4EPWA

Discovery of small molecules that bind to k-ras and inhibit sos-mediated activation
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
170
structure length
170
Chain Sequence
GMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Small Molecules that Bind to K-Ras and Inhibit Sos-Mediated Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords GTPase KRas
total genus 65
structure length 170
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4epwA00
1W2GA 2JLSA 3B5JA 1F3OA 1G4UR 4F4CA 1AIPA 3G0HA 2FH5B 2GHIA 2ONKA 4WVFA 2OLKA 4G5RA 1W0KA 5FTKA 4PPQA 4E07A 2JA1A 3GJ7A 4JIMA 4MYTA 1K5GA 2FNAA 1TX4B 1K5DA 1W1WA 1R0YA 1BYIA 2YNMA 1XB2A 5CB6A 4KXFB 1G8PA 3QXCA 4EDHA 2ZRPA 5F98A 3ZVMA 1IOZA 1JECA 4Q01A 4B2IA 3WYAA 4Q7MB 4DSOA 4MRPA 2BIFA 2W0MA 4BLPA 1QHSA 3NDPA 1QZXA 1Z0DA 5FUXA 1OB2A 3VAAA 2BVNA 4CT4B 1GL9B 4L16A 1G7SA 1XCMA 4L9SA 1E32A 1UEJA 3M4YA 3SDZA 1XNJA 2VO1A 1GL6A 1WDTA 2QP3A 4NPHA 2QTVB 5TVKA 1LF0A 3CF0A 3CRRA 1XPOA 5JJIA 2J5XA 2QMUA 3OEHA 4Y0AA 2ZSFA 4URZR 3OE7D 2OFXA 2EYUA 1N6NA 4JBYA 2WKPA 2ZITA 3I72A 621PA 3RYTC 4B3CA 4IXNA 1II0A 1Z28A 5EP4A 3CR8A 1MO3A 4PSVA 2NG1A 3K0AB 1JJ7A 1KKLA 2DFTA 5FOUA 3QKUA 5D3MA 2D06A 1U98A 1DVRA 1NL3A 1WB9A 5FBQB 4B71A 3VX3A 2WSSA 1VDZA 2J1LA 3PITA 3SHWA 1MV5A 2J46A 4A9AA 1S3GA 1NF3A 3KDSE 1E0JA 1E9AA 2WKQA 4FI3C 3QQ5A 4QFMA 3U3KA 4KITB 3HYRA 4CRWB 1W2HA 2ASEA 3FPAA 2WWXA 3UPUA 4FMCF 4F4IA 4YDSA 1IJFA 3VFDA 2A3RA 3T1VA 5KU1A 2GXQA 2OE2A 3OZXA 4OI0A 1JJVA 5GJWC 4WZ6A 4LHYA 2I1VB 3CONA 3QBTA 1ZC4A 4Q47A 1OB5A 3C7KA 3THYB 1TUEA 5CK5A 1E2GA 1L4YA 4DB2A 4DLSA 4BRUA 4DSTA 2NO6A 3OESA 4LY6A 4MRSA 3MWLA 4J0QA 4JJZA 5JMTA 4JL8A 3I8XA 1K8RA 5FL3A 2OXCA 1M7GA 4NU0A 2TMKA 4R2HA 1P61B 3GMTA 5GJCA 2KBFA 3QF4B 4ASUD 4AURA 3O47A 2QEQA 1DAFA 2C8VA 3EIEA 1JB1A 1KI8A 2AWOA 4JVLA 4TLAA 5LD2C 3R20A 1II9A 4HB0A 2ZE8A 2QT0A 1OKKD 3PUVA 4RD1A 1YR6A 3VQTA 4LJ8A 3VX4A 2OO7A 4B35A 1P4SA 4POAA 5F2EA 3IKJA 4X8MA 4TLCA 1N0VC 1GZSA 3PUWA 1U99A 3BS4A 3NEYA 2WVJA 4G5GA 4A8JB 4JKYA 2WWHA 2DFLA 1LTQA 2XGJA 1CJTC 2J59A 3TK1A 5FPTA 3WNCA 4EFMA 4TYNA 4C2TA 5E95A 2BCGY 2A5DA 1JXMA 3AKYA 1N5IA 3FKQA 4M53A 1EFRA 2HV8A 1Q44A 4Q1AA 1P62B 2BHRA 1GRNA 1ZM3A 2EFGA 4RJLA 3TSOA 1KNXA 1W0JD 3LWNA 1OW3B 4NCHA 4C0LA 5HE8A 2JJ2A 1MKYA 1SXJC 3QXSA 4ZI2A 5TB5A 2D7DA 1RE0A 4C7OB 3TR0A 1KZ7B 3C8UA 1DARA 4GMXA 4RFSB 3C16C 4YLGA 4DEXA 4A36A 4QHTA 1E2FA 2QY9A 4LV6A 4D0NA 1CP2A 4HATA 4QGAA 4D0LB 2CL6X 4TT3A 1X8JA 3RWMB 3LV8A 3TVDA 1GM5A 5FL7D 5SZJA 2J7PD 4XOIA 1ZD1A 4LBWA 4Z54A 1VYVA 1KDPA 2WMNB 4M1WA 4UNSA 4R71A 3RWOA 2P0EA 1MO5A 1P9RA 3ONWA 3UWOA 5HZKA 4AKHA 2CCKA 4JLBA 4KV9A 4N0DA 3AF1A 3ZVNA 2FFHA 1Z63A 3OAAD 2GXSA 4C0AC 4DEYA 3K09A 1MT0A 3H86A 2CL7X 2YJTD 3LO5A 5DI3A 2XTNA 4Q1FA 2ZTSA 1TAGA 3MG9A 4XWAA 4ARZA 1T3HA 1QBKC 3U3MA 4YONB 5IT5A 4ZV4A 1OH7A 1Q22A 4IDNA 1WF3A 2C2HA 4L15A 5E3HA 5JS7A 3FFBA 1KMHA 2GZDA 1CJUC 4NCNA 5CJ2A 1CBUA 2ZRKA 4XVRA 4G1UC 3FVQA 2C9OA 4Q18A 2OCYC 1L4UA 2HLDA 1TQ6A 2RH5A 5EQTA 5AK0A 4BEBA 3KUDA 1D5CA 4PQFA 2V3CC 1AZSC 2UVQA 3C41J 2R2AA 2GVDC 3EPJA 1G9XA 2DFNA 1HT1E 4W7SA 3GLGA 1NLYA 1BMFA 1TF2A 1EX6A 2P3SA 2QG6A 1N5KA 3LAWA 3UG7A 3X1DA 3BFKA 1XD9A 5AUQA 1YZKA 2GZAA 2VP9A 5AJXA 4A8JA 1NBMA 3QUSA 3LW7A 1Z6AA 4D0GA 5EE9A 4KO8A 1E9CA 1N2CE 1U9IA 3GD7A 3O8BA 2BOVA 3IUYA 3RRNA 3QXJA 2IYRA 3WYGA 3RANA 3IEVA 3ZH9B 3X1YA 1S4QA 4KYUA 4M21A 1RW4A 3K9LA 2QBYA 3A6PC 2J41A 4YQFA 3CZPA 1G64A 1NJGA 1UDXA 4EUNA 2G88A 2Z6VA 3WMEA 4KJZA 2LWIA 3SFVA 3UIEA 2GTPA 2IX3A 2QPOA 4TLBA 3CWZA 1QVAA 3GJ4A 1KDOA 3V9PA 3U6BA 5EP3A 5P21A 5DN6A 4NYJQ 5G53C 1OH5A 1W5TA 3B6EA 2WZQA 3AGQA 3HU2A 2GAOA 1NVVR 1NY6A 3AKEA 3QG1A 3U7HB 4CVNA 1XMVA 2JLQA 3IO5A 4H1VA 2D2FA 3LXXA 1MOZA 4XD7A 2AD5A 2C98A 1ONBA 1SXJA 1S0UA 3Q8XB 2G3YA 4IFEA 4KBFA 2XZPA 4OHWA 3SYNA 2IXGA 4BFZA 1NNEA 3ETLA 4TYWA 1KK0A 1ZUIA 2ZRIA 2ZRLA 3DO6A 4LRWA 4QHYA 4BQSA 4QNRA 4DDWA 4HZUB 1T8UA 3DHWC 3KQLA 2XSZD 1QHHA 2GJAA 2QENA 3CPHA 3B9PA 3RS3A 1HURA 2R62A 2W6IA 1Z5ZA 4PFSA 3CH5A 1RJ9A 2Q9BA 4PSKA 2WV9A 4R9UC 4YXWD 2ZAOA 4JLOA 5DH9A 1E3MA 1EG7A 2F6RA 4D6PA 1GKYA 5KPJA 3CNOA 1KDTA 3NTUA 3U61B 1TMKA 2C9CA 3MAAC 1GWNA 1XRJA 2D3WA 2IF2A 4N0EA 5BQ5A 1CTQA 4JYBA 2BBSA 3A1SA 1BS1A 3BIFA 4NTZA 2FU5C 4PAOA 2VSXA 2PT7A 2R44A 5G41A 1ZAKA 5J4HA 5KHOC 1G1MA 1KO8A 2IXEA 1XDBA 4XTCS 5H8WA 1P2TA 4OQMA 3AP1A 6Q21A 4O2LA 3CPJB 1XEWX 1ZC3A 4DT1B 1YZQA 1KJZA 3C15C 3KUCA 2FSIA 3PV0A 5EXSA 5EXPA 1H8HD 1ZUHA 3TJZA 2BDTA 3CKLA 3K09C 3SYKA 5KSYA 1KI6B 4PAQA 4B3XA 2WPDD 3LVQE 1GUAA 2BBWA 4YC7A 1II8A 4QGHA 2QGZA 5JZVA 1II8B 4V0MA 3NVAA 4EQ6A 2UKDA 4NCJA 3UG6A 1XTKA 5A0FA 4KFSA 3T5GA 4DT1A 1GTVA 5BN3A 1DOAA 3A8TA 3CRW1 4TQUS 1XTJA 5FPKA 2IHBA 2PJRA 4HUQA 4OQLA 3B2EA 4I1SA 5GJVC 3EPKA 3L0OA 4MKGA 4PC1A 2AX4A 3SYLA 1UAAA 2H16A 1WE2A 5A5GA 3MJRA 1DAMA 2YVUA 2GILA 2C78A 2ZRJA 1KAOA 3T34A 3SJBA 3AKCA 4Q1EA 4TMTA 1U9IC 2NPFA 1AN0A 3T1TA 4BUJA 3EX7C 4WXRA 1G8GA 5JWOA 2H1LA 2FJUA 2ZPTX 4L4UA 4PPFA 3IDQA 1W0JA 4ABYA 1DEKA 5CIQA 3LRPA 5JJLA 3LDAA 4JZKA 2IS1A 2O8EB 3NG1A 4BE7B 2C99A 2XITA 4U5XA 1IONA 1P2VA 2WM9B 