4EQ6A

The crystal structure of psy3-csm2 complex from budding yeast
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
213
structure length
192
Chain Sequence
MEYEDLELITIWPSPTKNKLCQFIKQNLSKEHVVTQLFFIDATSSFPLSQFQKLVPPTLPENVRIYENIRINTCLDLEELSAITVKLLQILSMNKINAQEPLKIILYINGLEVMFRNSQFKSSPQRSHELLRDTLLKLRVMGNDENENASIRTLLEFPKEQLLDYYLKKNRIKNGDSLAEYIWKYYADSLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and SAXS analysis of the budding yeast SHU-complex proteins
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords Chromosome segregation in meiosis protein 2
total genus 74
structure length 192
sequence length 213
ec nomenclature
pdb deposition date 2012-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16834 CSM2 Shu complex component Csm2, DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4eq6A00
4PO9A 4GRAA 2PT7A 4BFWA 1FMLA 3DKVA 3FWYA 2IYLD 1I4LD 3UG6A 2REOA 2ZJ2A 1KK3A 2F3TA 3TLXA 1SXJA 1KI1A 5J5CA 5CK5A 3UWKA 2QMUA 1AIPA 1YR6A 5CJPA 2ODNA 2XAUA 2OHFA 2Z0MA 1X8JA 1E98A 4JVMA 2KE5A 3VR3A 1IQPA 4MGYR 1K6MA 4IHQA 2RH5A 5B64A 4PFSA 4URYR 4M2LA 3KQNA 2JJ1A 1UAAA 3WHKA 1T4GA 2ZQ5A 2E9SA 4NCKA 4LRWA 4GP6A 2ZJZA 1KK1A 3G0HA 2WJHA 3C14C 1GRNA 4LBVA 1HYQA 1DAGA 1CJKC 2ZRDA 2ZJYA 2VQSA 3GJ6A 3IILA 4MRPA 1E99A 4RZXA 3RRZA 2PT5A 1G8FA 4QRHA 5IK2D 1G3QA 2FEOA 2IYQA 1R7RA 1EK0A 1OFIA 1R4AA 5L8VA 4C3ZA 3KXIA 4KV9A 1NIPA 2EW1A 3SJZA 2GCOB 2ZSEA 3OZXA 4HAXA 1XDBA 4HSEA 3BH6A 2Q0HA 5K8UA 1XXHA 5KSZA 3AVPA 3U44A 2AWNA 1IBRA 2JCSA 5HCIA 3VR1A 1F2TB 3THXB 4LHXA 3PVSA 2OILA 2I1QA 1XTQA 5DLQC 4CEIB 2OSBA 2HT1A 2YINC 2J1LA 3W90A 1W5SA 2ZYTX 2ORVA 1Z06A 2OG2A 4O2LA 4MKIA 3N5CA 1N5KA 1D9ZA 2JJ2D 3W5JA 1X8LA 4XD7D 5E3HA 4L9SA 5TXGA 1KOFA 3IEUA 2IYSA 4HUTA 1T8TA 3A37A 4TLBA 1E0AA 1GDDA 3I4LA 4Q1AA 2R9VA 1Z6AA 3I8SA 4QHTA 3M0EA 1I4TD 1NG9A 4AY2A 1DEKA 3PEYA 2IS6A 3CIOA 3QXJA 2ZU0C 2PLRA 3B1WA 1AA9A 1L8QA 4HI0E 3P20A 2LKDA 2RGAA 4DIDA 3GLHA 1FPMA 1E1RA 1T0JB 2QMOA 2QA5A 2V8OA 3CUEF 5AJXA 1QHGA 2IWRA 4LSGA 5LB4A 1CTQA 1EFRA 1G6OA 5HZHA 1G64A 2RGNA 3GJ7A 3U60B 4TLDA 1YZKA 2VP4A 4P31A 2RGEA 2JEOA 2GWHA 2PBRA 3IQXA 3NBXX 1FL9A 4HB3A 3LH5A 5AUNB 1EX6A 3CWQA 4C0KA 2P2LA 4DC9A 5IRCD 4WZ6A 4PZYA 1NLZA 3QXXA 4V02A 4PSVA 1EX7A 2A9KA 4W9MC 5CIQA 4EFLA 4LCBA 5UKDA 3I92A 1A7JA 1U99A 5K8LA 3LLMA 3QPVA 5K8IA 1OH7A 2GHIA 2PMDA 1E4VA 1VCMA 2DCUA 2J3EA 4XWKA 1P9WA 2VHJA 4JT4A 4CZ2A 3GJ0A 1MABB 4ASUA 1W36D 1JR3D 4TMXA 3U2QA 2ZR0A 3KXKA 4DT1B 2HYIC 3RS3A 2ZRHA 4U5XA 3TMKA 1A1VA 4U02A 5FBLB 4B6EA 4KLNA 3UMFA 1YZGA 3GCGA 4GOXA 4UKDA 4MRNA 1S1MA 3DM5A 1G16A 2ZRJA 2WZQA 2F1HA 3U6KA 3NBFA 3CPJB 3DMDA 1NBME 4FWIB 4H1VA 4JKYA 3ADCA 1WRBA 1O87A 4QBHA 2FPMA 1SXJD 1NL3A 3CRMA 3KB1A 4DLYA 1UBFA 2DYKA 3FPAA 1OIWA 4QM7A 5KSPA 4FWTA 4RD3A 2IBMA 4QM6A 4Q9HA 4XWOA 1BOFA 3TUJC 2FF7A 1CKEA 2C95A 1RE0A 4GSYA 3RHFA 4PHHA 3QBTA 4UQOA 5A0FA 5DI3A 3P26A 1TADA 2CHGA 1XMVA 2B8WA 4UXIA 3MRSA 3SC3A 4HZUB 2C99A 2JLWA 5DHFA 3BB3A 1CU1A 1W7AA 4OQNA 4PO8A 2IYRA 3A4MA 4LJAA 5JBQA 3AVWA 2VHQA 4G5QA 3G5UA 2YC4C 3OAAA 3QG5A 2C78A 4Q9LA 4HLCA 2BKUA 1N5IA 4EAQA 1R8SA 1S9DA 4NKRA 4JBXA 3IIKA 2DB3A 5HPYB 4TMZA 2O8CB 1ZIOA 5JMTA 4DCSA 1MRNA 1ZJ6A 4BECA 3MJRA 3KTAB 5E7MA 1NJGA 5FTJA 3UK6A 4DZZA 3PQCA 4W5WA 4GOKA 3X1YA 1M34E 2EYQA 2JLVA 1NRJB 3T34A 4O3MA 2R6CA 4B76A 3RRYA 1FTSA 4DCUA 4AD8A 2CVHA 1SXJC 4G0NA 5TV2A 2YWEA 5GJBA 4BFZA 3UG7A 4A0RA 1KI2A 4ARZB 1Q1ZA 2VH5R 3VR5A 4K81B 5SZHB 4DSUA 4GL2A 5H68A 3W3ZB 2YZ2A 2ZRAA 4RFSA 1AKEA 1XCGB 4TLAA 2Z43A 3IIJA 2HJGA 2CJWB 3Q7QA 4JLDA 3RS4A 2RGXA 3M4YA 5FOVA 1ZNZA 2AHOA 3HYTA 3TAUA 5F9HA 3I62A 2YYZA 4TZ0A 1GP2A 3BD9A 2O52A 4JIMA 4Q1FA 521PA 3KJGA 5C2JB 1AZTA 2ZM5A 3GJ4A 1BYIA 3NG1A 3VR4A 1FP7A 3KJIA 1HTWA 1R5BA 2QUZA 4HAWA 2FFAA 4NCNA 5JFGA 2XXAA 1G18A 1SHKA 1PV4A 4A6PA 2RCNA 2VP6A 4FD2A 4EKDA 3BJIC 3E70C 3IKJA 3CZPA 3KKNA 4B48A 3ADDA 3NC0C 1P2UA 2XZOA 3ONWA 1JPJA 1XD2A 3KKQA 4BLTA 3REFA 4CYMA 3BB4A 2UZ3A 2O8DB 2XB4A 2H8KA 1P2TA 5JLJA 4IRUB 4DIEA 3Q5EA 2EFDB 4M1TA 1DPFA 5D3MA 4R7ZA 5E7JA 2RGDA 3CBQA 1MO4A 3P27A 3GJXC 4NU0A 4RD2A 5D3QA 3CZQA 1OYYA 3AQ4A 2ZJAA 5JSZA 3GMTA 4Q4HA 2OCPA 1CRQA 2NIPA 3WMGA 4LJYA 2J45A 1GNRA 3OE7D 4IOJA 4NDZA 3MLEA 1IN4A 3QF7A 1KNQA 1U0HC 3IPXA 4JL8A 5DYGA 4PO1A 2V9PA 2PMKA 1G8PA 4L5BA 4O2RA 1UKYA 1CS4C 1Z6TA 4KSCA 2R6GA 1CR0A 1H8ED 1WBBA 1ZUHA 2OFOA 4W7SA 5H8WA 2WICA 1TF5A 3T1TA 1J8MF 4OK3A 4XVUA 4JT2A 4Q48A 2FNAA 2EU8A 2ZUBA 1JI0A 4PSAA 1KK0A 2MSDB 2VYFA 1R0WA 5FOXA 2NPIA 3V4FA 2O8CA 2V3CC 2V6IA 5G41A 2RGCA 5KDDA 3B85A 4I1SA 3NKVA 1KMHA 4P4UA 3NH6A 1F2UB 1TF2A 1D6JA 3EWAA 3GFPA 1E9SA 3CX8A 3ZZ0A 3IHWA 3REGA 1N6OA 2JJ8A 5DO9A 4QGGA 1MH1A 3SEAA 2XNSA 4LJ5A 4OHZA 3I73A 3LXXA 1P62B 4C0HA 3ICEA 1XXHE 3EZ6A 1Z5ZA 3TNFA 3CX6A 3GLGA 2OO7A 5DNYB 2QSZA 3KJEA 1KI4A 2GEDA 5E4FA 2H1LA 2ZYWX 1KDPA 4PAMA 2O8BB 4WAUA 4BLPA 3U3JA 1PJRA 1BO6A 1UDWA 1RIFA 1X8KA 1RJ9B 4IEEA 4FW9A 5DI9A 1EFHA 2X19A 3ICQB 1DAMA 2ZRGA 3NBYC 4Q47A 3SI7A 2JJ2A 4URZR 1DO0A 2BOVA 2VP0A 4J0QA 3K53A 3TBKA 4G5OA 3C16C 4FCTA 3WRXC 4BLSA 4OBEA 1ZMXA 2OFXA 5C18A 4TYYA 3QSYA 1J99A 3L0SA 1XTRA 4JLVA 4AYTA 4BUJA 4RCZA 1SXJE 