4EQ6A

The crystal structure of psy3-csm2 complex from budding yeast
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
213
structure length
192
Chain Sequence
MEYEDLELITIWPSPTKNKLCQFIKQNLSKEHVVTQLFFIDATSSFPLSQFQKLVPPTLPENVRIYENIRINTCLDLEELSAITVKLLQILSMNKINAQEPLKIILYINGLEVMFRNSQFKSSPQRSHELLRDTLLKLRVMGNDENENASIRTLLEFPKEQLLDYYLKKNRIKNGDSLAEYIWKYYADSLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and SAXS analysis of the budding yeast SHU-complex proteins
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords Chromosome segregation in meiosis protein 2
total genus 74
structure length 192
sequence length 213
ec nomenclature
pdb deposition date 2012-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16834 CSM2 Shu complex component Csm2, DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4eq6A00
2GRJA 2I1QA 3C14C 4RD2A 4BLSA 1E2QA 4JL5A 1UKZA 2LKDA 2BBTA 4ZDKA 4XVUA 4LV6A 3SYKA 2XTNA 2XXAB 5A0FA 1TU4A 1E1RA 3WBJA 3KQHA 1SQ5A 1JPNA 2O0HA 3QY0A 4TT3A 4IOLA 2ZRAA 2VF7A 4QHTA 2FZ4A 4D2IA 2IL1A 1TX4B 4B73A 2C78A 2AFHE 1CR4A 5KDDA 5DI3B 4LGMA 5LB4A 4OI4A 2F43A 5CLLA 1CRQA 1DAIA 2HJGA 4L9WA 1T6NA 4YQFA 4B3CA 4HB0A 3TMKA 2JLXA 2B8WA 1R8SA 4B71A 1HQYE 2ZVPX 2IA5A 2AKAB 2NO6A 1XPOA 1CXZA 1MKYA 3C41J 3KXIA 1E2LA 4OHWA 5D3QA 1VHLA 2QP9X 3QI2A 4B2IA 4K46A 3HR7A 4Q1FA 4TQUS 4Q01A 2FGKA 1GKUB 3K0CC 1GIAA 3M0EA 5JLJA 2IUUA 4L4UA 1UJ2A 3W8RA 4TMZA 2C2HA 4OQXA 2FV8A 1OFTA 1QG2A 5FBQB 4F91B 2AD5A 3ONWA 2O8BB 4G0NA 3AP3A 1DARA 3C7KA 4TWZA 4HATA 4JLBA 1JECA 2F1JA 1YZQA 5AUQA 1E2DA 1R8QA 2JASA 3MSXA 4P4SB 3KQKA 2WTUA 3GPLA 2GAAA 2ZRPA 2P6RA 1G8FA 5DI3A 1RYHA 1BMFA 4LJ9A 4X8MA 4ZKEA 3TE6A 1G4AE 4Z1MD 2K5UA 5BN4A 3MLEA 4D4KA 1G17A 2DBYA 4LY6A 1Z6YA 121PA 2QU8A 1KY3A 3KUDA 4QGHA 2NPFA 1Z83A 3WXMA 5JI2E 4TTQA 1U90A 3BRWD 3GLHA 5EZ5A 3OZXA 4FMCF 5FL7D 2AD1A 2VHJA 3E1SA 1Z06A 1CLUA 1U99A 2WOOA 5JFGA 1R2QA 2ZRCA 3LX5A 2QTVB 3KJHA 4R2HA 3K9NA 4A82A 3LLUA 4KYIB 3ZGXA 4DLVA 3NVAA 3THXA 4O25A 1G3QA 1F2TA 