3EA5A 1XZPA 2XXAA 5IDVA 4MITA 2IF0A 5AUPB 4QHSA 5BYJA 5L3SA 4Z51A 4B43A 3OHMA 4UJ5A 2XXAB 2VSOA 2QSYA 3VU9B 1ZM9A 1SVLA 3KJEA 2IS6A 4BFUA 3GEIA 2VP5A 4TMZA 2VF8A 5DO9A 5LB4A 3GLHE 1Z06A 1H65A 2VBCA 3WHKA 4LV8B 3FYHA 5CLQA 5FR1A 5KNBA 2AFHE 3CUEF 2E9SA 3VHLB 3R9WA 1KY3A 1QG4A 1IN8A 3EZFA 3L8YA 4OJKA 2PL3A 3M0EA 5SZKB 4OI1A 3HU3A 3Q7QA 4KSCA 1N25A 1U0HC 3CB4A 5BWMA 1FTNA 2V7QA 1CR0A 4ARZB 3Q9LA 1KJYA 2BKUA 4HSEA 3AQ4A 5HTKA 2ZR9A 2NO1A 2R8RA 2WSMA 4QL3A 2ZYUX 2N46A 3ZIAD 1CXZA 4Z1MA 3RSOA 4GFDA 4QG7A 3LFUA 2YOGA 2GKSA 1VG0B 1CULC 4URXR 4H9GA 3DM5A 2F7SA 1BIFA 1M1YE 2CHVA 2L0XA 4I1UA 1E1QD 3GLIE 4D82A 2VTKA 4ZCIA 4OKSA 3O8CA 2IYWA 2IL1A 4OHXA 4UNQA 1UJ2A 3QE0A 2VH5R 2HYIC 2DWQA 1CR2A 3GLGB 1N3BA 3BRWD 3SQXA 1A5TA 2ECKA 2VQSA 2FOLA 1P9WA 3GQBA 4D80A 1G6HA 4I81A 1SULA 2VL7A 1RRPA 1R6BX 1VYTA 1CS4C 4JLNA 4IVRA 1WXQA 1N6LA 3D7MA 3R7WA 1Q1QA 3EWAA 4Q4AB 4BFVA 3ZJYA 2ZETA 4UKDA 3AH8A 4PC6A 1XXHB 2JJ8A 3THYA 1YVDA 2IYSA 4LJ4A 5TXGA 3UMSA 5KO2A 4D4KA 3TAHA 1T8TA 5J5CA 4UXJA 2CHQA 5GADl 1YR9A 5SZIA 3K0FB 3GLFA 1CJKC 2CLCX 5KNCA 1X8LA 3U4QB 3NWJA 1KI1A 1UKZA 1TQ2A 4Q7LA 4C4PA 3UWKA 4EJSC 2V1XA 5BN5A 5JRJA 3A36A 1FX0B 3LBNA 5M04A 2ONJA 4RD0A 1SVOA 4D4LA 1ZD9A 2JATA 1ZINA 2R9VA 2HXYA 2QPTA 1LS6A 2ZRMA 1J7KA 2HT6A 4Q5IA 4G5OA 1IXSB 1E94E 1FPMA 1ZNWA 2V9PA 1N5JA 3K70B 4B2PA 1E1QA 1R4AA 3CR7A 3DOEA 1D2MA 2ZE6A 1T0HB 3AUXA 4OK6A 4UJ3A 4V0LA 4MDEA 4FXPA 1E9EA 4PXAA 3RRYA 5CIWA 2ZE7A 1NRJB 5FBRB 3A58B 3K0CC 3OEED 4MRNA 1LW7A 3GPLA 2YC4C 2Z4SA 3GJ3A 1R8SA 4G3XA 4MYUA 2Z43A 1KZGB 1OYWA 1D9XA 1ODFA 2IS2A 3QKTA 2WOJA 3W6PA 2GK6A 4HLUA 1E99A 3ZS9A 2W2TA 2OT3B 1W4AA 1ANKA 1QHXA 2MMGA 3BGWA 4HAZA 4C0BA 2PEZA 5FH9A 3IEUA 3A4MA 2ANCA 1NBMD 3RSLA 3K1JA 2JLVA 3FMPB 1SGWA 4M1KA 5CB8A 1OV4A 3I8SA 4BZXA 2A30A 3CLVA 1N6PA 4EKDA 1K6MA 3U44B 1ZIPA 2ORWA 1HH4A 2KB0A 4PX9A 4CEIB 1OXTA 4MYHA 4R98A 5CYPA 1FX0A 5E7MA 4A15A 1XXHA 3BFVA 2O8DA 4E09A 4RZXA 3JVVA 1G8YA 3KKOA 2ZRCA 4UNRA 3A1WA 4CF7A 1KNQA 2ZI5A 4B44A 3AVOA 2H18A 2LKCA 1KDRA 4JMPA 3W6OA 2QE7A 1AS0A 1AS2A 3FB4A 3VTKA 2KWIA 4PHGA 4LPSA 4V02A 5HE9A 5HR5A 4Q03A 1IXZA 3GEEA 1D8TA 2PH1A 5K8UA 1W48A 4JLAA 5FFMA 2XNSA 2ZRNA 1FNNA 2G0TA 3RDPA 3SC3A 2WJJA 4NCIA 4IHQA 2GXAA 3KZ1E 2ZREA 2I3BA 3V4FA 1PLJA 2B7CA 3KXLA 3VR1A 1KSHA 4GZLA 2D74A 2ODNA 1AA9A 3BXZA 4UXHA 3BOSA 3GLGE 2XOKA 1WP9A 3IIJA 3F8TA 4QBFA 3OFNA 4AG5A 3K70D 1XD8A 2DWOA 1JI0A 1Q21A 3ZZ0A 3L0IB 3L2OB 5JEDA 2O8FA 2R6AA 3W8RA 5DE3A 1E6CA 2B21A 4EFNA 3FHTA 1NP6A 3KQKA 4PO9A 2JASA 5DISB 4QGGA 2PZFA 3RRZA 5JSZA 3I5XA 1Y3AA 4GDFA 3JZMA 2VIIA 2GDJA 1BYUA 3UXMA 3C14C 5LBIA 1RRFA 3SNHA 1GL7A 5EUMA 2AFIE 1OE0A 3DMNA 4IKEA 3QSYA 2VP0A 3BB3A 2JLWA 2IYLD 2V6JA 5JCZA 3CRVA 1Z0FA 3ADCA 3WNBA 1AS3A 4GI7A 3PG5A 3TIFA 5L3SB 2QAGC 1W7AA 121PA 2O8BA 4D4JA 2FSFA 4D81A 3S1AB 5F9HA 4HLQB 4QXAA 3EAQA 2PLRA 3SHFA 3GJXC 3RS2A 1VG8A 3MWYW 1OFHA 1R0XA 1KI3A 5IRCD 4LDJA 2WMOB 4W5WA 1KI4A 2HF8A 1JEDA 4C0SA 3U7GA 3THWB 2XNDA 4HYYA 3RRMA 3J81k 2XZLA 3MWJA 4D2IA 2ZI6A 4E5UA 5DSZA 2O0KA 4DCUA 4UQOA 1QDEA 3WY9A 3SFZA 4LJAA 2A5YB 1QF9A 2AHOA 2OAP1 3U3RA 4B3BA 1OIVA 2NZJA 3W3AA 3ZZUA 1A1VA 3GLFB 3AP3A 5BW8A 1Z0JA 3PUZA 2VLIA 4G5QA 4M9SA 3UATA 1JEEA 3RS5A 4AK9A 2C95A 1CRQA 1TEVA 2QBYB 2WSSD 5JEEA 1A7JA 1OH8A 2P6RA 1NVWQ 2Q21A 3ICEA 1XEXB 3SI7A 4GRAA 5HCIA 1DO2A 1M34E 3QKSB 1LY1A 3QPUA 2QE7D 5AUNB 1W46A 2JCSA 3QKSA 4KFTA 1RC8A 2D2EA 4JLJA 3EXAA 3RNLA 2O8CB 1SKQA 4TQAA 3LH5A 1M2OB 3ECCA 1UFQA 2FGJA 3CH4B 3SJAA 2Q3HA 1GFIA 1GKUB 4EAQA 2ZU0C 4XSGA 1V43A 4DJTA 5CM8B 2X77A 2JAQA 4KLZA 1J90A 2XTMA 3VR6A 3NHAA 4JKIA 5TY0A 1GRRA 2OCBA 3PUXA 4LWZA 2XSZA 4LC0A 1HEIA 1M6NA 1XF9A 1UADA 4FN5A 2P2LA 3KL4A 5FBWB 2VP2A 4YMUA 2HLDD 3THXB 5C18A 1NN0A 1JR3D 4M22A 1AQUA 3EW9A 4M1MA 1N0WA 1Z6GA 2H7VA 2FFQA 2GBLC 2J45A 1IY2A 4HLDA 4Q02A 4Q1BA 1UBGA 2C03A 1KHTA 2JLXA 2RGNA 4JT4A 4Q4JB 3TGPA 5FUWA 3BC1A 4ZI3A 3W8NA 4ESVA 2VHJA 3OIWA 3PCRB 2BEKA 3E1SA 4LOAA 4P32A 4DZZA 3RC3A 1BO6A 1RIFA 4AY2A 5B30A 2QL6A 4JLMA 4KFUA 1SVIA 1WRBA 2IBMA 4LI0A 2QQEA 3BK7A 1OF1A 4FCVA 1OFTA 2ZYVX 3BE4A 1EESA 4CEJB 3IO3A 1HT2E 3A4LA 1CKEA 5K8LA 1T91A 1W44A 2FF7A 2ZYTX 2VEDA 5D3MB 1SXJB 3SU8A 2OXRA 4IOLA 1RFLA 1FTSA 2IYUA 4RZ2A 4LBYA 3IBGA 3MD0A 3TW8B 4CYMA 3LA6A 1EK0A 4Q1CA 4KLNA 3A1VA 2ZJOA 4V0KA 5CITA 2GCOA 3P26A 3EZ6A 5FTLA 5JSZB 2RGXA 3P20A 3I5YA 4HAXA 2ZQ5A 2NPIA 1NSFA 3ZGXA 4XH9B 1AK2A 1U8AA 2WJIA 3VNVA 2KBEA 4NKRA 1IY0A 2FPMA 2BMFA 3N2IA 2XNDD 4O3MA 3AKDA 1Q1EA 2GAAA 1NI3A 4KODA 1F2UB 1OYYA 3VKHA 2X2EA 2Q9CA 2PZGA 3WHLA 3KXIA 4EPWA 5JFGA 4A82A 1BOFA 3HYTA 2AD1A 2QAGA 1GDDA 3B9QA 3B78A 2FN4A 5FOWA 1IBRA 2RHMA 2RKOA 4PZLA 1ZIOA 2PCJA 4Q7JB 1GILA 2CCGA 3QOFA 1W4RA 1MH1A 1EFCA 4QBHA 4DLYA 4Q21A 3U3JA 5IHPA 4DSNA 1W36C 4NH0A 2ODWA 3C5CA 1DG1G 5EE3A 2O8DB 2PMKA 1G8HA 2CXXA 2A9KA 5D3QA 3AVXA 2ZROA 1ETUA 4EPRA 2ZS7A 1E1RA 3FKSD 4E22A 4Y0VA 4RKFA 2H92A 4LYJA 4DLVA 1AKYA 4JVMA 2Z0MA 1U94A 2VF7A 3SBEA 3DEFA 4MYCA 3G5UA 3BH7A 2ZSDA 4HDCA 1NMYA 2OCAA 4C0JA 4ERNA 1TL7C 1Z0IA 2BC9A 2PX0A 3B85A 2J0UB 4YMSA 3EZ7A 4BZPA 5DGXA 4BASA 3ZQ6A 1E9RA 