2PH1A 4R2IA 3SFZA 3EPLA 1Z0AA 2DFTA 2GEVA 3U4QA 1FNMA 2BM0A 2ZVPX 1NVVQ 3AH8A 5C4MA 3CF6R 4LOAA 1XBTA 5EP4A 1XCMA 2WSMA 5LB2A 3QG1A 3KKOA 1XEWX 3Q3JB 4YC7A 4BLQA 4R71A 4D25A 2BCJQ 2WWGA 1WXQA 4AG6A 5EXSA 4UNRA 2JLRA 2RGNC 1G5TA 4PAQA 4P4SA 4CEJA 2H92A 1VYVA 5P21A 3SHWA 1SKYB 1WE2A 3OIUA 4TTRA 1YZLA 2P67A 1UDXA 4CF7A 3KKPA 2QT0A 3QKSA 2HF8A 1D2EA 1VCOA 2GESA 2NO9A 4M4SA 2IYUA 1TL7C 2WKRA 4NYJR 5L3QA 3SZRA 1GL6A 3TVDA 2D4HA 5CYPA 4V03A 5DE3A 3C5HA 1XX6A 5EP2A 2BMJA 1E1QA 3T5GA 2IYVA 3OIYA 3BFVA 4OHYA 2J0QA 2CNWA 2XJ9A 4M9QA 1N6NA 4KHZA 3KL4A 4CRWB 2V55B 3W34A 3DL0A 1XJQA 4NCIA 4YDSA 3TK1A 2HXYA 4B35A 1S0UA 3PIRA 2H7VA 1XPUA 4G01B 4NCJA 5JI3E 2EFHB 4CVNA 4M1SA 4LWZA 1BH2A 1Q44A 3K0AA 1Z8FA 5FTNA 1E2EA 3V00A 2BHRA 1M8PA 2NTYC 1GAJA 4E03A 3U3MA 2ZRIA 1F2UA 1BKDR 1RRGA 5FUYA 1QHNA 4RKFA 3ZIAA 2KJQA 3TR5A 3ZZTA 3BBPA 3VAAA 3TGPA 4AKHA 3A1SA 1P6XA 3W8NA 1OH8A 2Q21A 1G4AE 2FFBA 1QG4A 2XZPA 3ADKA 3HPRA 1E2PA 3T1VA 4YMTA 4Q1EA 2VF8A 1E2GA 2ZYUX 3Q72A 2GXAA 2GZAA 4MYCA 4LPSA 1IAQA 4B3CA 1OIXA 1XF9A 3B1XA 5CYOA 2HT6A 4PQYA 2EVWX 2HF9A 3AVOA 4V0ME 2BMEA 3QF4A 5EQTA 1QHIA 5CM9C 4KSBA 3TKLA 4DUGD 4TQAA 4JZKA 1GM5A 4Q9JA 4DRZA 2OESA 4NMMA 2IT1A 1NVWQ 1G9XA 2V1XA 3A36A 4LPKA 3R7WA 4JLJA 4A36A 5LD2C 3KQUA 1CBUA 2QTHA 1IJFA 5L3VA 1RVDA 1Z28A 4PQRA 2QENA 4RZ2A 4B3FX 3AKCA 1GZSA 1YRBA 3WRYC 3AKEA 2P6UA 4ASUD 5F3WB 1JEEA 2PX0A 2AK3A 1JAHA 3BGWA 4DHEA 2KBFA 5FPYA 2FPLA 2G83A 1G5PA 2ZSBA 3B6EA 3KZ1E 3UKDA 1IOZA 1WBDA 2ECKA 2PEYA 2VA8A 2WJYA 2QPAA 4KFTA 1M6NA 3SS8A 2YWFA 3VU9B 5A5GA 3GLIA 4EDHA 3FKQA 4ZIRA 4C7OB 2N1BA 1TEXA 2OCYC 2P5SA 3B2EA 2PEZA 1MV5A 2QBYA 1XD9A 2LKCA 2FE4A 4Q02A 3RS0A 4WXPA 1AN0A 1W2GA 3AVYA 6Q21A 2KB0A 2XZLA 4RD4A 4NE2A 4KI0A 3K70B 1OF1A 4B2IA 3AVTA 3WYGA 3ZJYA 4QJ5A 2HCJB 2OBNA 4FCVA 1FUKA 1U8ZA 2IC5A 4IDHA 1TAGA 4K8OA 1T8UA 2O0HA 4DDVA 4IFBA 4IDQA 3X2SA 3H4MA 4RKEA 5BWMA 1SVMA 1NVXQ 3BOSA 4JBWA 4GZLA 3QPWA 5FTLA 4B44A 1T5LA 2VSXA 4OI2A 5J40A 2NO1A 1E9DA 2C04A 2CL0X 4HUQB 3FMOB 4KCGA 1OKKD 5AWFC 3SJCA 4HAUA 1QBKC 2WBLC 4YQFA 3CNLA 3OEHD 4CT5A 4RFVA 5AUPB 1W49A 2GF0A 5JWHA 3CH5A 4WXRA 2FSIA 4Z1MD 2QL6A 4HAVA 1N6PA 1QDEA 4G1UC 1P61B 1W46A 1OPXA 2NQ2C 3R8FA 3AP3A 2CVFA 1VHLA 2YVUA 2EFCB 4F4CA 2CE7A 2RGGA 1LF0A 1Z47A 3JZAA 4XD7A 3KQHA 4CEHA 4GZMA 1MO3A 4A6XA 2BBTA 4JBYA 5J4KA 2F55A 3NBZC 4FIDA 1E2LA 3CW2A 2J7KA 1R6BX 1ZRHA 5FI0B 4Q1BA 1OB5A 4X8OA 4RJLA 3K09A 2ZRFA 1EGAA 1W0JD 2J7PA 5FPSA 4HAZA 1OJLA 3QJYA 1N0UA 4ZDJA 2OAQ1 1T6NA 1KI7A 3CPHA 3QF4B 1DAEA 2ZR9A 3LX5A 3BRWD 3EIHA 3EC2A 5IK2A 3NIBA 4IXNA 1KO7A 4TT3A 1NG1A 4IJMA 2XOKD 2W6JA 3RAPR 4DDUA 3BAFA 5FPHA 4UXHA 4W5HA 5EP1A 3K9NA 3K1JA 2SHKA 2ZU6A 4HB0A 4L9WA 3KUDA 5FOUA 5KHOC 1KHTA 5DIFA 5KDLA 5CIWA 5JCZA 3THYB 3IEVA 1XTJA 3N2IA 4BFUA 2FN4A 2GJ8A 3I8XA 1KI3A 4ILEA 4POAA 1NJFA 1ZNXA 3Q5DA 4AK9A 4M0LA 5FFMA 4CIDA 5G3ZA 4A15A 1Z6YA 3MSXA 3VU9A 4C7OA 2CLDX 3TR0A 4N0EA 4BEJA 2QU8A 4LBYA 1F48A 1YZNA 3PG5A 2VHCA 5FOSA 1IY1A 1M7BA 3DDCA 4BFSA 3VX4A 2QP4A 2R2AA 1JXOA 4UNPA 1SVIA 5TVKA 1ZVQA 4GFDA 4M1KA 3PEWA 3FKSD 2FDCA 3NDPA 4F4IA 2ZJBA 4Q00A 2XITA 2DBYA 4EQ6A 3GLFA 2WV9A 4D0LB 3FMPB 3K0FB 2HYDA 2WJGA 4FMCF 2HCBA 2VEDA 3L2OB 2IWHA 3S1AB 3I72A 2CHVA 4RD0A 5JEDA 2A5FA 5EZ5A 1WQ1R 2A5JA 4QKQA 2GKSA 3EIQA 3WY9A 1AQYA 4A8JC 3GP8A 2BM1A 1DAHA 4AKEA 1XFAA 1NF3A 3HPQA 1HA3A 3AP1A 1VTKA 5KPJA 4WZAE 4ON9A 4D26A 2W2VA 3X1DA 4DB4A 2ZAOA 1SHZA 2EYUA 5G40A 3KDSE 3BORA 1U94A 5FUXA 2BEJA 1DAIA 1R2QA 1LB1B 1KAGA 3SU8A 1P2VA 2ZJ8A 5KNCA 3NXSA 3CF0A 3I32A 2IHBA 3QXHA 2G3YA 3OEED 1XCPA 4JLAA 3VKGA 2C8VA 3PENA 1Y3AA 1S1CA 5JWOA 2ZRPA 1E96A 2V6JA 2XX3A 4LY6A 2GBLC 4UNSA 1CF4A 2JIZD 5FL3A 1PUIA 1VCIA 3VHXA 4A2QA 2ERYA 2QTFA 4TLEA 1W2HA 5FOTA 4ARZA 2G0TA 1G4UR 4Z8XA 5KNBA 2DHRA 2ZS9A 1XPRA 4Q18A 2OBLA 2ORIA 1ZM2A 2Q3HA 4BWYA 1AS3A 1J2JA 2NPFA 1R10A 2G77B 2R6DA 1NN0A 4DLUA 1NLFA 3MD0A 4GNKA 1XEXA 4OQFA 4DDTA 4JLMA 2KI5A 3TQCA 3LFUA 2J9RA 1A2KC 2GCOA 1N6RA 1NLYA 1Z0KA 3IPYA 1XTIA 4LYJA 2QROA 1XXHB 4R98A 1S2MA 1F60A 3FHOA 1XMIA 2CL6X 1F2TA 4KJZA 3THXA 1FNNA 4OHWA 3OIWA 3U3RA 4Z51A 4OHXA 2NGRA 2BBOA 4NYJQ 3ZDQA 3LVQE 4HATA 1Q20A 1P7CA 3C15C 3HP1A 3LX8A 3WNCA 2UVQA 4PQFA 2QORA 1KO8A 4O0MA 3ZS8A 1OHHA 1KSJA 2XSZA 4XOIA 5BN3A 3PUYA 3E5HA 2YOFA 1GFIA 1J8YF 4BRUA 3H2YA 4PPFA 2WVJA 3AF4A 4B75A 3KKMA 3AKDA 1YZQA 4FMCB 4EPRA 2JDID 4PXAA 3WYAA 5BYKA 2FH5B 4ZDIA 721PA 1II8B 4BQSA 1Z22A 2D62A 4KU4A 2FZLA 5JHHB 2A3RA 1LY1A 1SQ5A 3RRNA 4HZIA 5G53C 3WMFA 1LNZA 1NMYA 4V0NA 2OAP1 3LQQA 3CWZA 4XVRA 5A4JA 1NMZA 4E5UA 3CO5A 1HH4A 2R65A 2WKQA 2ZS8A 4B3XA 4TYPA 5JJLA 5FL7A 4X8MA 3CRRA 3ASYA 2FZ4A 4IVPA 5B58C 4KFRA 1ZU5A 4MUBA 2AX4A 1KTVA 2W0SA 2NZ8A 1VPLA 3BB1A 3FFAA 2Q9CA 2WM9B 5DI3B 2QG6A 3SYLA 2WOOA 3A1TA 4G5SA 5H1YA 4LHWA 2ERXA 1S3GA 3B7GA 4RD1A 4Q9IA 2A5DA 4BZQA 3ZS9A 4D4JA 1EXMA 1KJWA 1E2FA 4URXR 4JYCA 2OUKA 4AURA 1QHHA 1G6HA 4KLZA 1T9HA 3KXLA 4NYIR 4OQXA 4P4TA 1CJMA 2NO6A 1VHTA 2P6RA 1XWIA 4MA4A 3K0EA 3ZVMA 1J90A 2ZI6A 2ZI4A 2QM7A 3VX3A 3LW7A 3QBVA 4QOSA 1F3OA 1PLKA 2PL3A 4PC1A 3U3OA 1S96A 2J0VA 3SN6A 2VSFA 3QE0A 5JCPA 4KODA 2FOLA 3SBEA 3OFNA 1E3MA 3LXRA 3LQRA 3ZQJA 