1N6PA 3UK6A 3EA0A 5DNYB 3MD0A 4GL2A 3K1JA 1US8B 3Q72A 4NMMA 4PHFA 1DAGA 4WZBE 4ZCMA 2R44A 1M6NA 3EG5A 4IVRA 1AZSC 2PJRA 2CE2X 1OYWA 1AKYA 3X2SA 4NYJR 3L0SA 4JMPA 4N0DA 1D9ZA 3RDPA 1M8PA 2IEYA 2EFGA 4F4CA 1KKLA 1M7HA 1VKJA 3CF6R 2GJKA 1NRJB 1XD2A 4Q19A 4R98A 1YKSA 3KFXA 2ZANA 3H2YA 1LS6A 2EWVA 1YR6A 4BFVA 2GEUA 3K9HA 2H7VA 2WAYA 1TF7A 4LBYA 3GLGE 1KI6A 2W6IA 3MWLA 1SXJC 1XXHE 3NXSA 1HURA 1PJRA 4MRVA 1F6BA 4KLNA 3I4LA 3OIYA 3GLIB 3NH6A 4NCJA 1XBTA 1WMSA 2HDNB 4V0KA 1TADA 1UDWA 2BMEA 4TQ9A 1ZM3A 5KSOA 3VNVA 2WKRA 5JWHA 4B75A 1W48A 1X3SA 1XD2B 1NIJA 4DSNA 1KI4A 2Z43A 2W2VA 1E6CA 2IX3A 2GCPA 1G8YA 3THYA 4I1UA 3B8HA 1DPFA 4A92A 3W3ZB 1WB9A 5EE5B 2CVHA 1OH6A 3BH6A 2P6NA 1RIFA 1ZU5A 5FBVB 1SVLA 1M2OB 1KDRA 3NBXX 4M8NE 1IXRC 4G5OA 5FOTA 3UKDA 2IYXA 4URYR 3B1ZA 1P2UA 2BM1A 4JT4A 4TMXA 2RGXA 2V55B 3DDCA 3KXLA 1UKVY 3GMTA 3ZVMA 4BZXA 2BMFA 3GEHA 2W2XA 5KU1A 4HLCA 1UKEA 5CYPA 4POAA 4I1SA 5IF9A 1BH2A 1V5WA 4TL8A 2W0MA 2RH5A 1NBMA 4LK2A 4OHZA 3TRFA 2GJAA 1KI7A 2ORVA 2GXAA 1Z6XA 2VTKA 4KSCA 1WQ1R 3SS8A 1QZXA 3OEHA 5HE9A 3K9GA 2CL7X 3U7HB 2V9PA 1EFUA 1EFCA 3LAWA 4M9XA 4NTZA 3GLHE 4L5BA 1UBGA 2J59A 2Q3FA 3JZAA 1XMIA 1JEDA 1XTQA 2FFBA 2EQBA 5JWOA 1VYTA 1RFLA 5GVSA 3I5YA 2IXFA 1KO1A 3NC1C 3QOFA 5JWRA 3EX7C 2HV8A 2XJ9A 1S96A 2DR3A 2Q9CA 3C5CA 4PZZA 3U44A 1IY0A 2BMDA 4YXWA 5KNDA 2G6BA 4LYHA 4Q4AB 2QEQA 4LPKA 4D0LB 2ZJYA 4PHTA 1EFRA 2OAP1 1KMHA 2O0JA 1AS2A 3GP8A 2QG6A 2LWIA 1TEVA 3L0PA 3Q7PA 1EG7A 2FH5B 2V7QA 3D31A 3RRMA 5KPDA 1L2TA 4QJ5A 4MKFA 1JR3A 1UAAA 3GJXC 4GZMA 3KTAB 5FTKA 2ZE6A 3HU1A 3IDQA 3BE4A 1E2MA 3QKTA 4A0HA 1Y3AA 1ELOA 3RANA 4EJSB 3TJZA 3O8BA 4BWYA 3GJ7A 4QC2A 1G6HA 2WZQA 2QT0A 2NO7A 5EZ6B 4FD2A 2XNSA 2GXUA 3DOEA 1R5NA 1QVAA 2QTHA 1FQKA 1LVGA 5FL7A 1KSGA 2A7QA 1EK0A 5AJYA 4PAMA 5FH9A 2QTFA 4LJ5A 3OFND 1IOZA 2QENA 3TQFA 4TZ0A 1P7CA 4V0NA 5DN6A 3WHLA 1W46A 2GJ9A 2TMKA 4TYPA 1Q1BA 2NQ2C 3GFOA 4Z1MA 5BQ5A 3I61A 4TLDA 2IF2A 3WP0A 2YNMA 2OHFA 4LC0A 3WNCA 3ZJYA 1G16A 4FCVA 2UZ3A 2GEVA 4EPTA 3QKRB 3AM1A 