1I2DA 5FBLB 4IEIA 1RZ3A 1IM2A 1E2HA 5JECA 3Q85A 2XJ9A 1FUKA 2QPAA 3B1ZA 2FFBA 4NZYA 3WMFA 4JYCA 3AF0A 2G0NA 1LF5A 4MGZR 4K46A 4TT3D 4I1VA 4JLKA 2OSBA 4O2RA 2J9RA 1E0KA 1G16A 2EWVA 2VSFA 4URVR 3UANA 3CF2A 3B60A 2WAXA 5KNDA 2W2XA 5AR1A 2JLYA 2ZAMA 4NL4H 1GNQA 3LQRA 2OILA 2XEXA 4EPTA 1GKIA 1SVMA 2WAYA 1FZQA 3I1FA 3PQCA 3AVUA 4D25A 1US8B 4TL8A 3AF3A 2G1JA 3TSZA 2K5UA 4US0R 4XVQA 4DHEA 1KMHB 1T5IA 4LYHA 5FUVA 1DAKA 2JGNA 2F1IA 4M9QA 4PC3A 3EPHA 2QGNA 2G9NA 2YWFA 1DG3A 1S3SA 1X8KA 4B47A 2IEYA 4RD3A 1FMLA 1IN7A 4PC7A 5IK2A 3Q7PA 3N70A 1WMSA 3TKLA 1T4GA 1Q1ZA 1IHUA 4FMDF 4JS0A 4ZO4A 4NHOA 4H1UA 4AG6A 3CW2A 2WIAA 4LBVA 2GCOB 4PC2A 5L3RA 4A0HA 1P3JA 2GBLA 2F9LA 3I3SR 4MKHA 3GCGA 3HPRA 3KB2A 2RGNC 2WJVA 3ADKA 3WNDA 4US2R 5L3VA 3X1ZA 5JCPA 3LLUA 4IRUB 4RZUA 1OHHA 4PO8A 4LZZA 1E79A 4DC9A 1JBKA 4TLDA 2OBLA 4ZCMA 3C5HA 4M1OA 2QSZA 2BCJQ 1EGAA 3TQCA 1D2NA 1HYQA 1ZBDA 4HAYA 4Q00A 1NMZA 1RVDA 3LW8A 4BZQA 3EC2A 1GVNB 3MJHA 2CL0X 3QPVA 5G3ZA 1S1CA 4LX0A 5CDFA 4PSAA 1US8A 2C96A 2AKAB 1DS6A 2QA5A 4KVGA 4RFSA 4MDFA 1Z6XA 3T35A 1OJLA 2Z83A 2CHGA 5JRZA 1T6NA 5B58C 4ZDKA 1QVRA 1M7BA 4M1TA 3B82A 4PHHA 3RC8A 1HE8B 1W49A 4GPTA 1MR3F 3OEEA 3FTQA 2JLUA 1VMAA 3Q3JB 1SVKA 3HR7A 4QOSA 2ODBA 2HXSA 1NKTA 4URYR 4CIDA 1T3SA 2XZOA 1D2EA 1WBBA 3NKVA 4DCTA 1WQ1R 3T15A 3NBFA 3BH0A 3LXRA 1SKYE 2HDNB 2ZRBA 4AD8A 1PLLA 2CBZA 4RZ3A 4GOJA 3U5ZB 2JLZA 2J0SA 3QKRA 2REXB 1G5PA 3GEHA 3W6NA 4YDHB 2WKRA 4NYMQ 5HPYB 2R6GA 4K8OA 4Q48A 1O3YA 4C0HA 2ZVQX 3BERA 1ZM2A 1W36B 2GZHA 2DYKA 3NDBB 1S1MA 4LHVA 4M2LA 3WMGA 4I1OA 4C3ZA 1BKDR 2Q3MA 4P31A 2GK7A 1UF9A 3QF4A 4LK2A 4GBMA 5AUOB 2E87A 1UKVY 1S9HA 3MSXA 4MGKR 1CU1A 4S2EA 4A92A 3GFTA 1Z0AA 3IGFA 4B34A 1QRAA 1ZJ6A 2FG5A 5BYKA 4XVUA 1D6JA 1YR8A 3QJYA 4N1AA 4IJMA 1Q12A 2WICA 2B6HA 2GXUA 1Q0UA 1YQTA 4BLOA 1L8QA 4CEIA 3M1IA 1J70A 4RD4A 5BN4A 4ACAA 4NYMR 1XTIA 2BBTA 3I61A 2OESA 4OHVA 1FP6A 3GJ8A 2ZRDA 3PUYA 1TTTA 1XJQA 3OEHD 1V5WA 5EZ5A 3FHCB 2RMKA 4YMVA 4A6XA 5HKKD 4V03A 4ZPXA 2WTUA 3LQQA 4MA4A 3HP1A 1C9KA 4M4SA 4URUR 1UKYA 3RHFA 2IUUA 3VR5A 3TUIC 5ELXA 3ZD7A 3A4NA 3IIKA 4ZDIA 2KE5A 5H68A 2CK3A 4TSFD 1GG2A 2QRZA 1DELA 3ZD6A 3DMDA 5EXTA 4PO1A 2QUZA 4XWKA 1QHHB 4P4TA 4QM6A 4HEJA 1XEWY 1PVOA 1JPNA 2OV2A 4B6EA 1NY5A 3KQHA 2EW1A 2WPDA 2FV8A 4RVCA 1KMQA 1YE8A 3NH6A 1N6RA 1P6XA 2AXPA 2QMOA 4TL6A 2W2VA 3LD9A 1E2NA 1FQJA 4OBEA 4QC2A 2CVFA 4JVSB 1KAGA 2GRJA 1VCNA 2QN6A 3IIMA 1OHHD 4IOMA 4F91B 3GLIA 3IILA 1LB1B 4I99A 2DBYA 1OPXA 1U8YA 1IN5A 4ZDJA 1NBME 2RGAA 5EE0A 3T1OA 3VNUA 2FZLA 2IT1A 1SKYB 2IEZA 5EE5B 1KY2A 3MCAA 1KOFA 1KI7A 2F55A 4O25A 2AL7A 1KYIA 1P5ZB 2N42A 4JBXA 5KTYA 1HE1C 4EPXA 1RRCA 1Z29A 1I4LD 5HCNA 1DO0A 5FTNA 4JL5A 3CBQA 4FCTA 4KYIB 1PUIA 1DADA 2GA8A 2NMVA 3KFXA 4OQFA 1TU4A 2W00A 4FMCB 3F5FA 4CT5A 1G5TA 3BFXA 2IYTA 3K9HA 4OJQA 2PMDA 4IDHA 1RPZA 2QT1A 4XIGS 2J7KA 1CJVC 4MRVA 3IBYA 4DCSA 2DR3A 1U8ZA 2NO0A 4U7DA 2FE4A 4P3YA 2FDCA 2VP4A 1ZU5A 1U90A 4GP7A 4XWOA 4R7ZA 1XJCA 2V54A 4B33A 1TQ4A 2GEVA 2JDID 3R9XA 3RAPR 4DDVA 1TADA 3DVLA 4JL6A 3D31A 2BEJA 1E98A 4EFLA 1Z07A 1N6KA 1ZU4A 2RGBA 4TTRA 2OBMA 3SJCA 2WWIA 1E2KA 3BWDD 3U7FB 2ZSAA 4A6PA 3Q5DA 2G1KA 2BMJA 3TNFA 2P65A 5TDHA 3H84A 2A5GA 3K9GA 4ZDWA 4FCWA 1OIXA 4F7WA 3VHXA 2YWEA 1OXSC 2H57A 2WJGA 2BMDA 2OBNA 3U7EB 4YMTA 4LJ9A 4DLUA 4JLVA 4D4MA 2EYQA 3AVTA 1Q20A 1QHNA 1XMJA 4LHWA 2QQ0A 3QNUA 4A8JC 5DN6D 2ZYWX 2FMXA 3NC1C 4NYJR 5CLLA 4F4JA 2CLDX 2ZE5A 2FWRA 3A37A 4RD2A 3AVPA 2B8WA 1G20E 1FP7A 1PLKA 2AXNA 4P4SB 2ZUCA 5EP2A 1S96A 1G18A 2AKYA 1T0JB 1EWRA 1C4OA 1OIWA 1XJ0A 3KJHA 1XTQA 4TL9A 1R5BA 1DE0A 1P7CA 3CX6A 3AM1A 5E7JA 1P72A 1A4RA 4W5JA 3PEYA 4BFWA 1UBFA 2P5SA 4Q9JA 3T5DA 2BV3A 2WWWA 2IYZA 2F3RA 3ZIAA 1JAHA 2IYQA 3SJZA 2VHCA 1XD2A 2O5VA 3EWSA 3WP0A 1UPTA 2IWRA 1NG1A 1NVUQ 4L8GA 2YOFA 3U2QA 2YWGA 4M1YA 5ANRB 5EXXA 3DKVA 4KSBA 5H70A 1I2MA 5FBVB 1DBSA 5FOXA 3QF7A 1ZD8A 2OHFA 1KSGA 4TZ6A 1H8ED 1KGDA 5KSZA 3FMOB 3ADBA 2ZRAA 2V55B 5DIFA 4NMMA 1E9FA 1KJWA 2KI5A 2GEUA 5B2ZA 1G7RA 2OLJA 4Q1DA 4TZ0A 1EWQA 1NVXQ 2I1QA 2WWFA 3T12A 3GP8A 1TPZA 5GVRA 3KQNA 5KDDA 2UZIR 5TMPA 1JNYA 1E2PA 1NG9A 3SEAA 2ZRGA 4TMKA 5CJPA 4WAUA 3T61A 1G6OA 1ZUNB 3C4JA 4WBSA 4CGZA 1G4AE 1VIAA 2W6JA 1U81A 3OE7A 4QJ5A 4DUGD 8OHMA 2WIBA 2F3TA 2ZI7A 2V8OA 3PR1A 1CRPA 2Q9AA 2GVZC 3L8ZA 3U60B 4X8LA 3KTAB 2EFHB 2W0SA 4MGYR 4Q4AA 3DL0A 4CW7A 3QKRB 1GOTA 2CCJA 2YKGA 3MGCA 3R8CA 1ZVQA 4FWIB 1X1RA 2CE7A 2XAUA 3TMKA 5DI3B 4C0QC 2V6IA 4LC1A 1D9ZA 5C46F 4XTRA 3JVUA 1YRBA 5J4VA 2A5FA 4BRWA 5KDOA 3EZ9A 1M8PA 4A4DA 3P27A 3TRFA 4DIDA 4ILEA 1ZM7A 1NIPA 3BH6A 1PJRA 1JR3E 2GJKA 2VHQA 4QBIA 3GLHA 1G21E 4ZKDA 3NC0C 2EVWX 3OFND 1XX6A 4DLXA 3TR5A 1SHKA 1UBCA 1UM8A 1ZYUA 3SZRA 1XEFA 1SXJE 3CX8A 4UXIA 4HB2A 3CRQA 5DI9A 4FINA 4LJ7A 5FOVA 2O8CA 2EQBA 3IHWA 4IDOA 4G0NA 4UNNA 4MQBA 4OK5A 3SN6A 4XD7D 2ZXUA 1YZTA 3U44A 1XEXA 1HUQA 4B76A 1WBDA 3WXMA 4C0KA 4XJXA 2ZM5A 5JI3E 4CZ2A 2X2FA 1F5NA 1G3RA 2A5JA 3RS0A 3X1XA 1I4TD 4GSYA 1E2LA 4FD2A 4ASUA 4PZYA 1N6HA 5DHAA 1ZM4A 4EJSB 2DB3A 4Q7KA 1DAHA 2DHRA 3IQXA 4I4LA 3W5IA 3VR2A 4W9MC 3U6KA 4DWJA 2WJYA 4PHTA 2C9YA 1COWD 