1P2SA 1A4RA 2O0KA 3NWJA 2I1VB 421PA 2C03A 4W5JA 3UXMA 121PA 3CONA 1N6LA 5KOYA 2UKDA 3BIFA 3QIAA 4GP7A 4ZCIA 3EX7C 2FU5C 1YJ5A 2R8RA 4C0QC 2GTPA 3TH5A 5C4GB 2W2XA 2GZDA 1FQJA 2OBMA 4QBIA 5BXQC 3FE2A 1AKYA 5AUOB 1ESMA 3MWLA 5JS7A 2ZE7A 1OXUA 3KFXA 4YONB 3K9LA 1Z07A 2J0UA 3W9YA 4CEIA 1AM4D 1LS1A 4EFMA 5KSOA 1MOZA 4MQBA 4I4LA 2FG5A 2A2ZA 1W48A 3PV0A 3OFND 4HEJA 1MKYA 4D4KA 1TPZA 3AGPA 3LVRE 4X8LA 2RB4A 1GTVA 1DELA 1OV4A 1CP2A 1PUJA 1KY3A 3W6PA 3O8BA 4MYTA 4JS0A 3ZVLA 1AZSC 1WMSA 4KYIB 1T3HA 1UM8A 2ATVA 2WJIA 3FMFA 4YXWA 5FR2A 1CJVC 4NYMQ 2ZSDA 1P75A 2QGZA 4QFMA 4DB2A 3ETLA 1RYHA 3SR0A 2O8EA 4XSHA 1DE0A 2H5EA 2YOGA 1YR9A 4PZLA 3RANA 3QENA 1JJVA 3GLHB 4JVNA 1CR2A 4GDFA 2X2FA 5HTKA 3WHLA 4JSYA 2D06A 2VF7A 3LWNA 1KDTA 1NN1A 4I99A 3AKYA 3TW4A 4S35A 1I2DA 1L4UA 3HYRA 4HLQB 4OI1A 1YRAA 4M1WA 4QG7A 4TQUS 5TDHA 4KYUA 3B13B 4YMWA 1T3LA 1K8RA 4EPVA 1AS0A 2XNDA 4LJ8A 3ZGXA 1Q1QA 1S9HA 3KTAA 3Q8XB 4GT1A 2MMCA 4AWXA 4WZBE 3D31A 3CR7A 1NVUQ 2A5GA 2WKPA 1IJEA 1JALA 4ZDWA 4QGFA 1X86B 2ZSFA 5TARA 2WWWA 3CX7A 1UFQA 2VP2A 1RPZA 4GPTA 3HWSA 2AKAB 1ELOA 2ANBA 4A82A 5L3SB 2HLDA 1HE1C 2CK3A 1W47A 1DG3A 4MH0R 4AG5A 4ZCMA 4D2IA 5DHAA 3GPLA 1NI3A 4ABYA 1WCV1 4Q01A 4DLWA 1F5NA 3QEOA 2HJVA 4M9ZA 2EFEB 1Q22A 1WP9A 5GVRA 2J41A 5KNDA 4UXJA 4A8JB 2IF0A 1U9IC 3QUSA 2WMOB 3NHAA 4LHVA 1MO5A 3IBYA 4US1R 4M8NE 4DBLC 4EPXA 3CNOA 1HY3A 1GOTA 1C1YA 3W6OA 3ZYCA 4P0TA 3THWA 4Q4JA 2ZRBA 5LBIA 1G7TA 2HXSA 2F3RA 3PUWA 2JLQA 4DXAA 5FOWA 4ZCLA 4K46A 3RS5A 2JLSA 5EJEA 2PZGA 1QVRA 2G1KA 4Y0AA 2P0EA 1XTSA 4GI7A 4IW3B 5IDVA 5IT5A 3ZD6A 2I4IA 4QBFA 4QBGB 5J4LA 2AN9A 2CHQA 2IS4A 2G88A 3BFKA 4QXAA 2CCKA 3DOFA 2GVDC 4OJKA 3UMRA 2WWIA 2YHSA 1GUAA 1S3SA 3D6TB 1ZAKA 1L7VC 2GXQA 1Z0FA 3EZ7A 4BEBA 4TL8A 3ZD7A 1G19A 3QKRB 4QGHA 5JJKA 4WA7A 2ONKA 5L3RA 1G3IA 1KI6B 3SNHA 1ZUIA 2N42A 3TRFA 2JLXA 3R9WA 2A78A 1LFDB 4MITA 4ESHA 1ZU4A 3VNVA 3NEJA 1KO5A 2RKOA 3MFYA 5JSZB 2ZTSA 2A5YB 3K0CC 2I3BA 4US0R 1QHXA 3BK7A 4DEXA 1E2IA 1ETUA 3BE4A 3X1ZA 1CULC 2EFGA 5C46F 1O3YA 3LBNA 1SKQA 2CK3D 3B60A 1W1WA 5C1BA 1Q21A 3RWOA 5CB8A 2WSSD 4NYIQ 1COWD 3ASZA 4NTZA 4BLRA 2GBLA 5J47A 1KZ7B 5HR5A 2O8FA 1FX0A 2BMDA 2QRZA 1YE8A 4FMBB 3X1WA 2NMVA 4LHYA 1D2MA 2PJRA 1N5LA 3GJ3A 1BIFA 2IS1A 1GKYA 5K8TA 4CEJB 3GD7A 2XGJA 1ZD8A 5EXPA 3TJZA 5FL7D 5BYJA 1KMQA 3ZVNA 4M1OA 2Q9AA 4OI0A 3EXAA 4MYHA 2R62A 2X2EA 3RVBA 2VSOA 1N6HA 5KTYA 1RZ3A 3SDZA 3EZ9A 3O8CA 1W0KA 2ZR7A 2CXXA 5B57C 1NMXA 4B6FA 3OESA 3THOA 4ZO4A 1LTQA 3IO5A 1VDZA 4TZ6A 2GAAA 2ZRCA 1E0KA 2VTKA 2QN6A 4HDQB 3L0PA 4NHOA 3FYHA 1NVVR 3AB3A 2H16A 2G1JA 1KIMA 1JPNA 2JIZA 3TW8B 4DCVA 1E2NA 1CR1A 5EE9A 2YJTD 2XSZD 1JQJC 3I3SR 3OAAD 2XJ4A 1E2KA 3T06B 5G3YA 4AKIA 1QZXA 5FTKA 4DT1A 1IN6A 3WNBA 3V4RA 3PITA 2IW3A 4N0DA 4AYXA 1E2HA 3B9QA 2WWYA 1TQ6A 3GEHA 4PX9A 4MKHA 2KWIA 1SZPA 1OYWA 1TUIA 4Z54A 4US2R 2O0JA 3QOFA 3P32A 1IY2A 3PEUA 5EE3A 1JQLB 3L0IB 3IIMA 3PFIA 3C7KA 4TMWA 1TX4B 1XPOA 2GA8A 4RZ3A 2ZE6A 2BKEA 2IHYA 4HAYA 2ZYVX 2MSEB 3MAAC 1JNYA 3FHTA 3UWOA 1IN7A 2MSCB 3QY0A 1OFTA 1KKMA 4Q5IA 4TSFA 3GLHE 5F2EA 4B73A 4NYMR 4V0MA 2OM2A 4EJSA 4R2HA 2DPXA 3H1TA 4OL0A 4TSFD 2B8TA 1TMKA 4P4SB 1XMSA 2YNMA 4JL6A 1ZM4A 3TVTA 4U00A 5AJWA 5DGXA 4CDGA 4IOKA 2OLJA 3U7EB 5HE9A 1SVWA 1G8GA 2OLKA 3A8TA 4PPQA 3VNUA 2QY9A 2V7QD 1R0XA 2B7CA 1AS2A 3CR8A 2IXFA 1E79A 3BXZA 5EE5B 1RRPA 5EUMA 1US8B 4F7WA 5L3QB 3U7FB 4JMPA 2NO0A 4OQMA 3TUZC 4F91B 1KKLA 5CK4A 1JR3A 4HDOB 1E6CA 3EA5A 2LCFA 1I2MA 2YWGA 4C4PA 2ZI3A 4LC1A 2WWHA 5FPKA 3LV8A 4PHFA 2R44A 4GMXA 3N2EA 3O8RA 1G41A 2X77A 3LRPA 4N3NA 2ZS7A 1G8YA 3B1ZA 4B32A 3ECCA 3WNDA 4IDNA 2AR7A 2UZIR 1QVAA 2JATA 4KFSA 3CB4A 4I1OA 1M2OB 4NONA 4BLOA 3B5JA 3QNUA 2ZXUA 1NSFA 2C5LA 4PC2A 4KXFB 5KO2A 4ACAA 1II0A 1BS1A 4QC2A 1E9AA 1VKJA 1DADA 1XEWY 2GETA 4TMKA 3HR8A 2C9CA 2QSYA 1OW3B 2WIAA 4PC6A 5F98A 2IF2A 5J4HA 5JHGB 5JWRA 5AR1A 1P9RA 4F93B 2AXNA 4UNQA 1P73A 1KK2A 3LA6A 4Q21A 5JI2E 3X1XA 1NKSA 4MUAA 2Z4SA 5B2ZA 4DLZA 1DG1G 1ANKA 4KO8A 1RJ9A 1RW4A 1G7SA 4MKFA 5HE8A 4D0NA 5LPNA 1U8YA 4TYWA 1W0JA 2D2FA 1JXMA 2QAGC 1M74A 2A30A 2DWQA 1OIVA 1ZUNB 2GCPA 2K5UA 2IX3A 2FA9A 2BWJA 2XTMA 1E9BA 2IYTA 1H65A 5KDOA 2L0XA 1G17A 1GVNB 1D8TA 2OFWA 1PLLA 4B47A 4TMVA 2AL7A 3SJBA 2C96A 4FN5A 3QQ5A 4Z8YA 1VYTA 2QT1A 1WB9A 4PAOA 1BMFD 2GJKA 3KB2A 4H1UA 3EWSA 1DVRA 3EW9A 4MRSA 3TAHA 5EXXA 2ZUCA 3VMFA 2CLSA 3UIEA 5FBRB 1KNXA 2FPKA 4TL7A 4MRVA 1VG9B 2GEUA 3CRVA 1XJ0A 1NKTA 2JAQA 2F9MA 3RS2A 2OT3B 3GFOA 3GEIA 3RC3A 1YZUA 3F3YA 2OCBA 1ZC3A 3R8CA 4F4JA 2QBYB 5GJVC 5KYKA 4JLOA 1P9NA 2W6ID 4GMDA 4LJ7A 1EFCA 1G5RA 1Z29A 2C9YA 4M22A 3PJRA 1ZP6A 2FFQA 1W4CA 2IUTA 1W4RA 3GJ8A 1XB2A 2ZITA 3WP1B 2CJWA 1R5OA 3OIVA 4Q7LA 5FBWB 4LYFA 3U5ZB 2CEAA 4BFYA 5GJWC 1BYUA 2IYZA 2FFHA 4MGZR 1E32A 1G3UA 3PCRB 4MGIR 5GJCA 2IL1A 2F6RA 1XJCA 8OHMA 3UATA 2WOJA 1KGDA 2WPDD 1A82A 2CCJA 4KITB 1ZD9A 3T1OA 2BMFA 4F38A 1ZW6A 3W5IA 3FFBA 3ND9A 2BBWA 3ADBA 3QVUA 2CNWD 4BPBA 3H84A 5EUQB 2W58A 2IS2A 3K70C 4XSGA 2F9LA 2BJWA 2QNRA 3BFXA 1OXSC 3IGFA 5TY0A 4ESVA 2Z4RA 4QHYA 1J7KA 2AFHE 2X1VA 3AVXA 1XMJA 2ZANA 4XTRA 1AGPA 4DLSA 1IHUA 2P65A 4TMTA 3HU1A 3KJHA 2ZRNA 3P4XA 2QTVB 3G82C 