4TYQA 3B9PA 4QG7A 1YJ5A 4LJYA 3EPJA 4LYFA 5HKKD 2MMCA 4YDSA 2YV5A 4B3FX 2A78A 3U2QA 4QM6A 3CPHA 3ICEA 3CNNA 4BLTA 4NKRA 4UXJA 1P2VA 4M9ZA 3VX3A 4BFZA 4OI1A 3UWOA 2G0NA 2YOFA 3TSWA 1XEFA 3EPHA 2D06A 1ZNXA 1NN0A 3FMIA 3H84A 3QPUA 5EE1A 4O0MA 3UWKA 5KNCA 1JJVA 4NPHA 3FVQA 4DVGA 5UKDA 3AVYA 1UBCA 4ZDIA 1NLZA 3CX7A 4H1VA 4PQYA 1H8EA 1G3UA 4QM7A 1FOEB 3ZVLA 1U9IA 2OBMA 1OKKD 3MCAA 3MMPA 4EAQA 2GZHA 4AG5A 3Q5EA 3RSLA 1J8MF 1HT1E 1TL7C 3G82C 3VHLB 1T3SA 4IVQA 3VU9B 1JI0A 4US0R 2QORA 3IIJA 2ASEA 3UXMA 2X2EA 3WYGA 3EWAA 1KAGA 4CEHA 2FN4A 2O52A 4O2LA 1JJ7A 4JIMA 3KQNA 3EPLA 1OXTA 4WA7A 1D5CA 2WSMA 2YZ2A 2H18A 1Z47A 2JJ8A 3PQCA 1Z07A 2CK3D 2ZPTX 1W2GA 1E1QD 4I4LA 4EKDA 2WPDD 4PXAA 2QZ4A 4YMVA 4TLBA 2A5YB 3LXXA 3CKLA 4RY2A 2JDIA 2NTYC 4R2IA 1P4SA 3Q9LA 3O47A 2RGAA 1G6OA 2P2LA 2VHUA 5J4VA 1H8HD 4M1MA 3RLFA 4XVQA 5SZHB 3PUVA 3RS0A 3U4QB 3R9XA 4B2LA 2KBFA 1XD8A 3RC3A 4DB4A 2P5SA 4JLMA 1M7BA 3BH0A 1Z6AA 1GAJA 4B3DA 1DO0A 1EX6A 3TVDA 1Z2AA 2G88A 2I4IA 3DMDA 4HDQB 1QHNA 1Z0AA 2OO7A 4JVLA 4EPVA 4KFRA 1ESNA 3K0EA 4M1SA 5C2JB 3AVXA 1NY6A 1KNXA 1ZIOA 5JEEA 4M1YA 3DKVA 3CNLA 4JKIA 4RCYA 2XNDD 4TLEA 3GLGA 2ZI7A 1Z28A 3U3MA 1UEJA 4IOJA 4TYYA 2QNRA 4KODA 2F6RA 3PXGA 4QJ4A 4A2QA 2J7PD 1IAQA 4ACAA 4LJ7A 2FOLA 2ATXA 2OLJA 3AVTA 4DEXA 1ZP6A 2YOHA 1U2RA 3A4NA 3CF2A 2H8KA 2XNDA 4Y0AA 1RJ9A 1E4VA 4HEJA 4FCWA 2VSOA 1S3SA 1AKEA 4UKDA 4HB3A 3OE7A 5CYOA 1F3OA 5L3RA 5TDHA 1PZNA 2BOVA 1GG2A 1AA9A 2AKYA 5B58C 2ERXA 5IDVA 3THYB 4GRAA 3ZDQA 3SFZA 4MYCA 3CO5A 3X1WA 1SZPA 1KMHB 2AFIE 2AL7A 5J4LA 2MSCB 1YR7A 1EWQA 2JJ1A 4M9SA 2GA8A 4EJSC 3WBKA 1VCIA 3FMFA 3KB1A 4D82A 3I5XA 4F38A 3VR3A 4BQSA 3TVTA 4EFLA 1JQJC 3SFVA 4Q7KA 4K8OA 4A2WA 4DWJA 4RD0A 4EPWA 2OFOA 1Q0UA 3B1XA 1X1SA 1YU9A 1ZVQA 1E2JA 1L4YA 1ESMA 4LRWA 2O8FA 3GEEA 2IXEA 2VLIA 3BORA 3DMNA 3T12A 3LQQA 721PA 3VNUA 2ZQ5A 3VMFA 3AH8A 3CLVA 1E0SA 3PFIA 4C3ZA 2R6AA 1XJ0A 2BM0A 3L2OB 5D3MB 5HCIA 4YMUA 3OEEA 2QMEA 4EIWA 2DFKB 4HLQB 4JLDA 3MWYW 4G01B 4BLRA 3VQTA 1CP2A 3MGCA 3A1WA 