2V1UA 2ZIAA 3GLFE 1YJ5A 4IFBA 4DLWA 1VYUA 1N6IA 1Z22A 3NEJA 1X6VA 3K70C 1G3QA 4GNKA 4WZAE 4C7OA 3THOA 5JBQA 4AWXA 3RLFA 3F3YA 2GETA 4EIWA 1TF5A 2JJ1A 1OT3A 1OLOA 4B2LA 1N5LA 1SQ5A 4MGIR 5KYKA 3GLHB 3REFA 1MABA 2O8EA 3PFIA 2JJ2D 2ZVPX 2QP4A 4OHZA 2D4HA 3GJ6A 2ZJYA 3CF6R 3KKMA 2ODEA 2IW3A 3QVUA 3KJGA 2VHUA 1NKSA 1H8HA 3H4MA 2A2ZA 4AIIA 4DCVA 2ZJ5A 1R10A 4A0RA 5IK2D 3OIVA 1SZPA 3H1TA 4KI0A 4B32A 1JALA 1G3UA 2J7PA 4E03A 5KDLA 3P1JA 4LSGA 3SS8A 3TE6A 4U00A 3AVWA 2XX3A 4TQ9A 3QPWA 1YRAA 2A78A 3K0FA 3B1WA 2CDNA 4LJ5A 3W5JA 1PV4A 1COWA 4LPKA 3PJRA 3NBZC 2ZJ2A 2MSCB 5AJYA 3FOZA 4Z1MD 2IHYA 3LY5A 4TYPA 4MKFA 2HYDA 3SQWA 4B3GA 1AGPA 3E2IA 1A2BA 3AV0B 2BJVA 2F1HA 2QNRA 3CWQA 3L82B 3QIAA 3AEZA 1EFHA 1MO6A 3ZLJA 1Q3TA 4OK3A 5TARA 3VKWA 2HEIA 221PA 3P32A 3QVVA 1W4CA 4GOKA 2EWWA 4RD6A 1F2UA 4DKXA 2GNOA 2FSGA 4NCKA 2HCBA 2Q3FA 4HDQB 4HI0E 5FL7A 1U2RA 4TN1A 4WW0A 4F38A 1EFTA 4NYIR 3TAUA 2IUSA 2RGGA 2IA5A 2E1RA 4TMXA 2CJWA 2AK2A 4AYWA 2O52A 5HKKA 1KTVA 3DPUA 1GAJA 3ASZA 4RCYA 3PEWA 5C2JB 3SR0A 5JS8A 1VG9B 4K81B 2ZJZA 1XWIA 2QAGB 5FOSA 4AYXA 1ESNA 2NTYC 1ZNYA 5KPDA 2NO7A 1XU4A 2ZJ8A 2D7CA 3VMFA 5C4MA 1DAEA 1ZP6A 4Q9IA 1BMFD 2OG2A 1E0AA 1NN1A 1EFRD 2ZSEA 3D6TB 4DBLC 4GMDA 4CEHA 1IN6A 1F60A 3QXHA 4LCBA 4A0GA 4C2UA 4AKIA 3OIUA 4LYFA 4II7A 2Q0HA 2HT1A 3ND8A 1XPUA 4NE2A 3O8RA 4FMDB 2ZJBA 2YC2C 2WWYA 3ZVLA 2YYZA 4JBWA 3ND9A 3FFAA 4OL0A 4BFTA 1OSNA 1XMIA 3B8HA 3DKPA 5J4YA 5JHHB 1CJMA 2WJHA 3LX5A 1XZQA 1G7CA 1RYFA 1FNMA 2OCPA 2QORA 4Q9LA 1IY1A 5KSPA 1VECA 3NBYC 1HQYE 3KB1A 4XSHA 1H8EA 2HJGA 2MSDB 3R7WB 4Q19A 1R8QA 4EPYA 1G3IA 2CNWD 1ZNXA 1HTWA 1VCOA 1ELOA 1P60A 2ZS9A 1GNPA 3PEVA 3AF2A 1SVSA 4HB4A 4PQRA 3X2SA 3VKGA 4EQ6B 3NIBA 2XB4A 2QM7A 5UKDA 1E96A 4DLTA 1VHLA 3AP2A 2GF9A 1LNZA 1X1SA 4ZIRB 1X86B 1E79D 4TTPA 3PENA 3LNCA 1G17A 4LGMA 3MFYA 3HR8A 4PANA 3EC1A 5B64A 3K0CA 4KU4A 1SXJD 4BEJA 2DY1A 5FI1B 2YINC 4Z8YA 4MUAA 4PPNA 3FE2A 3TVTA 4ITRC 1SVWA 4R2IA 3TH5A 3BB1A 4G5SA 1VHTA 3HU1A 3KTAA 4HLUC 2BMEA 4LYAA 3ZDQA 1JPJA 1E2IA 1Y63A 2ERYA 5GVSA 4HDOB 4Z8XA 4Q9KA 3WBJA 4TYYA 2KSQA 3B1YA 2UZ3A 4KCGA 1AKEA 3QY0A 4BPBA 4TTQA 3NXSA 3T06B 1W47A 5EP1A 3KKPA 5BXQC 4M1SA 3AVQA 1MRNA 2GEDA 3I62A 3O8DA 2CLSA 3CX7A 4YMWA 1VG1A 4Q9HA 4IW3B 1S8FA 3WP1B 3TLXA 4P4UA 1IJEA 2I4IA 2Z5FA 1YZLA 4MKIA 3TW4A 2JIZD 2A7QA 5E4FA 4WXPA 1ZCAA 4TMWA 3VR3A 2J0QA 2PZEA 1P9NA 2CVHA 1TQDA 3LBHA 3TUZC 1CR1A 3TQFA 4V0ME 1O87A 1F2TA 2HUPA 3BAFA 3CO5A 3FHOA 1U0JA 2YZ2A 4QNMA 4A1FA 1G291 1FFHA 1TEXA 3A1UA 2WWGA 3B1XA 5J47A 2QTFA 1KIMA 4B75A 4FIDA 3GFPA 1ZW6A 3KX2A 521PA 4PR0A 2GWHA 1PZNA 2DFKB 3QG5A 2QROA 3QI2A 2EFCB 1F2TB 4BWYA 1RJ9B 2OUKA 5J4KA 5KOYA 4GL2A 1AM4D 1A2KC 2RHDA 4TMVA 1E9BA 4HLCA 1N0UA 2V7QD 3CNNA 2FA9A 4GZMA 4QJ3A 4Q66C 5EZ6B 5F9FA 3IPYA 4TWZA 4IDPA 5CK4A 3MMPA 1RKBA 2VYFA 1FQKA 5FOTA 1U0LA 2CJWB 3BBPA 3P4YA 4JJKA 2NIPA 1YR7A 4Q4JA 4F92B 4PHFA 1Z83A 2SHKA 4DSUA 4EPVA 2JJ1D 1OXXK 2B7BA 1G5RA 3FKSA 2CE2X 1WA5A 1XD2B 4HB3A 2IK8A 4HUTA 5AJVB 2X8AA 1E9DA 1OFUX 4LBZA 4A2QA 1YU9A 2DPXA 1MO4A 4YXWA 1J8MF 4W5HA 5KUTA 1G8FA 3U3OA 4TSFA 3K9NA 1JQJC 3EIQA 2AWNA 2W83A 3WBKA 3HDTA 4DB4A 4HAWA 2OAQ1 4Q4LA 3ZYCA 1ESMA 2PJZA 2QAJA 4DRZA 4QGFA 3BJIC 3UMFA 4PPGA 5CYOA 3DDCA 1Q1BA 3R9IA 3ICQB 1Z47A 3V4RA 1LS1A 3H0KA 1S2MA 2GCNA 2ZANA 3SOPA 1GRQA 1VCIA 2PT5A 1F48A 3DM9B 3IHLA 1QHIA 1VCMA 2NGRA 1E2EA 2IUTA 3QXXA 4V0NA 1M7HA 4C9BA 3THXA 1XCGB 1XTRA 2F9MA 1EX7A 1G7TA 1W5SA 3CM0A 3WRXC 4Q4HA 4HUQB 1KK2A 1C1YA 1AZTA 3LX8A 5JJKA 2HJVA 2ZJAA 2IWHA 4RCZA 4ZIRA 2XJ4A 4PTLA 4MH0R 4LJ6A 4DIEA 3ADDA 3UK6A 1KO4A 5J4LA 5FPYA 4DDTA 1YZNA 2NZ8A 1FL9A 2ZSBA 3R8FA 4WA7A 1FUUA 1LVGA 2C77A 3CNLA 4KFRA 2ZRHA 2ATXA 5CM9C 4AC9A 3FDIA 3L43A 2DCUA 4G01B 3OAAA 1XPRA 1E2MA 4A2WA 1FW6A 5SZHB 2NQ2C 3EZ2A 2P67A 1P2UA 1J8YF 4LJYA 5LPNA 2PBRA 4RSGA 5EJEA 5L3QA 2AR7A 1R0ZA 3ZQJA 2X19A 1Z2AA 4LHZA 2X1VA 3AVVA 1JR3A 2F43B 1NN3A 1E2DA 2FFAA 3D8BA 4P33A 5H1YA 1XFAA 5DLQC 4C30A 1B23P 4AKEA 1LV7A 2O0HA 3H2YA 4FMBB 1XTSA 1CR4A 3QBVA 3AVYA 5GJBA 1Q57A 1DAGA 3MUFA 2R6FA 4OI2A 2BWJA 1UKEA 3FGNA 2ERXA 4IXMA 1YKSA 1R0WA 3I73A 2GCPA 3K8YA 1X3SA 3A1TA 1FMJA 4CEHB 2O8BB 4KHZA 4URWR 2F1JA 5FTJA 3PXGA 3HPQA 5AJWA 2FGKA 4IEEA 1XMSA 1P73A 4DVGA 2ZI3A 3GJ0A 3K0SA 4HAUA 2OFOA 2RGCA 4GOXA 1JQLB 5DYGA 5LD2B 4BFYA 3KKQA 1GIAA 4M9ZA 4B3FX 2XB2A 1KKMA 2ZEJA 2G6BA 3MWKA 4M0LA 3GLIB 4HZUA 1E69A 2P6UA 2VHTA 3CIOA 3RVBA 4LHXA 4DDUA 3L0SA 2J87A 4ZCLA 1W4BA 2YOHA 3T1QA 5J40A 2DWPA 2CNWA 3W9YA 2QMEA 4RY2A 2XTZA 4AI6A 3ZZTA 1KO1A 1NMXA 3B7GA 3IQWA 2GF0A 3Q5EA 1E2JA 4DCNA 3EA0A 421PA 2CMKA 3K53A 1A82A 2ZR7A 1W36D 2HCJB 3X1WA 4BLTA 4IDQA 1DPFA 5LB2A 2AN9A 4BFXA 2REOA 3PEUA 1KSJA 2JEOA 4IVPA 5DYIA 2FEOA 2PX3A 3DZ8A 1E9SA 721PA 3V00A 1VIYA 2ZR0A 1E4VA 3HJNA 4TYQA 3G82C 2QZ4A 1CF4A 3KXKA 2BBOA 2W58A 5DHFA 1T5LA 1DTSA 5FR2A 5FTMA 5EUQB 3CRMA 2Z4RA 3FMIA 1UBEA 1GSIA 4LUCA 2OFWA 2D62A 1T9HA 1SHZA 3TBKA 4OI4A 5IF9A 2V4ZA 3QENA 3ZS8A 1P75A 1I4DD 1G41A 2EU8A 2WHXA 5JWRA 4LV5B 4MRRA 1YHNA 3I32A 1GNRA 1R5NA 2NO9A 4P0TA 5CDFE 1E1RD 1Q3HA 5JWHA 2G77B 1XXHE 4BLRA 1KK1A 2ZI4A 