3LO5A 2BEKA 3AM1A 4XIGS 3IQWA 2F43B 3FVQA 4IOMA 3K0SA 2IXEA 2RHDA 2ZREA 2FSGA 4V0LA 1Z08A 4NCHA 4BE7B 4I81A 4IDOA 4ZKDA 621PA 5D3MB 2ZJOA 1B0UA 1VG0B 4URVR 1SVSA 4DSNA 2GZHA 1DTSA 2IEZA 4E09A 3OHMA 2XTNA 2WJVA 4Q4HB 3SQWA 1YU9A 3T15A 1KAOA 1JR6A 4V0OA 1R8QA 2HDNB 4LBZA 2JASA 1Z0JA 4KBFA 4PC7A 1QHHB 2GILA 3Q7PA 5GVSA 3RSOA 3VQTA 1UKVY 1Z0DA 2HUPA 3MWKA 1MRSA 2GF9A 4TT3D 1OSNA 4PSKA 2O8EB 1OFUX 3AUXA 1A2BA 3B82A 4LC0A 4DSTA 3CRW1 5CM8B 2C77A 4FINA 4A0HA 4C0SA 4ZI3A 2BBSA 5CITA 5HCNA 5CJ2A 1XU4A 3EPKA 1S8FA 3SOPA 3EPHA 3RC8A 4Y0VA 4DLXA 4QJ3A 4ZPXA 2OE2A 1EWRA 1KMHB 2WIBA 1IN8A 1W4AA 4QJ4A 5JRJA 4QGAA 4YMUA 1UKEA 3W3AA 1D2NA 3Q9LA 2HV8A 3CKLA 4B71A 3F5FA 4XWAA 1EG7A 4DCNA 5CDFA 2DFLA 2Q9BA 4JL5A 2ZSAA 5EZ6B 4MYUA 1TNDA 1W0KD 1OH5A 1VCNA 2VL7A 4A9AA 3U44B 2Q3MA 4PHGA 3L8ZA 2O8DA 1CEEA 4ACBA 2VBCA 5L3SA 5BW8A 3PXGA 1LVGA 2QRNA 3FMIA 5ANRB 1F6BA 5TB5A 5HKKA 1Z3IX 3U7HB 1GL9B 3K0FA 4LJ6A 3C5CA 4PPGA 3L82B 3GLFE 1EFUA 4D4MA 2H57A 3K09C 2WTUA 4C0BA 1EESA 4D80A 4EPYA 3OEHA 2ZIAA 4OI4A 2ZROA 5M04A 1XZPA 3LDAA 1YQTA 2Z5FA 3TSOA 4B74A 4RCYA 1LS6A 1Q3HA 1QHYA 4Q4JB 3K0CA 3MUFA 1E0SA 3LAWA 1KSGA 1FTNA 2WMNB 4JJZA 4JSTA 4JVLA 1OHHD 1ZCBA 3RDPA 3NDBB 1TU3A 2RGBA 3I61A 4YMVA 4BFVA 3OE7A 3H0KA 1QF9A 1JJ7A 2ODEA 3QI2A 1RC8A 1UJ2A 2FX3A 4HYYA 3W6NA 1CRPA 4RSGA 1KSHA 4B3BA 4EUNA 1T91A 4L15A 1RFLA 3I5XA 1B23P 1U2RA 2QMHA 3GQBA 2G9NA 2GXUA 2QGNA 1N25A 1OB2A 2HEIA 2ATXA 1Q1BA 3HU3A 5DN6A 1KO4A 4B3DA 1CIPA 3EAQA 3QKSB 2KSQA 1FP6A 1SVOA 2TMKA 5ELXA 2KBEA 2GDJA 5BN4A 3BH7A 4KBGA 4EPWA 3AVQA 1COWA 1QG2A 4U7DA 4JLPA 2W6IA 3A6PC 1S4QA 1UBGA 1M7HA 2IYYA 2QPTA 3UPUA 2QP3A 5SZKB 1XEFA 3AUYA 4BRWA 4C9BA 4TYNA 3GLGB 3QKUA 2FSHA 5CDFE 3A4LA 4DDWA 3A1VA 4UJ3A 5AJVB 1VG1A 3LLUA 4P3YA 2QP9X 1NP6A 1DAKA 4IVQA 1VYUA 4M1YA 1TTTA 3A1UA 4QHSA 3AVUA 2GNOA 3QPUA 2ANCA 2V4ZA 4QNRA 1VIAA 1T5IA 1XNJA 1BMFA 3K9HA 1DAFA 2PCJA 3DMNA 5LD2B 1VECA 2Z83A 1NBMD 3VTKA 3F8TA 5BN5A 1W4BA 2OEPA 4BGDA 1E9FA 5FI1B 3MG9A 1II9A 1ZD1A 4S2EA 2BJVA 1ZM3A 4A1FA 3CH4B 4XTCS 1W36C 4D4LA 3PUZA 2JA1A 2QZ4A 1N3BA 2QQEA 2VHTA 4FCWA 4IXMA 2P6NA 3NTUA 4LYHA 2FMXA 2DY1A 1Z2CA 1ZM9A 2DFKB 4PC3A 821PA 3SYKA 5IF9A 1U9IA 3M1IA 1WDTA 5KPDA 4LJ4A 5DH9A 1N2CE 3ZVRA 3DPUA 1FFHA 1GILA 3DVLA 3MGCA 1AJEA 5JECA 2OV2A 3L43A 4Q03A 1SVLA 4Q4LA 4Q9KA 5HZKA 1M7GA 1IONA 1NY5A 1GKIA 1SXJB 2P5TB 1TUEA 4G5GA 1C4OA 2ZAMA 1RKBA 4DKXA 2GK7A 1U0JA 4GOJA 5JEEA 1NN3A 3AF2A 1L2TA 4LHZA 2IEYA 1Z6GA 1KI8A 4WOPA 1G21E 1E69A 3QEJA 3RS7A 3U3KA 3R9XA 4LDJA 3TUIC 4TL6A 1E1QD 1E9EA 2WPDA 4F92B 2HLDD 3RABA 2X8AA 3R20A 2Q6TA 3GLGE 3EG5A 1W36B 2OCAA 4LBWA 1Q0UA 1E2JA 4PZZA 3SE0A 1MR3F 2JLYA 3IUYA 1SKYE 4PR0A 5JS8A 4OJQA 3ZLJA 2XNDD 1U8AA 1FZQA 1P5ZB 2GVZC 2V54A 4ZIRB 1IXRC 1XD8A 1QRAA 2H18A 4ITRC 5E95A 3SFVA 3T35A 4PTLA 3RWMB 2FGJA 2RAPA 2VP5A 4DLVA 2V7QA 4Q1CA 4OYHA 1T3SA 4LI0A 3GEEA 3TQFA 1XEXB 4JLBA 4AC9A 2W83A 3UANA 1YVDA 4D81A 3EARA 1KSFX 3FDIA 1X1RA 3RSLA 5EXTA 2D2EA 2PX3A 4WIAA 4D0GA 4Q7KA 4WVFA 1W5TA 1JAIA 1GG2A 4BZPA 4LK2A 1SGWA 3LW8A 3J81k 3KQLA 1CR4A 2B7BA 2CDNA 1DARA 2FSFA 3FHCB 4LV5B 3I5YA 1M1YE 3BWDD 4HUQA 3KUCA 1GNQA 2IUUA 2J59A 2ZI9A 2XXAB 4IOLA 4MDEA 5FTMA 5FUVA 1IXSB 3SHFA 4D6PA 2JGNA 2C9OA 4NL4H 1R0YA 4URWR 1HV8A 2H17A 3FTQA 2ZVQX 1IN5A 1II8A 1HT1E 5JZVA 2DFNA 2GRJA 4MGKR 2YWHA 3A4NA 1N6IA 1U0LA 1P3JA 2WAXA 2FWRA 4ZKEA 2W00A 1UF9A 2W2TA 2REBA 1E4YA 4R9UC 3PUXA 4V0KA 4KVGA 5TMPA 1LF5A 1NN5A 1DOAA 3F0TA 3DZ8A 1KY2A 4CEHB 4YDHB 2D7CA 4OK5A 4DSOA 1FW6A 4AI6A 3BH0A 4D82A 4ERNA 4Q4AB 2BVNA 4JVSB 2RMKA 1G291 3EIEA 2VIIA 3SBDA 1GSIA 4TN1A 1UBEA 1GNPA 2CCGA 4HB4A 2D3WA 3A58B 1OE0A 2F1IA 221PA 1E1RD 1GIAA 3H86A 4RZUA 5F9FA 1MT0A 4NZYA 1LW7A 4P33A 1YKSA 4Q1DA 3U61B 3B8HA 1U81A 1GRRA 1TF7A 1US8A 4RFSB 1DS6A 1NIJA 2J5XA 3I1FA 1VMAA 4O25A 4A92A 1C9KA 2GCNA 2AWOA 3FKSA 4LZZA 1KZGB 4LYAA 4EIWA 3E2IA 2PZFA 3DM9B 1IY0A 3AP2A 1CJTC 1PLJA 1UEJA 3JVUA 5SZJA 2GXSA 5JJIA 1KO1A 3NC1C 1TEVA 4L8GA 3LY5A 1OKKA 3FGNA 5FH9A 2ZE8A 4IKEA 2NO7A 3RNLA 1JBKA 3T1QA 2O8FB 1UBCA 1AGRA 1GL7A 2GJSA 1G8HA 2FJUA 3MWJA 1U90A 5EP3A 3BC1A 1RRCA 1HUQA 3THWB 3BERA 4RY2A 2P3SA 1H8HD 1NNEA 1VIYA 1AQUA 2WWXA 4UJ5A 3KFVA 5CB6A 1KJYA 3EA0A 3V9PA 4DJTA 5LDDC 1Z63A 1GITA 4L16A 5DISB 2O8BA 4OKSA 1A5TA 1SVKA 4Q66C 3VR2A 1UPTA 1Z0IA 3ZZUA 5FBVB 4CGZA 4DLRA 2JDIA 1L4YA 3WYFA 1H8HA 2NG1A 4LJ9A 3D7MA 4LUCA 3PUVA 1E0JA 1V43A 1X1SA 4LX0A 4XJXA 4EJSC 2ZRMA 1R5NA 1N0VC 3QKRA 3EASA 4DVGA 5J4YA 3B78A 1KI6A 3MWYW 4KFUA 3U7GA 2AKYA 4C0AC 1D9XA 1YZTA 2CLCX 1FOEB 3ZQ6A 3OEEA 4IFEA 4IEIA 1HT2E 2B6HA 2OXCA 1R0ZA 4TQ9A 2PJZA 4DEYA 1N6KA 3U4QB 4G5RA 1CLUA 5CLQA 4M53A 2QAJA 1KYIA 1PVOA 2CBZA 5B30A 4PHTA 1LV7A 4E22A 4WBSA 5DSZA 4DCTA 1I4DD 1JECA 4A2WA 3PEVA 4Z1MA 2ORWA 4Q7JB 4FMDB 3VKHA 1XTKA 4P32A 4ZDKA 1TQ2A 3THYA 1ZC4A 1PZNA 3LD9A 3VR6A 1GKUB 2J46A 3EC1A 3AVVA 1MABA 2FGKA 3C41J 4LGMA 1NY6A 4Q4AA 2WHXA 4MRRA 1ZNYA 1ZBDA 1NSTA 1FX0B 4HLUC 4MDFA 4IVRA 2AK2A 3CRQA 4EJSB 2BC9A 4BASA 1OLOA 1P60A 1Q3TA 3O8DA 4B43A 2EQBA 4A2PA 4QL3A 2W0MA 2N46A 1TQDA 4GBMA 1WF3A 1OXTA 3SQXA 3K70D 3B1YA 2ZETA 4EQ6B 3JZMA 3GLFB 5GADl 2F7SA 2RHMA 1KI9A 4HDCA 