2FG5A 1F2UA 3BXZA 4BEJA 3LX8A 2VSXA 5TXGA 1W44A 5FR1A 1KO8A 4IEIA 1E96A 4J0QA 5BN3A 1HTWA 1S3GA 4HAUA 3OAAA 3T1TA 1QHSA 3BJIC 2QPAA 3GLIE 4MITA 4XIGS 4MKHA 3VFDA 3IEVA 2EFEB 2IS1A 4JYCA 4M0LA 2XJ4A 2BHRA 1H8ED 2EVWX 5CJ2A 4GPTA 2WIAA 4OKSA 1CJMA 3CZPA 3DKPA 4C0AC 4DLYA 4ZCIA 1RRCA 2CL6X 1IJEA 2RHDA 2RB4A 3GJ0A 3LDAA 3NWJA 4YLGA 4EPYA 1N5JA 5JEDA 3A4LA 2XAUA 2OBLA 3B5JA 4XD7A 2WJYA 1R0ZA 2QE7A 4P4TA 1P3JA 1NLYA 2ZRHA 4KVAA 5AJZA 1RVDA 3AQ4A 2ZS7A 2FFAA 1OE0A 5EXTA 3JVVA 3U3KA 3LRPA 4CVNA 4QGFA 2ZJZA 2OG2A 4OBEA 5EQTA 5LB2A 1R0WA 4L16A 2ATVA 2FPLA 4UJ5A 3A1VA 2REBA 5DYGA 4ZIRA 1KGDA 4IDNA 4D4LA 1NKTA 2D3WA 5LD2C 4MGYR 5HTKA 4DLTA 3U6BA 4PAOA 2ZUDA 1XPUA 1Z0FA 4OJQA 1KK1A 1TEXA 4M22A 1KK2A 1XU4A 2FZLA 4RFVA 4AYWA 1C9KA 5L3VA 4ARZA 1NY5A 2VL7A 3ECCA 4ZDJA 1LTQA 1W1WA 1XRJA 1XCGB 2BMJA 1RRPA 2PX3A 4B43A 4S2EA 4CIDA 2BC9A 3BAFA 5JI3E 2XZLA 2Q21A 3CB4A 4TZ6A 5CB6A 2WHXA 1ZM7A 4AKHA 3W90A 1E98A 3BFKA 4QHSA 4PHGA 1ZNZA 2ZR7A 4P31A 2KI5A 4HLUA 1R10A 3NHAA 4XH9B 1HEIA 1Q3TA 3QKRA 1JALA 4BFXA 1HT2E 3W9YA 2AXPA 2WM9B 2QBYA 1Z6GA 5BWMA 2KWIA 1E79A 3CPJB 3A6PC 4DLSA 1XWIA 1I4TD 1GFIA 1XMJA 2D2EA 2GEDA 2NOAA 3C5HA 3NDPA 4HAXA 5L8VA 2GBLC 2OE2A 3G0HA 2AHOA 4KXFB 1XJCA 2XXAA 3AVQA 4TYWA 2YYZA 4G5QA 1YR8A 1ZD9A 3BH7A 3IHLA 4C30A 4DC9A 4NP6A 1B23P 4A8JC 4LI0A 4LWZA 4MH0R 2VA8A 3BBPA 4M4SA 4C2UA 4C4PA 3B13B 1WP9A 3VX4A 2GILA 1E94E 2ZJ2A 4OHVA 1FMJA 2YHSA 4KFUA 4B34A 2NZ8A 1N0VC 1QHYA 1VYUA 2ZM5A 3PEVA 4EJSA 1DAHA 3DO6A 2ZSAA 2BBSA 4DIEA 4DDWA 3GLFB 1VHTA 2AXNA 5KTYA 4ESHA 5J40A 2C98A 2H16A 3W6NA 2MMGA 3CUEF 2UZIR 4RVCA 2GJSA 4EUNA 2NPIA 1W36B 1SXJB 3K9LA 1JAIA 1AM4D 4HDOB 4U7DA 2A30A 3IUYA 1X86B 4UNQA 4V0OA 4JT2A 1NN3A 1BKDR 1G5RA 1MABA 1T0HB 1X1RA 2FX3A 2ZREA 2O8EA 1PUIA 3TAHA 3R9WA 2OCPA 1HY3A 3B1VA 1OH7A 1AK2A 2ZRBA 4TLAA 2FSHA 1S0UA 1NVUQ 3CIOA 3ZQJA 1W4BA 2H17A 1WCV1 2BBWA 2IUSA 4FWTA 2WJGA 2Q9BA 2HUPA 1KSFX 2R6FA 3MG9A 4LHZA 5HR5A 4IDPA 2ECKA 2Q3MA 4DLUA 2VYFA 1GRQA 5CDFE 3MJRA 3QG1A 2C96A 1ZUHA 1DG1G 