3L0PA 3Q72A 2QU8A 4DLZA 3MRSA 5C1BA 5KSOA 3ASYA 2FPLA 4NYIQ 2GJSA 5FPSA 1ZRHA 2EFEB 4QJ4A 2JLRA 2EFDB 2RGEA 3DOFA 3K0EA 4PQYA 4ESHA 4AKGA 1JAIA 5B57C 5K8IA 3TSWA 2VA8A 3N2EA 3AGPA 2ZI9A 4DXAA 1UDWA 2P5TB 1Z08A 1HA3A 1KO7A 2LCFA 2R65A 2REBA 2GJ8A 1CLUA 4OQXA 1IN4A 3SE0A 4PAMA 5FUYA 1M74A 1OH6A 4NDZA 1AQYA 5L3QB 3PIRA 1GITA 1Z6TA 2FEMA 3LLMA 2MMCA 4OHYA 4OYHA 1OKKA 1NVVQ 5C4GB 3EPLA 1G3MA 4QKQA 2ORVA 3GFOA 2R6CA 1JR6A 4FW9A 4TLEA 4WZBE 1KI2A 1OXUA 4CEJA 4B73A 4B3DA 4BGDA 3FMFA 5EE1A 1E2QA 4L9WA 3AUYA 2FZ4A 2BM0A 2WBLC 2ZUBA 3AB3A 4MUBA 2RB4A 1HY3A 3NBXX 3P4XA 4L5BA 2HF9A 1KO5A 4QM7A 1IXRC 1AGRA 4V0OA 2PCLA 2N1BA 1MRSA 3JZAA 3RS7A 1CEEA 1NLFA 2ORIA 2Y8EA 3EG5A 4IOJA 4ZKEA 3TUJC 3AF4A 2P6NA 4DUGA 4PZZA 3HWSA 4RKEA 4ACBA 1KSFX 2O0JA 3WYFA 1R7RA 3UMRA 4UNPA 2F1RA 2H8KA 2IYXA 1QHGA 4KAXA 4JVNA 1NJFA 1Z3IX 4HZIA 2WOOA 2QI9C 2KJQA 3REGA 3E5HA 4O0MA 5A4JA 3IPXA 4RFVA 1HV8A 2R6DA 4M8NE 4JT2A 3E70C 2IS4A 3QEOA 4S35A 4BLSA 1AJEA 3UKDA 3D3QA 1XP8A 2C5LA 2ANBA 2J0VA 2J0UA 2XOKD 1TUIA 1DAIA 2IYVA 4US1R 3U4QA 2MSEB 3W34A 3CPEA 2ZS8A 1Z2CA 1VKJA 5FPHA 1UEIA 1G19A 2BM1A 3BD9A 4NP6A 2FSHA 2JDIA 2W6ID 3QEJA 2B8TA 4NBSA 1E4YA 4ON9A 4X8OA 2W6JD 4FWTA 2ZU6A 3FWYA 1KI9A 4F93B 2G83A 3SBDA 1GP2A 1NLZA 5FI0B 1Z8FA 1VPLA 2J3EA 1N6OA 1WCV1 1TNDA 2IXFA 2VPPA 3EASA 3LVRE 1RYHA 1JXOA 4Q4HB 2FPKA 4QBGB 5AWFC 2ZUDA 2QM8A 4N3NA 3DZDA 2GESA 1CIPA 2YWHA 3PVSA 1QG2A 2LKDA 3KJIA 1QHYA 3N5CA 4JSYA 1ZCBA 2VRWA 3RABA 1E0SA 1RRGA 1MABB 2BJWA 5TV2A 3GJ5A 5L8VA 3B1VA 4WOPA 1VTKA 4CDGA 1L7VC 2Q6TA 3VR4A 1P2SA 1F6BA 3EIHA 3W90A 2FX3A 2PEYA 3NHBA 1NN5A 2CEAA 2OZEA 3CZQA 1W0KD 2OM2A 4D26A 1EXMA 1XCPA 4B6FA 1B0UA 1Z6YA 4IVQA 3VU9A 1HQCA 1TF7A 2QP9X 3BB4A 3S1AA 2QRNA 4BLQA 4EJSA 5K8TA 1KI6A 2JIZA 1KK3A 2AK3A 4P4SA 5HZHA 4U02A 4QRHA 1ZMXA 3M6AA 3KKNA 4A0FA 3KFVA 4NONA 1LFDB 1FOEB 2OEPA 2RGDA 4DLRA 4KVAA 5G3YA 3LBIA 4KBGA 5F3WB 1XBTA 1Z0KA 2YV5A 4JLDA 4JLPA 4WIAA 4AYTA 2CK3D 1NSTA 3OIYA 4X8HA 821PA 4GT1A 1EFUA 4TL7A 4M9XA 2IC5A 3OF5A 3NH9A 2H5EA 2QMHA 3B13B 2ATVA 3RS4A 2C04A 2O8FB 2ZRFA 4IOKA 3I92A 2BKEA 2IYYA 1R5OA 4OQNA 4GP6A 1PUJA 3WRYC 5DNYB 1IAQA 3F0TA 3K0AA 4BECA 1L2TA 2RCNA 1T3LA 2VP6A 2F43A 2GJ9A 2H17A 3THWA 3ZVRA 2RAPA 1OXVA 4A2PA 1YZUA 1J2JA 3MLEA 3W3ZB 1YZGA 5LDDC 2PLFA 5AJZA 2NOAA 5E7IA 4HAVA 1IQPA 1OFIA 1J99A 1ZNZA 2YHSA 5JI2E 2QTHA 5JHGB 2B92A 1TU3A 5JLJA 4JSTA 4B48A 1BH2A 4B74A 3I4LA 1R2QA 1S9DA 3BORA 1NIJA 5G40A 3KQUA 3EARA 4BFSA
chains in the Genus database with same CATH superfamily
3QVLA 2WNHA 3B5JA 1GZ4A 1XZEA 2L19A 4PM4A 5F73A 1FY2A 4EJMA 3ZIDA 3DLHA 5KJEA 1IBLB 1CDZA 1U0EA 4LISA 3A14A 4JEHA 4PPQA 5SY4A 5D86A 1M1XB 1VQ1A 4Y1RB 4Y7CA 3WYDA 4BC1A 4IJQA 4OUDA 4MYTA 1K5GA 3I3OA 1Z2DA 2I91A 2FNAA 2WU3A 1TX4B 3MINA 4BAGA 2BTOA 1SUFA 1E18A 5JAUA 4YWJA 3CT6A 4Q4CA 5ELLA 1BYIA 3ESQA 1I33A 3A2NA 3FTEA 3U09A 2VUHB 4DAEA 4KXFB 1G8PA 4YFVA 4EDHA 1JSCA 3W78A 4D42A 1AU9A 1Q0HA 3ZOKA 2JARA 2ZKIA 1HT3A 4MUEA 3ZVMA 3TZCA 4MKXA 4RXMA 3EPRA 5A02A 3D6HA 4Q7MB 4ER3A 4RK0A 5K99A 2W0MA 3R76A 1QHSA 2I29A 3CKYA 5FUXA 1OYVA 1GKKA 3R6GA 3TFQA 2BL4A 1GL9B 4C6TA 4YP5A 1JG2A 1TA0A 4KGVA 4B7UA 3M4YA 4MW5A 1TYCA 2WKSA 4JQZA 2G76A 1HEYA 4K3UA 1GQYA 3RV3A 2QP3A 4F3NA 1QH1A 2ZB8A 4DCOA 4UBJA 4ZZ3A 4NPHA 5CCBA 2J0EA 4H18A 4Y9UA 5IXJA 3D6MA 2ERCA 3Q12A 4FT4A 3M3DA 2AJBA 3OEHA 3TW0A 3VO1A 3WVNA 4EG0A 2IQIA 1YR2A 1B0ZA 1LBQA 3CMCO 3L7JA 1QQ7A 5KVQA 3VHRA 621PA 5DW0A 3IAXA 3TM4A 4PBSA 1JR2A 3D7KA 2J09A 2LPMA 4NU8X 2NG1A 1D4ZA 3NBQA 5D84A 5FOUA 4TXMA 1OZ0A 2C82A 3D6UA 3PDWA 1HWYA 1Z25A 5FP0A 4B71A 3VX3A 5KYYB 1SOWA 2WSSA 4EG3A 1R8JA 4G37A 2J1LA 3PITA 1W8IA 4FJ1A 3SHWA 1MV5A 3D2CA 1NMQA 3BL8A 2Q4BA 4LMPA 3UYKA 4RIFA 1S3GA 2CHUA 4QFMA 1E9AA 4FI3C 4ER0A 3L0BA 3U3KA 4KITB 2HHHB 1NR1A 4IJWA 3HKEA 3HYRA 4IWNA 4CRWB 3FPAA 2WWXA 4I1PA 5JSUA 1D7AA 1YBVA 4FMCF 4F4IA 1JSZA 5HIIA 2IITA 2A84A 3AR4A 4EF4A 4TM7A 1IJFA 2QJRA 3VKVA 1ZN9A 2R1ZA 4RKYA 3C24A 4MKZA 3T1VA 2JFWA 3ZGYA 1C9YA 3E58A 2OE2A 2YNMD 3EHEA 4UHDA 5KU1A 1DJQA 3WRVA 2XUAA 4C4RA 3AUFA 1H2YA 1R6DA 3MTQA 5JFOA 4L0QA 5BOVA 1ZC4A 3WSWA 2XUDA 3C7KA 4HDKA 1EA5A 4HADA 1TUEA 1ULHA 4FN4A 1L4YA 1VHDA 3L7AA 4U7JA 1RE1A 1Y8QB 3UHPA 3KOUA 1TIBA 2PRYA 3KM0A 4BRUA 1FTWA 2NO6A 3E3LA 4G65A 3OESA 4KSYA 2BHTA 1Y5RA 2GA9A 3DXZA 3MWLA 2TMYA 2C9ZA 2B2XA 3QNWA 3K9FC 1NBWB 1VA5A 5CCDA 5GINE 5TF0A 1Y7IA 3SX2A 2Z2KA 1SU6A 3QEMA 5BWLA 1KQGA 5DYWA 2XB8A 1IUKA 4QQRA 2FWPA 2IE8A 2OXCA 2JIBA 1BWSA 3WAGA 3GMTA 2PGDA 2VF2A 1JAXA 3SZOA 1E1CB 2C1XA 2GPJA 3H5LA 3O47A 4GL4A 2QEQA 1DAFA 4B17A 5AVVA 1JB1A 1CW2B 3PNOA 4FZ3A 1LZKA 4LMAA 2CLOB 4JVLA 2VRCA 1GQRA 5LD2C 1PJZA 1RJGA 3LQ1A 3UUFA 2GX6A 2ZDHA 3HJCA 3JQAA 4AT1A 1OKKD 2O2SA 3PUVA 3NNSA 3VX4A 4D4IA 3IDFA 4ND2A 4EJ6A 1ZJJA 2W48A 5J3JA 5DBOA 1N0VC 1GZSA 2R00A 3OTHA 1LC3A 3BS4A 3NEYA 3IYLW 3FG9A 1QHEA 1RJWA 3EAFA 4Y6RA 3QPBA 2QXTA 2ZPUA 1WW2A 4UFPA 3TM5A 4A8JB 4JKYA 4HXGA 4KX3A 1XNGA 1J0XO 2DFLA 4M76B 1LTQA 1U2DC 4E15A 2XGJA 2OO3A 3GLVA 3TK1A 3T3NA 1XLUA 5H80A 4EFMA 3RUEA 2QF7A 4BHTA 4EG6A 1PI3A 1EHYA 3ZWVA 2HPVA 4RABA 1F7UA 3CLUD 