3DEFA 1CXZA 3DHWC 5KUTA 4B33A 3GJ5A 1YR7A 1K5GA 3HU2A 3FOZA 3DO6A 4L4UA 2Z6VA 2XTZA 4X8HA 3RLFA 1OT3A 5EE0A 4C0JA 3UMSA 4JKIA 5BQ5A 4BFTA 4FI3C 4MKGA 1G7RA 4HLUA 3EZFA 4LV8B 4QNMA 4CT4B 1N5JA 3WMEA 3B1VA 4C0LA 3E1SA 4A0GA 1VG8A 2BCGY 3T61A 4XVQA 1SULA 1UEIA 3B9PA 1X6VA 4HZUA 1CJUC 1ONBA 5EE1A 1KJZA 4FMDF 3ZH9B 2QPOA 2ZUDA 4UNNA 4DWJA 4KAXA 1TQ4A 2XOKA 5JRZA 4I1VA 3MJHA 1OH6A 3AGQA 2ODBA 1E79D 4NBSA 4Q7MB 3RYTC 2VO1A 1Y63A 1IXZA 1RRFA 4HB2A 2AFIE 4II7A 4JJKA 3AEZA 3D8BA 2VP9A 2D74A 2WWFA 2OZEA 2VLIA 3QKTA 2GJAA 1E94E 2QAGA 3LNCA 3T12A 1ZYUA 2IXGA 2QE7A 3IO3A 1E2MA 3CM0A 5H70A 1JB1A 3CF2A 5FBQB 3RRMA 3BS4A 4YLGA 3HDTA 3C4JA 2IUSA 2QQ0A 1HE8B 4OQLA 4JLNA 3VHLB 2J0SA 1Z6XA 5CLLA 2YOHA 3LBIA 1G20E 1G1MA 4M21A 1N0WA 4E07A 1ZCAA 1E2DA 1FQKA 1V5WA 3M6AA 3OF5A 3CPEA 3TIFA 1E9RA 2XB2A 3L8YA 4IDPA 2JJ1D 2GK6A 2QEQA 2W6JD 2ZRLA 3K9GA 4URUR 1MO6A 2FV8A 3K8YA 4M1MA 1P72A 5AK0A 3WBKA 1E2QA 4DLTA 4TL9A 1G7CA 1ZNWA 2B21A 3MCAA 3VFDA 3WP0A 3NEYA 4B3GA 1FMJA 3PR1A 4AKGA 2FEMA 3GLIE 4WW0A 4JLKA 1XZQA 4OK6A 3GLIB 4YMSA 3K0AB 1ZIPA 2REXB 1HQYE 4EFNA 3EZ2A 3KQKA 1YHNA 2J7PD 5SZIA 4JYBA 1EFRD 2ZE5A 4M9SA 5AJYA 2YKGA 4AYWA 2GAOA 2CMKA 4BZXA 3CLVA 3L0OA 4HLDA 4XH9B 2ZI7A 1Q1EA 1XD2B 2C2HA 2EWVA 3R9IA 4TYQA 2ZEJA 3DKPA 3QXSA 4BFXA 4TWZA 2DR3A 1Z83A 2XEXA 2AD5A 1G3MA 5AJZA 2J0UB 1G3RA 2ZI5A 5IHPA 2E87A 1Q57A 3AF3A 4M9XA 5DYIA 1JEDA 3IBGA 4FXPA 5FPTA 4PPNA 3N70A 1JR3E 1NBMA 3S1AA 5J4VA 1XRJA 1J70A 2VPPA 1X3SA 2WJJA 3SJAA 2YC2C 4ZV4A 5KSYA 4EPTA 3DOEA 3DZDA 2G0NA 3QXCA 4LV6A 3R7WB 4PANA 1Z2AA 2WSSA 2Y8EA 2BIFA 2CE2X 3U6BA 1HQCA 3IHLA 3AV0B 2ASEA 2MMGA 4YXWD 3VKWA 2IYXA 2ZPTX 2QI9C 3C8UA 1H8EA 2ODWA 2D7DA 2ZRKA 1OXVA 1W44A 2WAYA 3TSZA 1DO2A 1AK2A 1GRQA 4Q19A 5E7IA 2NZJA 5KU1A 1TU4A 2F1RA 3P4YA 1EWQA 4A4DA 4RD6A 1D5CA 1ESNA 4DUGA 1OXXK 2V1UA 2J87A 3WXMA 2OXRA 3LBHA 1XP8A 2ONJA 2F43A 2QAGB 2QE7D 2DWPA 3A1WA 2B92A 2EWWA 4NPHA 3CNNA 3ND8A 5DN6D 2CL7X 2C98A 3HR7A 1HURA 4TLCA 4C30A 2PZEA 4RVCA 3P1JA 1KDOA 2QM8A 4A0FA 2JLUA 4C2UA 1ODFA 2LWIA 1GWNA 1UADA 3O47A 2NOAA 4NH0A 2YV5A 4H9GA 4ZI2A 2VHUA 3AF0A 4B2LA 2AD1A 3NVAA 3GFTA 4KVAA 1YR8A 1ZM7A 2ZJ5A 4B34A 1EFTA 1U98A 2G6BA 1T0HB 1FUUA 3SYNA 3D3QA 1Q12A 1UKZA 3Q85A 2QMEA 1IM2A 2Q3FA 2DWOA 4TTQA 2R6AA 3T5DA 3QVVA 3WBJA 2GJ9A 4AIIA 5FR1A 5AUQA 4A8JA 3W8RA 3KX2A 4G3XA 1WA5A 4NP6A 3EPJA 1K5DA 2AXPA 2JLZA 1OFHA 2BV3A 3NHBA 4OHVA 2IK8A 4N1AA 2O5VA 2PLFA 1HEIA 1ZINA 2A7QA 3JVVA 3TE6A 1E9CA 1P4SA 2PCLA 2R6FA 3HJNA 4TTPA 5HKKD 1KDRA 2IYWA 4C2TA 2IA5A 3MMPA 3FB4A 4I1UA 4B2PA 5FUWA 2E1RA 1DBSA 2BDTA 1QHSA 3AF1A 2VRWA 2F1JA 3IDQA 3NH9A 3ZIAD 4CW7A 3TSWA 1RYFA
chains in the Genus database with same CATH superfamily
2G9VA 1WY7A 1YR3A 2PT7A 1HT3A 4GRAA 3UNXA 4BFWA 3ER9A 1FMLA 4XYBA 5L7WA 3GZNB 5JYDA 4MB0A 3JQAD 3X1MA 1I4LD 1X19A 3D0QA 3HB1A 2GEFA 3WV4A 4YCLA 4KMSA 4EMBA 3F7OA 5CK5A 2QRGA 3PDIB 4AZ0A 3IUBA 5LMZA 2LW7A 3UMVA 4MR7B 1YR6A 4R7GA 2ODNA 3HEMA 4I66A 2DH6A 1B14A 3K5HA 3WG9A 2OHFA 1PYOA 4LGCA 5K05A 4JYZA 1W0CA 2PZ8A 3EW7A 4NBWA 3UUEA 1E4EB 1ZGAA 3C8ZA 3RKRA 1DBIA 2OO5C 4V0RA 3U62A 4UTRA 5A04A 1ISJA 1M2JA 2RH5A 1TCBA 5K3AA 8MHTA 3K2EA 2F8TA 2P5YA 2BKLA 1UAAA 1OFVA 1BGWA 4FR0A 3TRIA 4NEGA 3ABIA 3DCIA 2E9SA 2FEPA 3CO0S 1NJ2A 4GP6A 4LRWA 4MLPA 4E46A 5KQRA 5ICFA 4RE6A 3G0HA 1CUVA 5TLSA 2WJHA 4HXEB 4L07A 4MQFB 3CEHA 3I39X 4PPYA 1D5WA 1RC0A 3AESA 1GGHA 3P9PA 1E6LA 2ZRDA 4HWKA 1FP4B 4GX2A 4RANA 4HK4A 1AUQA 3DUWA 4KRYA 1P74A 1UR5A 2VK2A 2C9BA 1BS2A 4RZXA 1VHWA 3RBZA 2WV7A 2HB6A 1L4GA 1OVMA 5IK2D 1G3QA 2IYQA 1T0PA 2WD9A 3NWBA 3WGNA 1BVRA 5IKMA 2EW1A 5REQA 3RJTA 2PWAA 1F1JA 1FVOA 3U7QB 2ZSEA 4HSEA 1RWNA 3RUDA 4BMYA 2Q0HA 4PLFA 2AWNA 4BQFA 3KOUA 1CK4A 2J85A 3NCTA 3IDZA 1F2TB 1Y1KE 1ILWA 2AJCA 3DAFA 4ENRA 3WKBA 5HMLA 2QVBA 2X3FA 3W8DA 2Q2WA 2OILA 5NULA 4RVUA 3CNBA 5DT9A 1JHZA 5EWMA 5JR3A 4OJTA 2HWYA 5KS2A 1LPMA 1F0PA 1P9LA 2OSBA 3PBKA 1N8NA 4OSPA 4XQEA 3K6SB 3ASUA 2YINC 2J1LA 4Z0NA 1U3UA 5TJHA 4YJHA 5INTA 1L3IA 3AFNA 3TW8A 1WDKA 1VJGA 3E2PA 3R0QA 4RENA 4G23A 3BD7A 4MS1B 5E3HA 3EZNA 1TM7E 3WLEA 4RETA 4ARIA 1H42A 2QNIA 3OSZA 1G6Q1 3I4LA 4WADA 4ZQHA 1I3LA 1W6RA 4AY2A 2P1RA 4QECA 1C3LA 1EGVB 2Y3IA 2B2CA 3CINA 1THZA 4R1UA 1CW2B 2CNKA 1CY1A 1KAHA 1SIWA 2KYRA 2NXWA 2B36A 1TI7A 2XOXA 4UDOA 3BIWA 5EG5A 2ZDHA 4U63A 1JIUA 2RGAA 2XW6A 5I3ZA 3PUJA 1K9VF 1EDBA 2OL4A 5AM2A 4CKWA 3U56A 5EIEA 1N2ZA 5JNUA 3G2HA 4L22A 3D6AA 1DC8A 2QA5A 1IY9A 5LIPA 2H4WA 4LSGA 3TNLA 1M2KA 3FOWA 1CTQA 3HACA 3I9FA 4HJRA 4KUGA 3RIMA 3KQVA 2CZCA 4K9KA 1M6VB 1AKWA 1JG6A 4MV8A 1UKAA 1H5UA 1X15A 3GEBA 4ISBA 4INAA 1ZUNA 2CWDA 2ZCJA 2H2WA 3TGWA 1Z4QA 3TECE 4WEQA 3K6JA 4O4JB 5AKLA 2ECPA 3AI2A 3B9BA 3FCCA 1G8AA 3TB6A 3U17A 2WZBA 5JZOA 3IQXA 1Z6QA 4ZT4A 1UANA 1FL9A 5HWSA 1TRKA 5BN4B 1KBQA 3UK7A 4R3UC 3D0KA 2QD3A 4NZ9A 4C0KA 3CWQA 2BFBA 2R68A 4MUGA 4CV0A 5IRCD 2IXBA 1YFZA 2GBFA 1NLZA 3NRBA 1PX2A 4LW8A 1L5GB 3ZH2A 1O0CA 4GKJB 3QNWA 5CIQA 1QYWA 4LCBA 4J0JA 5JO0A 2GH1A 3PUKA 3VJLA 3UJ7A 5K8LA 3QPVA 1E4VA 3BSFA 2VHJA 2FRDA 2VZEA 1HE3A 2WD8A 3R3XA 2XDQB 2XH8A 2GZ1A 3FI9A 2PY6A 4HYEA 3GJ0A 4LOLA 5E8RA 4RPHA 4F8JA 1W36D 4TMXA 2ZR0A 