2WICA 3N70A 5L3QA 2R9VA 1LFDB 1Z29A 4KVGA 4PFSA 1GP2A 5E7MA 5C4GB 4Q7LA 3AP2A 4P0TA 1E32A 1E2IA 2ODWA 2OAQ1 3DEFA 4DSOA 2W6ID 1Q1EA 3CBQA 3OAAD 1X8KA 2ZS9A 3P20A 2ZRDA 2IYRA 4Z8XA 4EPRA 2GTPA 3TQCA 4MA4A 4KU4A 1JXOA 3Q5DA 1E9FA 3REFA 4BLQA 5KSPA 1F2TB 4HUQA 2WWHA 1ZC4A 2ZYUX 3AV0B 4B48A 5FPKA 2IW3A 2H5EA 4WAUA 4D81A 4LHXA 3AP1A 5GJWC 5TARA 1VG0B 4MGZR 3TSZA 2OCYC 2CCKA 4D25A 1I2MA 4IHQA 4CEIB 2C95A 2HF9A 4KO8A 5IRCD 4DXAA 1KIMA 1E0JA 1QVRA 2PLRA 5L3QB 5FPTA 2KSQA 4KITB 4HB2A 3T5DA 1R6BX 2ZUBA 5H8WA 1G9XA 1NSFA 3PR1A 2ZTSA 4EPXA 1JQLB 3MFYA 3AVUA 3FE2A 4CZ2A 1E2KA 4LV8B 4JVNA 2XX3A 1DELA 1HE1C 3DHWC 1FZQA 2IBMA 4OYHA 2X19A 4ZV4A 1S9HA 2N1BA 4QOSA 3KKQA 2HJVA 1T3LA 1DAKA 1OXVA 2FFQA 3PENA 2CCGA 2XEXA 4AY2A 2C77A 3H0KA 2A3RA 1B0UA 5FTMA 5JMTA 1SXJA 4XTCS 1XB2A 3Q85A 1CJKC 5B57C 3PIRA 4DLRA 5BYKA 4B33A 1GDDA 5M04A 3R7WB 2PBRA 2PT5A 4JLVA 1MABB 4YMSA 1GZSA 3FHTA 1ZD1A 1LNZA 1XCPA 4BFYA 2I1VB 1R5OA 2VP6A 4IOMA 2CLCX 2ZI5A 4KYUA 1JR6A 2QQEA 4DCSA 1GILA 2GETA 3AVWA 4GNKA 5DE3A 2OSBA 5J4HA 4II7A 2ZEJA 2DWQA 4GP7A 1OXUA 2RGDA 4LHYA 3SQWA 4CEJB 3QPWA 2G1JA 3IHWA 3QEJA 3SDZA 3V00A 3FMPB 4R9UC 2GJ8A 3KFVA 1WA5A 3QNUA 3THXB 3R20A 5JJKA 2HLDD 4ON9A 4IVPA 4LHWA 1DVRA 3T1VA 1E2NA 1Z3IX 3M4YA 4RZUA 1UBFA 1IONA 4P32A 3N2EA 1G5TA 1RPZA 1HUQA 3B1WA 3L0IB 1W36C 2QM7A 4LBVA 3F5FA 1F60A 2ODNA 2GNOA 4LCBA 1KOFA 4QNMA 3K70C 2QBYB 1JB1A 3D8BA 5GJBA 4HUTA 3ZS9A 1N6IA 1U8ZA 1II8B 4H9GA 5E4FA 1R0XA 4P33A 1D6JA 2ZSFA 3E70C 3EASA 1N0UA 3B82A 1IM2A 4P4SA 4KHZA 5KHOC 3FGNA 1E1QA 1G20E 4A15A 3U3JA 3GJ6A 2J5XA 3RS5A 1H65A 3UG6A 4PSKA 2JLZA 1GITA 2OCAA 3GD7A 1OYYA 2DCUA 5CM8B 2AX4A 3F0TA 1Z0KA 2QUZA 1NI3A 1E9EA 5GADl 1ZRHA 4C0LA 1M7GA 2P3SA 4OHYA 4NYIR 1HH4A 3RWMB 4NZYA 4A0GA 4DSUA 2WSSD 1BYUA 3B78A 1TNDA 4PPGA 1NJFA 3AKEA 5FR2A 2FFHA 4XVRA 1LY1A 4MGIR 4ARZB 4G3XA 3RYTC 3QXCA 4CF7A 4OI2A 4EFNA 2ORIA 2PX0A 3TKLA 1ZMXA 4B44A 3PEYA 1U0LA 3IO3A 1OHHA 2GVDC 2BEJA 5JBQA 1EGAA 1FW6A 2OZEA 3FYHA 5H70A 1GVNB 2GDJA 2G83A 4D0GA 2FEMA 