2HY7A 3AKYA 4M53A 4ZAVA 3KZCA 2HV8A 1YQQA 3P9XA 3FJYA 1P62B 4QWMA 5EYPA 1CNFA 2BHRA 3QK7A 1GRNA 4BX2A 1ZM3A 1QB8A 3SPXA 5LQAA 1P5JA 4G4GA 2G6TA 4NCHA 4C0LA 5HE8A 3LCMA 1UP7A 3QXSA 1BCRB 3ECAA 3AHHA 3FNGA 1RE0A 1GZ6A 5TB5A 4ZI2A 5CDTA 4HRAA 3NIWA 3LPLA 4YQEA 3ZV7A 4LY3A 1ACLA 4GMXA 1P4GA 2ENWA 3FTDA 1TMOA 2PXHA 5IKOA 3DMTC 5D3ZA 2FRDC 4QHTA 4HWGA 4N9WA 1NP3A 3I2FA 1CP2A 1XO1A 1P5RA 4H59A 4HATA 4J4BA 1SY7A 1A9YA 2Q45A 4JWKA 4QGAA 3R7LA 2BZ1A 4D41A 2X2PA 3ACBA 4LBWA 1M2NA 3PRKE 3H2GA 4Z54A 1KDPA 2HA0A 1FLDA 1JIQA 1DRVA 1FYDA 2P4UA 3AZQA 4XAQA 3G59A 5DFAA 4R71A 4KFCA 1A76A 1MO5A 1P9RA 2GN4A 1Z5UA 3CUYA 3TZQA 2CCKA 4KV9A 5CCXA 4F9TA 1RBZA 3DBOB 3GJQA 5F35A 3VPHA 3EFOA 4D5EA 1A71A 2HSEA 1Z63A 4BQEA 3OAAD 3RRMA 1TZMA 4BNTA 1LUAA 1JJAA 3F5SA 2PUCA 1DCMA 1Q2XA 3FM9A 5BSVA 1RZUA 1X0VA 3DE6X 1K63A 3QVOA 2PR2A 3KZNA 4PTYA 1E8MA 2H5IA 5D1NA 1OASA 3AM5A 3C3WA 3OCCA 4Q1FA 5AOCA 4V1CB 2R4UA 4Q3BA 3MG9A 4XWAA 4JYMA 3JPWA 4EAAA 1YA8A 2PUDA 3RUPA 1ZGCA 4P35A 3M70A 4YONB 1POXA 1RM5A 4FFBA 2DU8A 4MPTA 1XTVA 1OPRA 4Y6OA 1XK6A 3RPEA 4MDEA 3G2NA 1MOQA 4ZMRA 2W6QA 1SCJA 3C8DA 3E9YA 3F6PA 3KEOA 5L4LA 4JI2B 3H87A 3SHVA 4BJ1A 3QVMA 3TQRA 1WF6A 2X3FA 3FFBA 1UC4B 1CJUC 2ZWVA 3ZHBA 3OM9A 3QU2A 2CXTA 2W11A 5E1BA 3IVCA 1KBQA 3D4PA 2BT4A 1E1LA 4G23A 2ZRKA 4IJ5A 3P96A 1PBNA 2XAAA 1P4RA 3H2HA 4G1UC 3FFWA 4WNIA 4X7RA 3VSAA 2Q3LA 1L4UA 3CA8A 2B78A 5SY9A 1T0UA 4JCCA 2RH5A 2H1IA 5JCJA 1HMYA 4QLBA 1N75A 2IOYA 2ZWAA 3KUDA 3RKSA 4IX9A 2O3TA 3C41J 5LR6A 2XQVA 1DBWA 1MGPA 5LKRA 1B8UA 1QVVA 3COPA 1PV1A 5EGNA 3EPJA 3JD2A 3PFWO 4HDRA 5KAMA 4MTLA 3RCBA 4KR2A 1PWYE 2XCTB 4GGPA 5CT8A 2P3SA 1QCDA 3KEQA 4EJ2A 4AJPA 4K9NA 3MELA 2DKNA 3UAYA 2HH9A 3DL2A 4M60A 2G9ZA 3F2IA 1UBTS 2XUHA 2QZZA 1XGKA 1EXWA 3DNMA 3O0DA 5AUQA 1MT3A 1LRLA 3SNKA 4PLTA 1JU4A 4UUBA 5E4TA 4P2BA 6ABPA 3K6JA 1J1ZA 3EN0A 2B1QA 1U9IA 3GD7A 2DQZA 2PG3A 3O8BA 4F2HA 1F4PA 2IYRA 2VNHA 3QXJA 1A9XB 1RPAA 3AFIA 3X1YA 4KRYA 2ZJ7A 1S4QA 1OROA 3FHLA 4KYUA 4M21A 4LZJA 4XIJA 2QBYA 2JK0A 1FRVA 2C1ZA 4LDRA 5EQFA 4EK9A 1NJGA 1OFUA 1UDXA 2GSWA 1EWKA 2CFIA 2KYRA 2P4EA 3TB4A 3TQIA 3WMEA 4BAZA 5AW4A 1UXJA 5ALPA 3H2ZA 2PS0A 2DP4E 3AG6A 3KHUA 2MCFA 4B0OA 1ZK4A 3IAS1 3C6XA 2NO5A 1CX9B 3L1VA 5LA6A 5P21A 1DBVO 2VNJA 4QXQA 3ZHCA 4M6WB 5DDIP 1U5CA 4CL0A 1OH5A 2VSNA 1W5TA 3B6EA 5JH7A 1H5UA 4LJKA 2WTMA 3OE1A 4HO1X 2INGX 2PVCA 3EUWA 5MF6A 1NY6A 3QG1A 3AKEA 3U9SA 3RV4A 5CJJA 4HXYA 5HS6A 4HQOA 4CVNA 3NBKA 2PSFA 4P84A 5L53A 1S3IA 1NJ8A 2XF8A 2ZWIA 3SYNA 1SO8A 5JJCA 4F04A 3QFCA 4I6GA 3UGJA 4ZYTA 5A3JA 4AMUA 3W2EA 1P0IA 3QBEA 5GONB 1UH5A 1X74A 1R3UA 1VDMA 2ZRIA 2QV7A 3C5VA 4G97A 1V35A 3OA0A 5E8RA 4BQQA 2CJPA 2X9GA 4HZUB 3DHWC 1RD4A 3CPHA 1LPMA 1O77A 2HMTA 3FSRA 4M0CA 1QH9A 4PFSA 2IVFA 3CH5A 3NHYA 3RT7A 2Q9BA 4CM4B 4ZO6A 4PSKA 1FFAA 1UPCA 4R9UC 3DZJA 3HE3A 4ZVLA 4EFLA 1E3MA 1EG7A 3OG9A 3PYMA 3SXJA 1N9ZA 1OVMA 3OQIA 4LXTA 4EHJA 2VJCA 1CZNA 1DX9A 3DBLA 4HH0A 5AW0A 3CNOA 1KDTA 1P6UA 3R2JA 3T54A 1TMKA 3IVRA 3NPMA 3U61B 2C9CA 3MAAC 3BFPA 1JKFA 1XRJA 3NV9A 3R7DA 3BZWA 3TOXA 3TEMA 1K98A 4QT4A 1CTQA 1R4NB 2IJGX 3Q9NA 4JYBA 1GZDA 4XQ9A 3B1KA 1QFSA 3F49S 4NTZA 4PAOA 2VWPA 3T9FA 4B6JA 2VSXA 1L7DA 2WJ4A 3RC7A 5G41A 4ROTA 4RTOA 1GTG1 1M2FA 3IQGX 3KXPA 2OR3A 2IXEA 4JT8A 5EZYA 3EGXB 1KPHA 5J63A 1GGJA 1P2TA 2IZ0A 5AKGA 1RMTA 4WY5A 1QMPA 4WXEA 1XEWX 2BH9A 2OVBA 2R8OA 1PWHA 4YFYA 4AMYA 5CDGA 3C15C 1KJZA 3OX2A 3PV0A 2FSIA 1E3QA 1PU2A 5EXSA 3SKVA 2O4UX 2WMYA 4G25A 5EWLB 2JVJA 3TJZA 3K09C 4BDSA 5JYCA 3PL1A 1HNNA 1Z73A 3LUBA 3R5SA 3JW8A 4GWKA 4PNEA 1OX4B 1YD7A 3OQNA 1VL2A 1IZ0A 1QG0A 2Y1WA 3H1BA 3I0NA 3ZVKA 2HHAA 2PRIA 4YC7A 1H4TA 1QCCA 1II8A 5HDBB 4JBGA 4WLVA 4PRLA 1GCOA 5TF4A 1NLMA 2G1PA 4QGHA 1LKZA 3KLPX 2QGZA 3ST7A 4G0WA 1F9AA 2EKZA 3OLVA 4H7PA 1O9BA 1L5SA 3GBPA 2FP4A 2UKDA 4NCJA 4W9NC 2W70A 4FEYA 5A0FA 4EQ6A 4FMPA 2FEWB 2QG9A 2WU0A 1H66A 1PR6A 3ICOA 4KFSA 4NAHA 4BWVA 1GTVA 5BN3A 4UVIA 1JQAA 3CRW1 1SIBE 4RXUA 1V45E 2H4FA 1VSTA 2HIMA 2PAFA 4I1SA 4MYDA 3ICWA 3KP1A 1ZI8A 3HDGA 5A6SA 1AE1A 2J6CA 4KQMA 2CUNA 5FDFA 1YAHA 4LA4A 4MKGA 1IUPA 1NXTA 2AX4A 3EUEA 4U6SA 4RE5A 1TJNA 4PFQA 4U2FA 4XLZA 2GQ0A 1WE2A 4RULA 2YVUA 1JAZA 1ZONA 2C78A 3PF8A 4F5ZA 1KAOA 2R7AA 4ENRA 1GZ3A 3T34A 4DQDA 3SJBA 4UCFA 3ISJA 5ALWA 3Q8WA 2PH3A 4Q1EA 3G88A 5LYJB 3PL5A 4NH4A 4N7RA 2O7NA 1KEEB 5B4TA 1QTRA 1M1UA 2Q2QA 4ND1A 4MQ4A 4QYXA 3R09A 1NI4B 4ITVA 4WXRA 5JWOA 1PEDA 4HX9A 5E8JA 5H59A 4B3JA 1ZKDA 2C0QA 1TFRA 1DEAA 1YZVA 4QX6A 2YQZA 3HJRA 4OATA 4TUYF 2Q4EA 4A7PA 3NYIA 5F4ZA 5B36A 1LPOA 2C3UA 1ZK1A 3LRPA 4KXUA 3T7IA 2IS1A 3NG1A 1K3TA 4BE7B 2AMJA 4RANA 4QEKA 2ZSKA 3EMBA 5AHWA 5LZ7A 3S40A 2WM9B 1UK9A 4RHCA 4XSVA 3GA0A 4F3RA 1R4ZA 3GRKA 4KIGA 4DARA 3RVNA 5AUPB 3QE4A 3WGJA 5BYJA 5I5GA 3FPKA 4HPWA 2RK6A 4R8VA 4XQ0A 4Z51A 2M2IA 3KK0A 4PYKA 5KTOA 5KYUA 3VPGA 2FPOA 1SVLA 4NAUA 3R5KA 1ISHA 3DHVA 4LXXA 4PG4A 4WFQA 3AR7A 4BFUA 1Z12A 2B1IA 1Z06A 2ZBDA 4WLUA 2H85A 4LV8B 4LGYA 3WWEA 1M6WA 3PK0A 1L8OA 3I9V6 1WVMA 3KWJA 2AFHE 5E6SB 3HJFA 1LQUA 3SZMA 3T5AA 1T1IA 2ECQA 3QLUC 4EA8A 1VIMA 3PHJA 3IDOA 2IYNA 4JJIA 1OA1A 