3PXBA 3KXKA 4RULA 2ZRHA 5E6SB 4L7VA 1SQGA 4KLNA 2YDXA 3DTVB 2OYRA 1HTBA 3LUFA 2YL2A 4UKDA 3K1YA 1EPUA 4YS6A 3VXKA 3H6KA 3R9KA 4Y9SA 5JJ5A 2WJ6A 2V4MA 2JFYA 2V6BA 2ZJ7A 4D9JA 2WZQA 5H16A 4EF6A 4JKYA 3ADCA 4MWOA 4CKEB 1WRBA 1O87A 4N4AA 2FPMA 5TQ2A 1GCAA 5GIOE 4L3VA 4HDSB 4S1WA 4YQYA 5DBEX 4WV3A 1P0PA 4TV9B 5GMOA 1UBFA 4L6AA 4MWEA 1NBWB 4L0QA 5KSPA 3NDRA 1OR8A 3VR4H 5FD8A 1ZMOA 4QM6A 2PRZA 3B12A 5IM5A 4Q9HA 3FF4A 5DK6A 1BOFA 2WUFA 4GSYA 3IUNA 1WMEA 4C29A 2H4FA 3RHFA 4D45A 1AGXA 3OOEA 4JOSA 4DV4B 4FLFA 2CHGA 3VVMA 3SHOA 2D2IA 4TRRA 2Q5HA 4BYGA 3DGEC 3LP8A 1N36B 1PT9A 3QLJA 4FOLA 4ZAZA 3UAVA 3H9QA 1LBQA 4R9NA 3AYZB 4QG3A 1CU1A 3IAUA 3K9QO 4PO8A 2IV2X 3VTAA 1PJTA 3FUTA 1TMGE 1IEQA 3P97A 4AULA 4L78A 3DUFB 3WGZA 6REQB 1KVRA 3EQ8A 3QG5A 2C78A 3A0UA 3GUHA 1A2OA 4AJKA 4G0PA 3L8GA 1K5HA 1MAVA 1Y8AA 5HUQA 5HIMA 4NOKA 1PT6A 4EAQA 1Z5WA 1R0RE 1QSGA 2DHQA 3IIKA 1KC1A 4Z7OB 5GGXA 1ZIOA 3O3OB 5LDGA 2X5XA 1MRNA 3FCSB 4OREX 2G1UA 4YMGA 4Z1OA 1GGFA 4IF4A 5D3ZA 5HJ5A 3UK6A 1PJ2A 4JP3A 4RJTA 3PQCA 3ZDRA 4NNPA 2W2NA 2Y1DA 2W2LA 2B1RA 4RMNA 5JLAA 5I8WA 1FDWA 2R6CA 3HVHA 3ZV4A 1C3EA 4WKCA 3L0DA 3MTGA 3O3MB 3IIEA 2CVHA 4V1CI 5A0TA 1FDVA 4G0NA 4L5CA 5TV2A 4WLVA 1KWKA 3UG7A 1R4ZA 1KPHA 2P2DA 3CNQS 3HEBA 4M1EA 1JKIA 5CH8A 5A4IS 5EUBA 4RC9A 3CUVA 2O50A 1OTYA 2JCYA 2RK4A 4NRDA 1SCKA 2BL4A 2LCIA 5AK4A 5H68A 3SWWA 2A0YA 3VR5H 2D7JA 2AUNA 2HNBA 4FZ3A 4TZTA 1QIFA 4YBRA 5B7QA 4NH4A 4PLVA 2QQFA 4MK4A 1FBNA 2Z43A 2SICE 1FS5A 2RBKA 5BWBA 4CI0B 5AVKA 3A4YA 1E3WA 3IIJA 3L8MA 4CMEA 5ABPA 3V8EA 1Y3FE 2HJRA 1YL5A 4YJ3B 1QV6A 2PKYX 3AR3A 1GP2A 1UJ6A 2FZWA 3HFGA 2RD2A 3A31A 2GRUA 5CA1A 3ZX4A 3S8EA 1O54A 3EDOA 521PA 1ISPA 3KJGA 4LWPA 4CLOA 3WA7A 1JA0A 3NG1A 4G5XA 1HTWA 1R5BA 1QQ6A 1KYVA 1VL2A 2NUTB 2QUZA 5G2OA 4Z9AA 4EY5A 4RGQA 4EKDA 3ADDA 5BPHA 1N3IA 3BJIC 1CLEA 3E70C 5LQSA 1GU7A 3KWFA 3FCYA 4N8SA 3NC0C 1P8JA 1P2UA 5BT8A 1JPJA 1QGUB 4DV2B 3KKQA 2I4TA 1EHIA 4BLTA 4CYMA 5MFZA 1U0BB 1WCXA 5BMVA 1DEXA 1PK8A 1SCBA 4Q9DA 5HA5A 5THXA 2D1SA 3ZR4B 2O59A 1YVEI 1ISMA 2QMZA 3PXEA 1WUJS 1N2GA 4IY1A 3GYBA 4EGAA 4ZI7A 3KEOA 2YFHA 1C2TA 5D3MA 4R7ZA 1L7NA 2YX1A 1BXZA 2OZLB 3CUUA 1CYDA 1XKXA 4I19A 5JCJA 4ZMRA 5EJ9A 5IPFA 1MO4A 4NU0A 2QTRA 5JSZA 5MN6A 1S2GA 2CFOA 2PTHA 4ZHSA 3ETGA 1E66A 2R8XA 1XYGA 2HI0A 1YOVA 3F6YA 4S12A 3LL7A 3LC0A 3B6IA 3QPDA 4KRFA 3IPXA 2M98A 4TS4A 2YJ6A 1DP4A 3O4RA 2HLNA 3BMXA 5DXJA 1FDTA 4O2RA 1VJ1A 5E9WA 4F1JA 1VGQA 1Z6TA 3PU6A 2L42A 4NPAA 1CR0A 5B5SA 3D59A 1SHUX 3GLQA 1XVTA 3DE4X 4C78A 1I8TA 3O38A 1EUQA 2IYOA 3ZU2A 3SPXA 5KOJA 2H2FA 1UBRS 1WB4A 4JT2A 5B6JA 4DM4A 1CQXA 2R7LA 3A28A 4Q82A 2FNAA 4UUBA 4MQUA 5DWDA 2Y9MB 2ZUBA 2OYCA 2VYFA 3GZJA 4WNYA 3TZQA 2NPIA 3P0IA 4G1FA 1LBTA 5E3IA 2V3CC 2O8CA 4UVHA 5KDDA 1FPQA 1PG2A 2CVZA 2GA9A 3REOA 4BVLA 4I1SA 3ND5A 4WE3A 3N7UA 5ALQA 5KVQA 3UUFA 1F2UB 1FS6A 2WAAA 1M2FA 1M0WA 3DULA 1E9SA 3CX8A 3I58A 5DYWA 3LP6A 3WLMA 2ZP1A 2XY4A 1DKNA 1SB8A 1GZ5A 4NHEA 4QGGA 1WF6A 1HEUA 3Q11A 3ND6A 1S8OA 4I4TB 1ZQ9A 4PAGA 2VWPA 3NYWA 2BGWA 4TSRA 4EG0A 1YUBA 4OHPA 1CZNA 2H00A 5IJ0A 3TNFA 1MO2A 5DNYB 2H2GA 4MP8A 1EBUA 5HILA 1KI4A 1PZXA 5CR9A 3OJCA 1H85A 2M6RA 4GPEA 5EAIA 2HJHA 3V8NA 3R7NA 3SAJA 1BO6A 1UDWA 3OPYB 3TQSA 3AERA 3U7RA 4AY4A 4IDFA 3BTVA 1TZJA 3AXTA 3GDGA 4EB8A 1MN6A 2X19A 2A9OA 1DAMA 2ZRGA 3FD8A 3IDSA 4Q47A 5B1YA 5HIAA 4URZR 3KKLA 4BKOA 3JQCA 10MHA 1E3EA 1ORWA 3AR7A 1QH9A 3TBKA 1XTUA 4EGSA 4FCTA 4QU5A 3WRXC 2FMTA 2Y2UA 1QORA 4IG4A 3QSYA 1BH6A 1AUVA 1J99A 3UO8B 1QFMA 3OKFA 5H3CA 2KPOA 1RBZA 2ZBGA 3LNTA 4P7KA 5KYYB 3L6RA 3HNPA 3Q10A 3RLIA 3HJRA 1OPRA 2PH1A 3DBLA 3FMVA 4R2IA 4XQGA 3VR3D 3EPLA 3PKIA 2ZAIA 3R3WA 1F0YA 1MZVA 3AH8A 2XVXA 5C4MA 4IWYA 1DKOA 1MG5A 5EP4A 4DY4A 1X7HA 5H80A 3H5VA 3JALB 4II3A 2Q07A 3DE6X 3WYNA 6ABPA 4YC7A 3CRNA 4K9PA 2GFQA 3M1LA 1IL0A 1GGNA 3RHZA 2ZB7A 1QO0D 3FVWA 4GG1A 4I4TF 2X5JO 2J3DA 4PAQA 1TECE 2FVYA 3D8TA 5CNKA 1I7PA 1JYSA 4LEIA 3O7MA 1EXDA 4IM7A 3SHQA 1ODJA 2AMYA 4V24A 1P2BA 1L0BA 5AKKA 4GOLD 3ROXA 1JA1A 1UDXA 2VHYA 3JYOA 3W5SA 2J48A 1T9GR 1C3OB 3EUEA 2GVNA 3KZCA 4NQRA 2H1CA 1TL7C 2WKRA 3E84A 3L6BA 1YFJA 1GL6A 1EZ1A 5GONB 4RUKA 3C5HA 4H6VA 1XX6A 4HT3B 5BQ3A 1AMOA 2BMJA 1E5LA 3THRA 3T3IA 2C5EA 4I46A 4P86A 5TS3A 3PDUA 1J24A 3BMNB 1B6RA 4MVJE 3BFVA 5CBKA 2QU7A 4OHYA 2B4AA 1PKXA 2CNWA 2H9AA 1Y4SA 1N6NA 5JISA 4KHZA 4J1TC 2ISQA 2O48X 4R1MA 5IH3A 4YP6A 5EUCA 1EDZA 1XJQA 1IZ8A 2C9DA 1CY2A 2HXYA 2NU9A 2X14A 2KS6A 5G1PA 3TK1A 4D7AA 1M0TA 1S0UA 2RBEA 3PIRA 3BK2A 4G01B 1QAOA 1K68A 5EGSA 5FT9A 3W1WA 3VYTB 4MTCA 1THMA 1E2EA 1EK1A 4RYLA 3VC3A 4EGFA 4QJBA 3V00A 2BHRA 1M8PA 1QV7A 2J31A 1EJ0A 2PX6A 4GPIB 4R1PA 4RV4A 3TX6A 4E03A 2BELA 4ZCRA 3U19A 1HL3A 4W99A 3FZYA 1EVJA 2RJNA 1LVHA 3R0VA 1V4VA 4RKFA 1N0HA 2NZUG 3C6BA 2KJQA 3K0HA 1NVKA 3R7FA 3WFZA 5BNWA 2WW8A 1N7IA 3AEXA 2P8SA 4GLBA 4K05A 3G13A 4AKHA 1MORA 3COYA 4HVTA 1RADA 1M67A 2I80A 1W75A 1C7QA 1RAEA 3WK7A 1AQNA 1TTHA 2BEVA 4OTZA 3MELA 3OQIA 4YMTA 1C80A 4HP8A 4GPAA 3CZ9A 5DNWA 1OVGA 2GZAA 3NXKA 3LX6A 4FX2A 4L51A 1EJ6A 3D0RA 1Y5NA 3BBLA 4QDJA 1VB3A 3W3AD 4DIMA 1K8ZB 5HEKA 2AOUB 2BMEA 3QF4A 5DYNA 1Y4UA 4ZO8A 4ONEA 3TKLA 