3I8SA 4TYNA 1RKBA 4G5GA 3HJNA 4QBGB 4RD6A 4C0KA 1A1VA 1IY1A 2QN6A 1P73A 3VU9A 4NDZA 3WMGA 3LQRA 1TUEA 5FPYA 3IIKA 1Q57A 1I4DD 1AGPA 1U98A 2P5TB 4ASUD 2ZETA 4WZAE 3WP1B 2VHQA 3MUFA 3SC3A 3UPUA 1CIPA 2ZIAA 5SZKB 2IF0A 1U8AA 3R8FA 5EXXA 1IN7A 2QPOA 5HKKA 1ZNYA 1U94A 1PUJA 4DB2A 4DT1A 1G1MA 3CWQA 1SXJE 1R7RA 2RGNC 4JSTA 2IEZA 3MRSA 4DEYA 2PZEA 2ZU0C 3RS4A 1G64A 4Q47A 1U8YA 1VYVA 5B2ZA 4TMKA 3PUWA 3OFNA 1NVVQ 3B60A 3KX2A 2YC2C 3AF2A 2IS6A 4PPNA 2X8AA 3KDSE 3T5GA 4QL3A 3QXSA 4M1KA 3GJ3A 4UNSA 1WBBA 2JEOA 3LVQE 1KKMA 2V4ZA 1KY2A 5DHAA 1ZCAA 1VPLA 4RJLA 3LD9A 2YKGA 1OH5A 4ERNA 5HZHA 2SHKA 1TUIA 3K0FB 3KKNA 4IJMA 1S4QA 4TMVA 1T8TA 4QGAA 2JCSA 3EC1A 3NEYA 4QBIA 3AVVA 2A5JA 3VKGA 5D3MA 3RRYA 1LF0A 1ZIPA 3PCRB 3W3AA 5E7IA 4TTPA 4E5UA 2XSZA 2KBEA 3FHCB 5A4JA 2GESA 3EXAA 4FXPA 4M21A 2IHYA 5E7JA 3S1AA 4MQBA 1EFRD 2REXB 1JAHA 1UEIA 1KI2A 1KI8A 3TUJC 1CS4C 1G21E 1U9IC 1XMVA 1W0KA 3C15C 4C7OA 4G5RA 1N2CE 5JRJA 2RGNA 5E3HA 3BERA 2AWNA 4GMDA 4M1WA 5L3SB 3X1YA 4G5SA 3HPRA 1ZNWA 4JYBA 1OSNA 1OPXA 4IEEA 4PAQA 2GZAA 5BN5A 1RC8A 4HLUC 5HE8A 2GVZC 3WNDA 4PZLA 1S8FA 2Q6TA 3KQUA 1N6OA 1A4RA 1T5IA 1MT0A 3K53A 1XTJA 1G7TA 4LX0A 1OV4A 3A4MA 2Z0MA 2A5FA 5FUVA 4FN5A 1JNYA 4ZO4A 1J2JA 2OXCA 4GP6A 2IYZA 2W0SA 5AK0A 1YZTA 4C0SA 1NBMD 2IYTA 4UJ3A 1N6LA 1J7KA 4F4JA 421PA 3SJCA 4BGDA 1Z0IA 5P21A 5FPHA 1ZAKA 1KO4A 4UNRA 3PJRA 2YWFA 2C9OA 2HYDA 3IIMA 1AS3A 2QAGC 3LFUA 3PUYA 2V1UA 1HYQA 3WYAA 1ZC3A 1EFTA 1IN8A 3FHOA 4A4DA 2PEYA 5FBRB 1QHXA 1WE2A 2YJTD 1OIWA 3FOZA 1KI1A 3ZZTA 1U0JA 1ZYUA 5CK4A 2QROA 1DBSA 1HE8B 1OIVA 3PEUA 5GJVC 5DN6D 1G19A 1E9AA 4FI3C 2ZJBA 4Q1CA 3EZ2A 2ZJ8A 1IN4A 1CJUC 2HT1A 1VCMA 3CM0A 4Q03A 2XZPA 3RRZA 4MYUA 3W6OA 1W4AA 3RS7A 1GKYA 3OEED 4NE2A 3HP1A 1KDTA 4IXNA 2HCJB 2V8OA 1COWA 1HV8A 2DY1A 3FB4A 3B6EA 5C1BA 1MO4A 1DG3A 2FNAA 3CRVA 4QJ3A 2WWGA 4M1TA 3D3QA 3ZZ0A 3LWNA 4CEHB 5JS8A 3EW9A 4KBFA 3DL0A 3CX6A 3THWB 1QRAA 3GQBA 4X8HA 4IDHA 5LD2B 4IDQA 1GSIA 1S9DA 2JLRA 4KI0A 2C9YA 3FMOB 4OQNA 5EP3A 2V1XA 1V43A 