1R6UA 4OJKA 4YAWA 1NXOA 1NQXA 1N25A 1RQ7A 1Q0TA 3LQKA 1L5GB 1AO3A 2HO5A 3LCRA 2PXXA 4N54A 1P4HA 1HTTA 3WX0A 1M34B 1PP4A 4ZK6A 1A8UA 1U2ZA 4ARZB 4NSNA 3UWDA 2BKUA 4FHDA 2FDXA 4H7IA 3LBFA 4OBXA 1KC1A 2RI1A 2VRCD 4YAJA 3P9ZA 1DUVG 3LMKA 3ZIAD 2W9XA 5CDSA 4GFDA 2FVXA 1U0BB 2YOGA 1D03A 3JSAA 1VG0B 2AT1A 2X9QA 1CULC 3O5AA 4URXR 3EBOA 2F7SA 5DTMA 2XMQA 3ZD9A 3GGCA 1M1YE 2CHVA 1NW8A 3B9BA 3K4HA 4GM1A 1E1QD 1ZGGA 2V5AA 2HC9A 2QDKA 3U31A 2VTKA 1KVRA 1YQDA 3O8CA 1UJ2A 3FLAA 4H35A 2YHUA 2I4LA 1FQWA 1DIHA 2ECOA 3TL3A 3ZH2A 3RYIA 2FN3A 1USIA 2WWTA 3JWHA 4DLBA 1NZFA 4LHEA 4IH9A 3QYJA 2VQSA 4YECA 4I5DA 5JATA 1J0EA 3EEBA 3ZWCA 4D80A 4F46A 4PIMA 3DP7A 4I81A 3TF5A 1RRPA 2WFAA 1M1YA 3JYHA 1DMSA 3O21A 4IHJB 3UO8B 3Q3VA 1XLVA 1XKXA 2H1WA 2YMLA 4IVRA 1QK4A 2M9MA 3H9BA 4ZZ2A 5JZMA 1CYDA 1GLVA 4N65A 4O4IB 4HAIA 3HFRA 3PNPA 4H31A 1EVEA 2KHZA 4Q4AB 3W5HA 3ZJYA 4UMFA 2BF7A 1XXHB 2B5VA 5EWMB 4CHTA 3ZZ1A 4G36A 2JJ8A 3D2BA 3N53A 3SE7A 5FPQA 4B6RA 3OZFA 1YVDA 4COKA 2VSQA 2JC3A 4OHKA 3CF4A 2IYSA 3TVYA 1QZTA 3M3PA 4UXJA 2C31A 1JH9A 4R1QA 2CHQA 2R6JA 3NTOA 4GX2A 1CJKC 5EJ5A 4I9GA 4P3OA 3NWJA 1J2TA 1C3OB 1Z68A 5B7PA 4CCAA 1TQ2A 1NW3A 1OX5A 2H9IA 3KZMA 3OT4A 1PK9A 3ZCQA 4P5DA 3L79A 2VRBA 3LBNA 3OI7A 2P2ZA 4FI3F 4EW6A 3UT5B 1Y8RB 3D3WA 4CLOB 2Q4RA 1KY4A 3AG5A 4KDEA 5ICGA 4FDTA 3ID6C 4U1RA 2EKQA 2V9PA 1FPMA 1BQ4A 4B2PA 1NTOA 2EV9A 1D2MA 1MQAA 3LUJA 3GJSA 4MIYA 3VPCA 3ZNQA 4DMCA 2OCIA 1E9EA 3MTBA 1CUDA 2OUIA 5IC4A 4I50F 5BMVA 2WEKA 4GKJB 4KYTA 2DUWA 3EAGA 2VUUA 3OTQA 2QTRA 2VEOA 1KXZA 3BIOA 3OEED 6NULA 3O1JC 4MRNA 3GPLA 4CLOA 4ALIA 5I7EA 2OORA 2J4FA 2Z4SA 4QFCA 3IOCA 3IE2A 3PSHA 2EHDA 3KZKA 1KZGB 5LFAA 1HT0A 4WESB 4KLCA 3L7DA 1I3KA 4NICA 3PDUA 1G38A 2W2KA 3VAYA 4JOSA 2H1SA 2HJWA 5AIBA 3UGQA 3GGGA 3HTXA 2IS2A 2GK6A 3SG0A 4BMSA 4HNAB 2FOXA 3AF5A 1MJFA 3INYA 3DBRA 3JWGA 1MQ9A 4LNHA 1HYBA 2ANCA 3FSEA 5FI3A 4XYLA 2UVPB 3RSLA 4JI7B 4M1KA 5D8DA 4BZXA 3I8SA 5AK5A 1N6PA 1L3CA 2GPWA 4MEJA 1W4LA 3HZZA 3WC4A 4EKDA 3GZTB 1H2HA 3B36A 4MS3A 3SLKA 3TX2A 1HH4A 2GPSA 4MYHA 4YV7A 4ND4A 1FX0A 1Y1TA 4R69A 5CYPA 1VJRA 2O8DA 3ZY6A 2HJHA 1O9HA 2P78A 5ISMA 3VRHA 5K3DA 4YO8A 3UJ9A 2H29A 3BDIA 5BV1A 4FZJA 4KIFA 3HY6A 1T3GA 1QANA 1QP0A 1F20A 2ASVA 2H18A 1C9MA 3GUYA 1YFJA 1R0SA 3MQ4A 4WD3A 3PT9A 1AS0A 1AS2A 2CFTA 1ZXLA 1AN9A 4JR1A 4LTNA 5GZ6A 4H1WA 3C3EA 3ADPA 2D1QA 2QYHA 5WRFA 1VPDA 5GV8A 1GLNA 4G0YA 4Q03A 4S0ZA 3GEEA 5FPPA 1D8TA 4YHBA 3TEJA 2ARKA 1W48A 1UT8A 1VI5A 1WLYA 5K8UA 4U2EA 4JP1A 1AV6A 4NCIA 1W30A 3OWOA 2CMFA 3C5EA 4I2NA 1TM3E 4XGKA 5DEOA 5EWLA 4P3NA 3H6GA 1Y9DA 1KIFA 4PYQA 1PJAA 4GH5A 3CNBA 3S5UA 5C53B 3JTEA 2KPOA 3CSDA 3HFSA 1IMJA 2PRZA 4UXHA 4MDHA 2VDWB 2CXOA 1XRPA 1PGOA 2CBXA 3I8OA 1WP9A 3HB5X 4CL2A 3F8TA 1TZCA 2AN3A 4HDKB 2XGOA 3OFNA 2QYTA 3K70D 2NZ2A 1VCHA 4XDYA 2QRVB 4LDPA 2RHLA 3L2OB 3X3HA 2NPOA 4GQAA 2ISSD 2R6AA 3W8RA 3FHTA 1CP3A 1TUBB 1ECPA 4IGAA 5A7HA 4FK8A 5FOQA 4EKNB 4PO9A 3LYUA 2J9FA 3TOVA 5H5JA 3WTBA 3AI7A 3RRZA 2CNNA 3FF4A 1KE2A 3K8ZA 4H0FA 4L7VA 5DBGA 3HKDB 3UAZA 1X38A 2NU8B 1ZSNA 5K0SA 3JZMA 2VIIA 2GDJA 3HO1A 3C14C 2J6BA 3A27A 3FVTA 5LLSA 1LPBB 3QPCA 5KKAA 3ZXXA 5D6NA 2AFIE 3DMNA 3QE2A 1AMUA 3QSYA 2QD5A 2X15A 4HFNA 4W5QA 2PX6A 4NXMB 3A4YA 1WETA 3QP9A 2V3VA 3TIFA 3QA3E 1PZXA 1UBSB 5L3SB 1Z0SA 2JCGA 5IKPA 4RTSA 1T6ZA 1PZMA 4D81A 2XNJA 4ZANA 2QTAA 3FYUB 4I4TA 3K9QO 3E61A 3SHFA 3GJXC 4BEWA 1OFHA 4IH4A 2BP7B 3KALA 1KOGA 1YJ8A 6LDHA 4AZ0B 4LRTB 4W5WA 3WGKA 2WYUA 4FFRA 5C31A 1YRWA 2HKIA 4OAQA 2EDCA 2F3UA 3ZWWA 2XNDA 1C7IA 1RRVA 4DUZB 2G5TA 3LVFO 4O2BB 5TPWB 3J81k 4D2IA 4E5UA 2ZI6A 3IP9A 2ATCA 4NFYA 3AEQA 2DPLA 2O0KA 1GVHA 3IP6A 4JOQA 2XRZA 2ORED 1TK3A 4XYGA 3N2GB 4LJAA 4MQ6A 1OC2A 2R47A 4J3NA 3U3RA 1A1VA 3MB5A 5CUQA 2HSZA 3AP3A 4U4AA 5DCLA 1EZZA 3PUZA 4M9SA 4AP6A 5BW8A 4DY4A 3RS5A 3PHIA 4JOBA 4MYRA 4ZHQB 5LDHA 4ERXA 1P31A 1LQTA 4WOKA 3QE9Y 4RNDB 3LF1A 3DMRA 2WSSD 4R1MA 4RA9A 4E13A 5JEEA 2QBYB 4Q6BA 2YDYA 2D5AA 3MMSA 3L4EA 3ICEA 3SI7A 4EMSA 5KYNA 2B69A 3VC7A 3VO8A 1DO2A 1M34E 3QKSB 4H60A 4ESEA 1NT4A 4Z5XA 1ZGZA 1JLLB 3BMOB 3G23A 3UMGA 3RS8A 3RNLA 4E33A 3EXAA 4EFDA 2PH7A 2POCA 2QTLA 3LH5A 3ECCA 5DF1A 3NWEA 2IY8A 4S05A 4PZ9A 1CDOA 5H82A 3TKAA 3WLRA 3EGDB 5LNK6 2Y4OA 2XLCA 5GZ1A 2FF5A 4D9HA 1YVUA 2EGHA 4ALKA 1GFIA 4IH1A 1GKUB 3EZYA 2GFQA 2ZU0C 2PT6A 3S8YA 3QQPA 4BQRA 1W73A 1YKGA 5CM8B 3SC2B 1VXRA 3Q6IA 1Q92A 4Q3NA 2BH2A 3LQ4A 4JKIA 5TY0A 1ZEMA 1NC3A 3ZZNA 2UUCB 1UJBA 2FPGA 4NZMA 3KT3A 2HA4A 1KVQA 5MFZA 4ZD6A 1MH9A 4KE7A 5AHKA 4OIMA 4UCXA 2X0IA 4PYOA 3PQEA 1X2BA 2JRCA 3FPFA 2HLDD 1GARA 3FA2A 2X41A 5AYVA 5JE8A 3TLGA 5B6JA 1UXIA 4M1MA 1C9EA 3HVUA 3WL4A 2W8BB 1M33A 3GLSA 2H7VA 3ROZA 1TB4A 2GBLC 3DPIA 3AFGA 4OP1A 1QO7A 2YXLA 1UBGA 5TGDA 5KQLA 1P0QA 3TJMA 2JLXA 2RGNA 4JT4A 4Q4JB 4BMNA 5B55A 2I71A 2XEDA 7REQB 1ZJZA 4JCOA 3BTOA 3R3SA 1U7TA 4HDSA 3G7UA 4MWBA 2VHJA 5F77A 3OZGA 1E1YA 1U5BB 4RQUA 3NYQA 3W8NA 4QUJA 2BEKA 3CZMA 3ZKWA 3BILA 4P32A 2B82A 2X9NA 3VOSA 3RC3A 1BO6A 2I6SA 3DTVB 1MX1A 1RIFA 1DQNA 4LNAA 3U0VA 3K8QA 3ZE8A 3TRIA 4AY2A 1O7JA 4JLMA 2GN6A 5MN4A 4KQXA 4LI0A 4CI0B 