3M4XA 1QM5A 4FDTA 4TQAA 3PFFA 1GM5A 1MJ5A 1D6NA 1UOPA 4GYKA 1JHXA 4NMMA 3BF7A 2EFJA 5K6RA 3A36A 1C8VB 2B5VA 3OCXA 2P90A 4A36A 3T4PA 1T2EA 5AW7A 3FY4A 2QTHA 5KU7A 3KQOA 1RVDA 3IBSA 1R37A 1J97A 2IX9A 2X15A 1DJOA 1T0BA 4KGVA 5EWLB 4B3FX 3V1NA 2SKEA 5BUSA 1G21A 4UTZA 1GZSA 4O2AF 3CVVA 2PUDA 5FFFA 3TQRA 1OROA 4WNAA 1A95A 4M0MA 1YD7A 1JEEA 2PX0A 3KPUA 3U3DA 1XK6A 4OKIA 5FV7A 5FPYA 2ZSBA 3BXHA 1G5PA 3GVCA 1OLUB 3IVAA 3UKDA 2BGGA 4BMVA 2ECKA 2PEYA 2WJYA 3GG9A 4KFTA 4Q7QA 4WZBB 5CFQA 1K86A 1RC1A 1Z26A 4HEA1 5CCDA 3GLIA 3GOHA 1JSCA 4ZIRA 1U8FO 2N1BA 2OCYC 2P5SA 5HGJA 2XQJA 3QP9A 1MV5A 2D8AA 4G36A 2QBYA 1VKHA 2LKCA 2FE4A 3RS0A 4WXPA 1AN0A 2Q1SA 4YMIA 4BQRA 2XZLA 4I55B 2ETXA 3DV9A 1U1EA 4RD4A 3A9SA 4KI0A 4XGNA 4EX7A 1S2OA 1YJAA 2RH8A 3IUMA 3JD1A 2YZNA 3GJZA 2W6OA 5B58T 3RM3A 1XE3A 3G1UA 3LF1A 3RT1A 2HCJB 5KTKA 2OBNA 2CF5A 4ZVNA 3A11A 2NXNA 2FWJA 3L46A 3R1IA 1PK9A 3ON5A 2QN3A 4HXFB 1T8UA 2O0HA 2JANA 3X2SA 5KTOA 5B7PA 1FMFA 2QZ9A 4OFZA 2AFHB 4FGLA 3K2BA 4CV2A 3ED1A 4CF5A 5IW8A 4FIZA 5D1NA 1T5LA 4X84A 4OI2A 3HXLA 5JSUA 4P92A 2X0JA 4CG1A 4Q9NA 3FMOB 1KU0A 1X8XA 2H51A 4PYKA 3MERA 4G5YA 1JE1A 3PGKA 2BFAA 2WBLC 3QOWA 2HZ7A 4ZARA 4YQFA 4K3UA 2G6TA 4L3WA 4GH5A 4ZXFA 4Y9UA 1FJGB 2DSTA 4OYLA 5BUZA 4FOOA 4HYQA 5CMLA 2F48A 4ECEA 1T35A 2QL6A 3L77A 1M73E 1N6PA 2HM7A 1IB6A 1KYQA 4P6VF 5J9FA 1P61B 5JCOC 1OPXA 1ZUWA 1RAGA 3JASA 3AP3A 1ZMTA 1T9KA 2YVUA 2YIVX 3OMLA 3WZ2A 4C4RA 2EFCB 4F4CA 4QDTA 3ROEA 4HXYA 1DJLA 3C6XA 1DRKA 2IX3A 4EY8A 1MO3A 4UHKA 2A8YA 4A6XA 4YX9A 1Z5UA 2VJBA 5J4KA 5DRTA 1CUYA 3HWRA 1JIKA 1E2LA 3HA7A 2IKSA 5IH7A 5KYNA 5C51B 1MW9X 2CHUA 2OK8A 4MPRA 1U8UA 4LF5B 3OJWA 4X8OA 3OF3A 4RJLA 3JQ8A 2FUEA 3CF4G 1LRKA 1AD2A 3EVZA 3U4DA 3BWYA 3TW6A 1FRVA 3HUFA 4OX9Y 1OJLA 1A9SA 5JMWA 2Z3ZA 1GCUA 5LLTA 1CIVA 3QF4B 1WPXA 1OBOA 4ZU3A 2CHEA 4FONA 3UHPA 1G9TA 2R6JA 1B76A 3LKBA 2QUJA 3LX5A 3OPVA 3EC2A 3UB3A 5IK2A 3PF8A 4U2CA 4BQIA 5FEMA 3RHSA 4TT3A 1NG1A 3OX4A 4ZAFA 2W6JA 3RAPR 3WK4A 2IHNA 3I6BA 2AVDA 2ZYSA 2QM0A 3PDHA 4X62B 2PT9A 3DUFA 3H1GA 4R16A 2ZGVA 4UXHA 3F8WA 3LECA 4W5HA 5LQUA 3K9NA 2LDBA 1K7XB 3NNNA 5JD5A 3QE3A 1Y48E 3ESZA 4L9WA 3UMGA 1ESEA 2EKQA 4RMJA 4WH0A 3BJZA 5DIFA 1E64A 2M6SA 4R41A 5KDLA 4BNUA 3HKEB 5JQGA 3ZDFA 1VHDA 1KQNA 3L9WA 5C8YA 1GUFA 4BFUA 4LXQA 3FYUC 1RXSA 1NJFA 1BJTA 4FW8A 4M0LA 5FFMA 4CIDA 3WGIA 1HG0A 1B6SA 1YU6A 2YXEA 2LRHA 3NHLA 3TR0A 4F5ZA 3AY7A 3LVFO 2QU8A 3ZQUA 3ZJVA 4N5IX 2VHCA 2H65A 2C1EA 1IY1A 5EJ8A 3VX4A 3B70A 4K2AA 2X8WA 4ZT3A 3PNYA 2KQUA 4GFDA 5K01A 5TGZA 4PR3A 4MWDA 1YK0A 4YXFA 1P18A 2PKXA 1ENOA 3CR3C 2YTZA 1A4XA 4HPJB 4EQ6A 3FMPB 1T9GS 1QF7A 4L4RA 3DQPA 1WKCA 1CB7A 5KSWB 1U2EA 3D02A 4RD0A 4BS9A 5IVKA 4G67A 3NC4A 3J7AC 5IAOA 4GP9A 4AG3A 2JCXA 4QDXA 3C3XA 1M3SA 2C0PA 1TAHA 3RRJA 3GP8A 4Y2PA 5KVVA 3R4CA 4TRJA 2XBUA 3KHTA 1CUFA 3PYMA 3K16A 2PSEA 1MDBA 1VTKA 4P3OA 5KPJA 1RSZA 4ON9A 2GPSA 3K1ZA 2Z1NA 2F3SA 3N76A 4O4IB 4BNTA 4X7PA 1FYVA 1SHZA 4MXDA 3V1YA 1UZMA 3UT0A 2A9FA 1FTGA 3U09A 1KS2A 1OWLA 1R4MA 3FLEA 3I45A 2O3JA 1P19A 1NVDA 2OHGA 3C3BA 3EPPA 3IJ5A 4BJ5A 4BKPA 1P2VA 2ZJ8A 1EUYA 4F97A 3V4ZA 1MV8A 3NXSA 4HLNA 1LDYA 1TA9A 3ZNPA 2QRUA 4NY1A 4L9RA 3RSZA 2BMWA 3IAFA 5JSYA 1G5QA 1SXPA 5ILGA 5AK6A 4XIIA 4ZHQA 4LMRA 3VKGA 2Z8YM 3CSUA 2E4ZA 3PENA 1Y3AA 1FSSA 3COWA 4CIYA 4HAIA 5E2AA 1A5BB 3ENQA 4J43A 1L1EA 4EKIA 1LTKA 2MCFA 4WBNA 4XAQA 3X1KA 3MEQA 5M3BA 1U8CB 4P7FA 3PF9A 3FM9A 3ICWA 1XRSB 2QTFA 4TLEA 1W2HA 2HU5A 5KB3A 3KEFA 1H1LB 4QYMA 1J8FA 3QEAZ 4D99A 3GPBA 1S01A 4R7TA 4XI9A 1XZJA 2ORIA 4IMPA 4U0JA 1B8NA 3BE6A 1PR0A 5NLLA 2PT6A 3A9TA 2R8ZA 2AYXA 5AKEA 1R10A 2G77B 1NN0A 3MD0A 4HX9A 3DZBA 2YVLA 3OQJA 1PTJA 5GV8A 4D9EA 2Z3VA 4OQEA 2J9RA 4R68A 2GCOA 3IAEA 4BRZA 1XTIA 2O14A 3DS8A 2JNWA 4R98A 4X90A 2DQZA 2EERA 5CHEA 3IP9A 1XMIA 3THXA 4OHWA 4HEQA 5K1ZA 3U3RA 3DFKA 1SU8A 2WHEA 4CM8A 2XUOA 1WDWB 5E9AA 2FLWA 4HATA 3WNCA 3ZS8A 5LYJF 1MQAA 1WCWA 2QORA 2UVQA 4MQ4A 4B4DA 1OHHA 3E5HA 4FYWA 1XR3A 3MCUA 3VPFA 2YHAA 1XQ6A 2H52A 2XPCA 2PVCA 3CH7A 2MYTA 2WVJA 3RF6A 1D6MA 4B75A 2GASA 1YZQA 3AKDA 4FMCB 1QYVA 2WJZB 3DTVA 3NT2A 4H18A 2YYYA 4PXAA 1J5EB 2YWDA 4FYXA 4KE9A 1SK9A 5F21A 5IC6A 3VU1A 4C6SA 4B40A 4E0BA 4EHLA 2I76A 3LWBA 1ZJ4A 4IHJB 5JHHB 2I0FA 3RRNA 1LY1A 3WGHA 2WA1A 5BSUA 2PG3A 3ZK9A 4J90A 1NMEA 1UL1X 4IJKA 2C4WA 3WMFA 3V33A 1LNZA 1Y9AA 3DH0A 1ACJA 2OAP1 3AR2A 4V0NA 4D6YA 2K6GA 1JDUA 2ZS8A 2R65A 4PG7A 1U3TA 4TYPA 4CCYA 4E5MA 3O2QB 4CMHA 5FL7A 1JN0A 3ASYA 3IV9A 1ENYA 4KFRA 3UBMA 4E6PA 4R2XA 5K0ZA 1JQBA 2FR0A 2P41A 2AX4A 3VBCA 1EGHA 1W8IA 1VPLA 4GI5A 1QMGA 4JI3B 5DI3B 2QG6A 3SYLA 3IYLW 1PNTA 2JBWA 1O6GA 1ORIA 2Y1FA 3DLTA 3P2IA 4KWCA 4P54A 3G0GA 1O95A 1T4MA 4P08A 1KJWA 5F4BA 3M6LA 2A1TR 4D4JA 2XGMA 3WL8A 5KWVA 3UH1A 3UV3A 2YRFA 1EMDA 1XKTA 2I62A 1G6HA 3MYRA 3OY7A 4X3PA 1YMUA 4JA2A 1T9HA 4BVFA 4DCPA 1H9CA 3JX9A 4MI1A 2NO6A 2VJKA 2P6RA 4DMCA 2ZSJA 3GZTB 3G6KA 2A9RA 2YHIA 4LZNA 1OREA 1CSEE 2QM7A 2OSVA 1VC2A 4CQLA 5KOHB 4KHPB 3D4OA 2PL3A 1PIWA 3KWLA 2VAPA 2AIRA 1TLFA 5BNIA 3QE0A 3DZJA 4KODA 2GBPA 1TK9A 1G42A 3OZUA 4NX2A 3ZDCA 3FW1A 1E3MA 2I4NA 3AV3A 1DLJA 3LXRA 3LQRA 3REQA 5EHZA 1C29B 4P4LA 