4RZ2A 2WMOB 2QSYA 1FP7A 4NHOA 4YXWD 2LKCA 4BPBA 1YHNA 4B6EA 3TW4A 4RFSA 4DCUA 3TLXA 1N5IA 1W2HA 3OIVA 1XMSA 4FINA 4QHYA 3QQ5A 2BIFA 4MUAA 1KI3A 1P2TA 1C4OA 4PSVA 1BYIA 2XB4A 1G8GA 1NSTA 5FOSA 2ZR9A 4CW7A 1NG9A 4TL9A 2AR7A 3SJZA 5TMPA 1VCOA 3BGWA 2W2TA 4FMDF 4XJXA 3JZMA 4HLDA 1UBEA 3CR7A 5CIQA 4JLNA 4KJZA 4DDTA 621PA 3KXKA 1NVXQ 3D7MA 4F92B 2VPPA 2OFWA 2WKQA 5E95A 3N2IA 3GFPA 1WXQA 2HEIA 2PL3A 1XF9A 1NBME 2KB0A 1MO5A 1SHZA 4XSHA 1II9A 3NG1A 4Q66C 2VH5R 1E4YA 5SZJA 1F2UB 1KHTA 1A7JA 2DHRA 4ZKDA 5LBIA 3QF7A 3RS2A 4D26A 2V6JA 4TQAA 2QA5A 3V4RA 2ZE7A 4RFSB 4Q9JA 5KDLA 5KNBA 2QAJA 2VRWA 1P6XA 4TMWA 1GNPA 1C1YA 3OIUA 4RD4A 2IUTA 1FQJA 3BWDD 4IOKA 5EXSA 4D4JA 3UMRA 4LSGA 1H8HA 4JVSB 2DFTA 3QKSB 4JLOA 1JBKA 1J99A 4OK5A 1MRNA 1RYFA 2J46A 2JIZA 5FUXA 1SVIA 1DE0A 1T8UA 1CR0A 1ZINA 3HU3A 3CZQA 4ILEA 3I73A 2EFDB 1GRNA 1CULC 2CMKA 4GT1A 1LF5A 3BB4A 4GOKA 3I8XA 2CK3A 3T61A 4BRWA 2BDTA 2FEOA 5KOYA 2G3YA 2YVUA 2OEPA 4MGKR 3THWA 1YZKA 1Z08A 4E03A 3WRYC 3CH4B 1QHGA 1W7AA 5JHGB 2VO1A 2NO9A 3HYRA 3ZVRA 1OB2A 4Q4AA 1TQ2A 4L9SA 4A0FA 1E2PA 1EESA 3K09C 3MJHA 2ZSBA 1A82A 3LXRA 4C0JA 3KJIA 1W4RA 2VIIA 3FFBA 2B92A 4IKEA 4R71A 4JLAA 3RNLA 1PVOA 2VP5A 3HYTA 1N0WA 1FX0B 5IK2A 2H57A 4S35A 1QHIA 3U44B 4RZXA 1NG1A 5TB5A 4W9MC 1MO3A 2P0EA 1KAOA 4ZCLA 2ANBA 1P72A 1Q3HA 3IKJA 3AKYA 4OL0A 4WBSA 2WBLC 3LV8A 2EWWA 5KUTA 4E22A 4QFMA 1CBUA 3I3SR 3MAAC 5KPJA 1DO2A 4KBGA 4OQMA 3V4FA 2XSZD 2DWPA 1P2SA 2J0UA 1P62B 1IXSB 2NIPA 3AVOA 3BIFA 1CJTC 2GHIA 4W5WA 3AF3A 5G53C 4Q1DA 5G41A 4CT5A 2A9KA 3I32A 3DM5A 4LDJA 3F3YA 4DCTA 4I99A 2HXYA 1CEEA 1E2HA 4QKQA 5J4YA 1G5PA 2ONJA 3K8YA 1Z0DA 4LOAA 4NCKA 4Q1EA 3ICQB 4I1VA 2O8CB 2BCGY 1SULA 3ETLA 3FTQA 4ZPXA 5CK5A 4HUQB 5EE3A 5JHHB 3AF4A 2QMHA 3BS4A 2YINC 5K8IA 4CEJA 2QI9C 1XXHB 2VSFA 1K5DA 3SNHA 2YWEA 1SXJD 3K09A 2HXSA 1GOTA 1X8LA 1PLKA 5ANRB 4BASA 4C7OB 1TMKA 3TR0A 4AI6A 3NC0C 5JRZA 2RAPA 3CF0A 1N25A 2OFXA 1OF1A 3SHWA 1KMQA 1Q22A 5L3SA 1GM5A 2C99A 1T4GA 1G7SA 2P67A 2WJHA 1UADA 1JXMA 5TV2A 1DAFA 