5U9CA 5IAJA 1WV0A 4C3OB 4FCVA 1W6UA 2MIIA 1LSOA 3AINA 4ZVNA 5LMZA 3E9MA 3BE4A 3BHIA 4UM9B 1CERA 3WIDA 1EESA 3IO3A 2IUEA 2VJMB 3AEXA 1V5EA 1JEYB 4EVSA 3UTCA 1JVNA 2C83A 2FF7A 3LIIA 1SXJB 4ZQIA 3ZLVA 1LPAB 1X42A 4X54A 4OKIA 1FTSA 3TW8B 1PV2A 1F14A 4I19A 3MD0A 3X2FA 3ZDZB 4UDXX 1J39A 1EK0A 4Q3AA 4R2LA 1XYVA 3K5IA 2OB1A 2XTJA 2ZXFA 2A1IA 3WLLA 1ISSA 2FN8A 3FPBA 1FS6A 1T2UA 3SQMA 3TLYA 2GCOA 1ZVKA 2X8LA 4M1QA 4WXHA 4XA8A 5DKFA 2WY2D 5JSZB 2RGXA 4EY5A 4C21A 5JXWA 4HAXA 5G4KA 3SZ3A 3T3PB 3ZGXA 1DC3A 1A8QA 4QPJC 1U8AA 1Y5NA 2QTCA 1YMUA 3ZKAA 3KEGA 3KEFA 3VNVA 2KBEA 3OCJA 4FHEA 3REQA 3OKFA 1T5TA 1A5AB 3NVDA 1CQZA 2O1SA 2XNDD 4YCAA 1EM8B 1DRKA 2X2EA 3MAGA 5KHAA 4KNYA 2E48A 6YASA 3D0QA 1D0SA 4Q3DA 4A82A 2QAGA 5D01A 5FLEX 1MAHA 1USGA 1NBHA 1WSAA 1Z4IA 2CHFA 2FN4A 2RHMA 2RKOA 4P92A 3HNOA 5FOWA 3GBSA 4PZLA 2PCJA 4Q7JB 5BSWA 5FAKA 5A1JA 3QOFA 1EFCA 1CHNA 2LCIA 1ZN2A 5C37A 2G1AA 4PYNA 1KS2A 4CR6A 3PC2A 2ODWA 4ECEA 1DG1G 5HRCA 4FSXA 1T29A 5FV4A 5HP4A 5BRNA 3HB4X 2GAJA 1P2BA 1VLVA 4EYOA 4WCFB 3DVRX 2XLBA 3RC2A 3VYRB 1J33A 1U2GA 1TEZA 4BQFA 1UT6A 1OOEA 1UMDA 1AQ6A 3P9IA 4JUDX 4OAPA 4X65B 5KU7A 3T94A 3SBEA 4WNYA 4A1OA 1YXMA 3LC0A 1XDDA 4IDBA 1W5AA 2BFEB 3FTPA 1A96A 4ERNA 4GOOD 1QYWA 2D5LA 1AGXA 2PX0A 3ADOA 4C5BA 5IKXA 1V71A 3Q7SA 3QVSA 2GBCA 3PFBA 3DMFA 3WGUA 5K0JA 1KL7A 4M8IA 1Y80A 1SUIA 2FE1A 4C5CA 3HV2A 1HLDA 5KKNB 2RONA 2D2IA 3GW8A 4J29A 3ND6A 1E2HA 1I1QB 1NUTA 2ZJ3A 5JECA 1FUKA 2HU8A 4G07A 1PJSA 1RHJA 3B1ZA 4OJYA 1SG0A 2A1TS 1Z9BA 4FKZA 6REQA 1LF5A 4MGZR 1YRQA 3DSRA 2I8AA 2YVKA 2QLNA 2C9BA 3K2EA 3KKKA 1G63A 3M7IA 4IQFA 4JLKA 4O2RA 4R40A 2X0RA 4URVR 3BUSA 3K9BA 3E48A 3UANA 5B1HA 4BGIA 1SVNA 3UW3A 3LT0A 2W2XA 1NV9A 3P9RA 5AR1A 3DTTA 2JLYA 1J21A 3EG9A 4NL4H 4ID3A 3UCXA 4C7KA 1ABFA 2OILA 2XEXA 3LQRA 2WAYA 3I1FA 4QUAA 5I01A 4D25A 4EGCB 2G70A 1WPQA 2G1JA 3AF3A 4K6KA 2K5UA 1MIOB 4N0MA 2IGBA 5LOVA 2EG5A 5FUVA 4CE6A 1DAKA 4M9QA 5CNIA 1R0RE 2QGNA 3CC8A 1Y8CA 1DG3A 2WUGA 3D6NB 1KDVA 3T5TA 4RD3A 4BNHA 1FMLA 5CW2A 4D8UA 1L7NA 1X70A 2H4ZA 3PPYA 5JLAA 1YIDA 2B4KA 1L5QA 3N70A 1ZJYA 3Q7PA 4G85A 5KWEA 2R86A 1T4GA 1Q1ZA 4XRRA 4C29A 1UP4A 2YMPA 4NMXB 1VPWA 1PD0A 2WIAA 3DWEX 5F2OA 1ISIA 1P3JA 5FF9A 7MDHA 3JQPA 3LOQA 3QH4A 3QRWA 4E0BA 3I3SR 3MS4A 1MBZA 3GCGA 1T9CA 3KB2A 3ADKA 4KGZA 1NOKA 4PCVA 4Y30A 5COAA 3CLKA 4LZZA 3VI4B 4DC9A 3CJTA 1T6YA 4LKOA 4RE6A 4TLDA 4DJAA 2BE7A 4NZ9A 3C5HA 4ZCMA 2FUG6 4KE8A 4F2DA 3TTUA 5CH3A 5U1PA 1PJQA 3JQGA 3GMDA 4B09A 3S1SA 1AXEA 2HA5A 3ELDA 2ZTVA 1WG8A 2VYQA 4QUDA 1ECCA 1RVDA 1W7AA 1M83A 1EGVB 3MPOA 4FOLA 1XDWA 3CB2A 3EC2A 3H17A 4LRXA 2FSPA 2CL0X 2EFYA 3OCXA 1WIWA 3QPVA 4UBLA 5L6MB 3AOEC 1S1CA 3L0YA 3NOOA 2C2XA 1JG4A 2H2GA 2PUVA 4PSAA 4KVGA 3NETA 4Z7OB 3FWKA 1A5ZA 5JOQA 1DXHA 3L93A 3WE7A 5GOZA 2HTFA 4RPJA 1OWOA 2Z83A 3MYYA 5ICEA 3TBFA 4XCVA 4YRTA 4YRJA 3HNPA 4MB6A 3CBGA 3NFYA 4C6SA 1MR3F 3AKZA 1Z0ZA 5HKAA 2IYOA 2HLNA 2VH2A 5K20A 4QOSA 2XQFA 4H08A 4OXIA 4URYR 1NKTA 4FS8A 4CIDA 1YONA 2XZOA 4LGCA 4RVUA 4CTNA 5LLTA 1D0VA 3T15A 3NBFA 1PBTA 2DLNA 4L75A 4XB2A 2JIMA 3HCBA 2ZRBA 1LA2A 2Y1EA 4RZ3A 1HL3A 1K6EA 5KJFA 2ZIWB 2PQ6A 3GJTA 5EWMA 4KPEC 4J49A 1K8YB 4EYKA 2JLZA 3MBKA 4ZAZA 2J5KA 2GZMA 3JD0A 1NFQA 1G4HA 5ALSA 3W6NA 1DDGA 1ESEA 4NYMQ 2JGJA 4O5AA 2GLTA 2CYAA 4ANFA 2BR5A 2MYNA 4K8OA 4JJ8A 4RY0A 2YIJA 3U80A 1O3YA 4C0HA 1H4QA 2X22A 2DYKA 2OENG 3MOIA 3NANA 3OZRA 3KJXA 2B83A 1D4AA 2Q3BA 5DK4A 1U1FA 1BKDR 5BOSA 3G2IA 2Q3MA 4ER7A 2J3DA 4BMZA 1UF9A 4DXDA 2I7VA 1UPAA 1SNYA 3E9DA 5KYXA 1Y5MA 4MGKR 1CU1A 1ZA1A 1V9SA 2JFHA 4L4YA 1Z0AA 1GKLA 1RHRA 1UFVA 1Z7EA 2FZ5A 2VC2B 2PAAA 1JHXA 3RIEA 3IERA 2TYSB 2Y77A 3O4VA 3PUKA 4JA2A 4M9RA 5KMGA 3OTIA 3F5QA 1JAYA 1RBMA 1QAOA 1EAMA 4NESA 4BLOA 3B2QA 4HSGA 3HJHA 4CEIA 1DZIA 4N49A 1J70A 2CEKA 4RD4A 4Q9DA 4V39A 4ACAA 1XTIA 3FFTA 2BBTA 3BXHA 4G9EA 1JTFA 4D3SA 4OHVA 2ZRDA 2QVGA 3OZ7A 1W5FA 1KMIY 1AKNA 5HKKD 1I4OA 3CLTD 4C87A 3PRJA 3LBAA 4OU4A 3LY8A 2CDCA 4Y2JA 1UKYA 4X1YB 2P41A 3VR5A 5K3FB 3ZD7A 2XNKA 3IIKA 3LZ6A 2IU6A 2VTEA 4ZDIA 6REQB 2WW8A 2CNLA 3MOGA 4LCJA 4X61A 1MFPA 3M6FA 1J2EA 3CCFA 4JELA 3U5TA 1ZAYA 4TSFD 4UREA 1PN3A 4PO1A 2QUZA 4P36A 5E4JA 2H1OA 3MMNA 3UHAA 1ONOA 3MHPA 4P4TA 4XWKA 4XIFA 1JPNA 3PTLA 4KC0A 2OV2A 2AN1A 2PQ0A 4E2YA 4XZ3A 2ACVA 2FV8A 3NH6A 2YFKA 2X5KO 2AXPA 2C2YA 2QMOA 3KKLA 2H00A 1JQDA 2JAWA 1KZ1A 2P40A 3QOWA 4XUCA 1K66A 5K0BA 3W0LB 2QAIA 3RR2A 1XQXA 1TYBE 4RAOA 2SCUB 4JVSB 4Y6QA 2XYPA 4NOJA 1YE5A 3A32A 1OHHD 1PNOA 2NYUA 4IOMA 1LB1B 4I99A 3QUQA 3R24A 3ZXIA 4LW8A 1NBME 1YOBA 1AURA 5EE0A 2B30A 2IT1A 3MF4A 1BQ3A 4GICA 2IEZA 3ZJUA 2AJCA 4JQYA 1EEXB 5LOVB 1T0IA 1IBCA 1V39A 3ABSB 2P27A 2OHJA 1KRXA 2Z6QA 3BTSA 5CA0B 3B89A 1UZAA 3C1AA 1UQTA 3MCAA 4DV3B 1SR8A 4O25A 1KVUA 3EG9B 5AK4A 4FHFA 1YBAA 3M4ZA 3V4ZA 3IAM1 4CQNA 1SELA 4WERA 4EPXA 1RC8A 1JIUA 2QZJA 1ODJA 2PQ2A 3F9CA 3EOZA 3I76A 3OPMA 3V46A 1WM1A 4EGSA 1Z29A 5EHXA 5HCNA 4KBYA 2O3RA 1AXGA 2F48A 3E82A 5AI8A 3CBQA 3ZGNA 2RAUA 1CDEA 2JBAA 2WKWA 1GT91 1YVEI 4FDMA 1F51E 3KPVA 4WI1A 5ALYA 3VMMA 4NCXA 1QK5A 2ACEA 3ZXUB 2MR6A 2W00A 3QMWA 3QV2A 5ES3A 4ENVA