4G8BA 1T2CA 1A4RA 1I7NA 4RH3A 4RVGA 3DQZA 1JSXA 4QSHA 121PA 5CX1B 3KYJB 2UKDA 4J76A 5KOYA 1VGRA 3AUUA 3PD1A 1GV0A 3QIAA 4PLYA 3SS7X 3VPXA 4F2HA 5FDFA 5HP4A 1BQ3A 4N76A 4EHJA 2V6GA 1YJ5A 2XNKA 2HA5A 5EPOA 4S04A 3S2YA 3WJ7A 5JALA 3TH5A 3SGLA 1JS1X 5MN4A 1FQJA 3I9OA 1UOEA 3FE2A 4HNAB 1QP4A 3DNMA 1ESMA 3MWLA 2NTEA 2ZE7A 3L1JA 3OURA 4GIBA 3F90A 3QSGA 4EOGA 1Z07A 2J0UA 4CEIA 3PQDA 1SCDA 4EFMA 4IDAA 3BIOA 3K8ZA 3OJFA 1MOZA 3ZLBA 2IDJA 5M34A 4B9AA 2A2ZA 4B46A 3FDFA 3NHWA 3PV0A 4INOA 1Z8HA 1CUSA 4QU0A 4ZYYA 3VR6H 3IQDB 5FAKA 1MKYA 1A8HA 4WOBA 2HWWA 3A2LA 3RYCB 3LVRE 1QX3A 4TT8A 2W4IA 5A4AA 1DELA 2X9VA 3TFOA 1CP2A 4G6ZA 4HN4B 1E1CA 5CCEA 1KY3A 1E3LA 3O8BA 2NTJA 3NONA 1WXGA 2LP4Y 2NYRA 4FSDA 5FWXB 4RTPA 4FDVA 1T3HA 2WJIA 3PC6A 4WA8A 3S5JA 4YXWA 1G8KA 3IAXA 1P75A 4RGYA 4AMZA 3L0BA 1N78A 1FC0A 1RYHA 2J5QA 3WYCA 1XYYA 2O8EA 3BIXA 3GT3A 4HWSA 2YOGA 1FB5A 1HBJA 1YR9A 1C3XA 1JJVA 2NZXA 3B89A 4JVNA 4X1YA 1CR2A 1YCDA 4KR9A 2X2FA 3QLTA 3WHLA 4AU1A 4JSYA 3LWNA 3UAZA 3TLYA 2J33A 4QUJA 3AKYA 3UGJA 2G06A 2Z5VA 3FKJA 3I04A 2WYUA 2FJPA 3HYRA 4HLQB 4RNDB 4OI1A 4M1WA 4EKYA 4L5IA 1SUIA 2O6HA 1ISGA 4KYUA 4TQUS 5KYUA 3I6MA 4PV7A 5ESWA 3UFBA 1K8RA 2E85A 2XB9A 4CV1A 3NM5A 5A7FA 1I3CA 2P4SA 3F96A 5JTTA 4OOEA 1ODCA 1XA3A 3EBOA 4R9RA 4BXOB 3D31A 4O6VA 1FLDA 2A5GA 1MRZA 2JBAB 4AKTA 4QTZA 1Q0TA 1OV6A 1ARZA 2ZSFA 3UH0A 5TARA 3LF2A 1LFAA 3ET5A 3JYHA 2DP4E 1UFQA 3M4ZA 5DBOA 4C4ZA 4QEKA 3WGVA 4BO0A 3OLWA 2ANBA 3SP1A 1VLQA 5L3SB 2HLDA 4ER3A 4CTKA 3ONEA 4BNJA 3K9CA 1OZAA 1R1DA 4FGZA 2QHXA 4MH0R 8ATCA 4D2IA 1QKIA 3ZXSA 2PKEA 3IOEA 1FJXA 3B20A 3KD3A 4Q01A 1F5NA 4WTOA 4HGOA 3WZLA 2HJVA 1GAQA 1TQHA 1Q22A 4OQYA 2ODPA 1XL1A 5GVRA 5K09A 3ND7A 1FIUA 2O3TA 5KNDA 1T5TA 2QG9A 3EISA 3MWGA 4GE0A 3TR6A 3FF1A 2WMOB 1XKLA 2ACKA 1MO5A 2FQ1A 2YR0A 3G68A 3OE4A 4GGPA 4LHVA 4MO2A 5F35A 1J2EA 4KWTA 1QYDA 1HY3A 2NAPA 3CNOA 1GOTA 5AW5A 1U5CA 2J5KA 4L8FA 4E88A 5HTOA 5DM70 2ZRBA 2O7RA 3VV2A 1G7TA 2HXSA 4XOUA 2QR5A 5DW0A 2JLQA 4QOFA 4UUMA 2P9TA 3AETA 5E6UA 3SHTA 4DIUA 3NP7A 5FOWA 3A9RA 3GRKA 4K46A 3EGEA 4PWZA 4FX5A 4ZCLA 3RS5A 2QT9A 4Q34A 4DQDA 2G1KA 1PI3A 1Y3DE 2VYQA 4RXTA 1ZZEA 4CIWA 5IDVA 2IHJA 1OZFA 3QY9A 3ZD6A 1JDSA 2I4IA 4QBGB 5J4LA 5C35A 1QGUA 1GU0A 1PWHA 2AN9A 2BEVB 3NO4A 3RJZA 2YMMA 5U1PA 2MHCA 4ITVA 4YPOA 1F7UA 3IAM6 4TUYB 1W8DA 2CCKA 3DOFA 4CM9D 1J7JA 1S3SA 2Z09A 1ZAKA 4S1PA 1Z0FA 5DM0A 2RH4A 1JFRA 4QQNA 4XJSA 2WF6A 4U6SA 2JZOA 4BEBA 4QGHA 3AG5A 3DHYA 3IVGA 3EXHA 4WA7A 2N42A 2JLXA 3CPSA 1LFDB 3T7IA 1T8WA 2FKAA 4YP5A 2UZAA 1BDJA 1I32A 1ZU4A 2FHPA 4X63A 3ZE9A 1O4WA 5TQ0A 1KO5A 2RKOA 3NHYA 4XM1A 3K0CC 3EVGA 1XTTA 3D1LA 3R5FA 2I3BA 1TK3A 1QHXA 4ZRDA 4DEXA 3R3HA 3KO8A 3BE4A 4A3SA 2CXHA 3NBMA 3ZBTA 2VRCD 1MAUA 1G8MA 2ONYA 3L06A 3X1ZA 4J3NA 1KZ1A 1O3YA 3LBNA 3L7LA 1H6BA 4N6GA 4TV8A 1GA6A 3R3SA 1WXWA 3OCJA 3R9XB 3B60A 1W1WA 1Q21A 5HSGA 3MF4A 1W34A 4HQ6A 2WSSD 4NYIQ 2QL9A 1OZHA 3JRWA 4YR9A 4ARVA 1COWD 1RWBA 1N2HA 2ONCA 1KVUA 5J47A 4NTZA 3V2IA 3Q3IA 2HU8A 1KZ7B 3TFQA 4XUDA 2VTEA 1FX0A 2BMDA 3C5EA 3CURA 4BWVA 1CS0A 2YJ5A 3IKLA 4FMBB 4ZRMA 4TKUB 1Z33A 2PO7A 4JB3A 4I0WB 4BO6A 1BIFA 3HGTA 4FE3A 5AVYA 4ZV7A 2H1HA 2ID9A 3PCXA 5K8TA 2GTHA 3K4QA 2I4MA 4Q1VA 1BN6A 2I3DA 5EXPA 3F4BA 1RM5A 4XD2A 2O6LA 2VEOA 1BXRB 4OFXA 4GQAA 4OI0A 1Y1SA 3ZK8A 2R62A 4NAVA 1UBUS 1N6HA 2YVQA 1PL0A 3AEUB 4MPPA 1NMXA 2X3UA 1IB0A 2YVKA 2NV2B 4CKYA 3UAOA 3EGIA 4D5GA 1LK0A 2GAAA 3QFTA 1NLUA 5HDQA 1DV2A 2NW6A 3L4BC 4DPKA 2I9KA 1MP0A 1DXQA 1E9VA 4X91A 5KKAA 1BROA 1B16A 1ZMBA 1ZN2A 2IEIA 1ZSVA 1KH1A 4A2CA 4NICA 5B1EA 1E2NA 1CR1A 3G23A 1W4LA 1N1MA 1E2KA 3AY3A 3PDIA 5B7NA 5G3YA 2Z9CA 4AKIA 1G6KA 1QS0A 1SOVA 2WC1A 2VUHB 3A4VA 4NFLA 3UQZA 5IG2A 5IJWA 3KDPA 1DCFA 2ZIEA 3P94A 2J9FB 2HFJA 4Z4FA 4UVDA 3PITA 5AVOA 3R3YA 1LQTA 4AYXA 2HD4A 1TQ6A 1YK1A 2CFTA 2F2TA 3T7EA 4BB9A 3W9BA 3CUYA 3O82A 1VLMA 4Z54A 2B35A 4WK2B 5CA0B 2J9XB 1DSSG 2XECA 5EE3A 3ORFA 3U4HA 3OIFA 3C7KA 2XMQA 2GA8A 4RZ3A 2BKEA 2IHYA 2ZYVX 2MSEB 4C43A 1KYZA 2XWSA 2NM0A 5B37A 2UZ4A 3FHTA 3BTSA 4A8PA 1OFTA 4DMFA 1IFXA 3NM6B 4CMJA 3SSAA 3T3GA 5JATA 1SG9A 4NYMR 4W5RA 3PC7A 4J9VA 4OL0A 5IVHA 3C87A 3D3JA 2RHGB 5FORA 1UKBA 2I1LA 4P4SB 4EGJA 1XMSA 1W2WB 2IEDA 2XMSA 1DXOA 1M6VA 2YNMA 3A4TA 2YIDA 4L4YA 4R6XA 5AHRA 1GPWB 4CDGA 3IURA 4Q3DA 3KXPA 1VOTA 4IOKA 1P45A 3U7EB 1Z7GA 4X3OA 2WA2A 1G8GA 3VNUA 3UOAB 5AYVA 1QUFA 1OBHA 1YB6A 3Q0TA 1W96A 4HMQA 2B7CA 3CR8A 5H81A 2CV0A 3AFMA 3E35A 3GLKA 1R8JA 1IG3A 1E79A 3H9EO 4QEDA 3U4GA 3VU0A 4F7WA 1FSPA 3PQFA 2E4XA 1I4OA 2CUTA 3ZV3A 4F91B 5KQSA 3TUZC 2BFBB 3KKEA 4BVEA 4DAOA 1I2MA 3AOEC 2X8LA 2YWGA 1V11B 3HBMA 3ZDZB 2ZI3A 3AO0B 4WFIA 1JH9A 1JDVA 2CXRA 3N2EA 4GMXA 3O8RA 3ZCTA 1EB8A 1Y34E 2XB6A 3HI6A 2ZS7A 4B32A 1ZI6A 3ECCA 3DXZA 3OMXA 3SM3A 3EG9B 2CXPA 4HMOA 4YRQA 4YO7A 4F56A 2CLKB 4V0QA 1M2OB 4BLOA 2PUEA 3B5JA 4AZWA 3P2KA 3B6KA 1IEXA 5ELLA 2C5LA 3VYSB 3MC1A 5KMGB 5CA1F 3LWDA 1J1ZA 1RYMA 1A97A 1WUHS 2G9UA 1E9AA 1VKJA 1DADA 1I3KA 1XEWY 2P9GA 3JWEA 4QC2A 1C7IA 2VXYA 4TMKA 1OW3B 4C89A 4PC6A 1ZEJA 2OCGA 3VZRA 5AHKA 4ZMBA 1HYHA 2C20A 3G6WA 5F98A 2ZSIA 5I7EA 2HPHA 5AR1A 1OXBB 2YXBA 4UNQA 3S40A 4DR6B <