3K70B 1EX7A 4QGGA 4X8LA 3CRRA 2JA1A 3KJEA 1CJVC 1D2EA 2F1HA 2MSDB 2QL6A 3BOSA 1OJLA 2QP3A 4NL4H 3V9PA 4URXR 2HYIC 4HAWA 5B30A 2JLWA 1MO6A 2UVQA 1E9RA 2CXXA 3LLMA 2ZJOA 2WMNB 4XWOA 1E3MA 1YZUA 4WXPA 3SYLA 3I72A 2IHBA 3K0FA 4E07A 2OCBA 4IXMA 1N5LA 1W0JD 2ODBA 4A8JA 2Z5FA 1FTSA 2J0VA 2J3EA 1W47A 1SVKA 2BEKA 4PZYA 1NVVR 4TT3D 3J81k 1R5BA 2FA9A 4UXIA 4PC3A 1US8A 1OKKA 1DS6A 2QQ0A 3CPEA 3FKQA 4WOPA 3UG7A 3UATA 221PA 3VTKA 4CGZA 4NBSA 1VIYA 1E2FA 1YZNA 1PLJA 5K8TA 1E2EA 1OFIA 3KUCA 4AURA 4RD1A 4M9QA 2FF7A 4R7ZA 5FOUA 2ZRFA 5H68A 3NTUA 4LJ8A 4Q21A 3QG5A 5CB8A 2CL0X 1VG8A 3PITA 4DCVA 1TQ6A 3ZIAA 1F48A 1XX6A 4M1OA 2R65A 4WW0A 3Q3JB 4FWIB 1FTNA 3KKPA 3OF5A 2IT1A 2QY9A 2YWHA 2B7CA 5EUQB 2D74A 1UM8A 3CONA 4WIAA 1CKEA 2VF8A 2XB2A 2F1IA 8OHMA 2VEDA 3TSOA 4C9BA 3ADKA 2MSEB 1AQUA 3HDTA 1NNEA 1MV5A 4MRPA 5FUYA 4A9AA 2J0UB 4MUBA 2IWRA 4ESVA 2JLSA 1Y63A 3W6PA 2WKPA 1VDZA 1NP6A 1ZUIA 2Q3HA 3IQXA 5AUPB 4PC2A 1KO7A 2R6CA 3EIQA 3NBFA 2CCJA 2F3RA 1WBDA 3KQLA 3UANA 1XEWX 3KTAA 2QRZA 2OESA 1OB5A 2J41A 4I1OA 2O8DA 3NH9A 5H1YA 2NMVA 2GKSA 2WWYA 2GCNA 2IYSA 3TR5A 2QT1A 2BJWA 3NBZC 3TUZC 2QGNA 3SBDA 4F7WA 4C2TA 1Z6TA 3FDIA 1NLFA 1GRRA 3VKHA 4AIIA 2CVFA 1OT3A 2DFLA 2QM8A 2ZROA 1G3MA 5IHPA 4NONA 3NIBA 4DIDA 3SOPA 5FUWA 1E0KA 2F43B 5J4KA 2PCLA 1FNMA 3I92A 4OHXA 1FNNA 2ORWA 4MYHA 5LDDC 3THOA 1TAGA 3PEWA 2HF8A 1DAEA 1P9RA 4WZ6A 4KAXA 1K6MA 4PR0A 2GWHA 3FPAA 3LY5A 1JEEA 2WJVA 2RMKA 1NMXA 2VP4A 3QF4A 4MYTA 4RSGA 2WIBA 2IK8A 1G7RA 2EYUA 2ODEA 2CHQA 2FWRA 2GAOA 3HPQA 3A1SA 3B7GA 2WOJA 4RCZA 3RWOA 3SYNA 2B8TA 4DUGD 1GTVA 4XSGA 2FU5C 4XWKA 3CRMA 1DEKA 2F9MA 2GCOA 3K0AB 4JBXA 4WXRA 4PHHA 3ZVNA 4Q00A 4Q7JB 5G3ZA 4TL6A 4CEIA 4KSBA 2QGZA 2VHCA 4MRSA 4KLZA 2IYYA 1XEXB 3KB2A 2VBCA 4FMBB 3VR5A 2ZRJA 2JLUA 5FTLA 1MH1A 1GL7A 4LC1A 5FOVA 2V54A 1COWD 1UKYA 3CRQA 4MKGA 4B3GA 4YMWA 4JL6A 4DDUA 1KNQA 4NU0A 5GJCA 3L43A 4YDHB 4NCHA 4MDFA 4HYYA 2ZR0A 1IXZA 3ND8A 4DCNA 3KZ1E 2RHMA 1FMLA 1YR9A 2CJWA 1X8JA 1XCMA 3VR1A 5F2EA 1XD9A 1KK3A 3GCGA 2XOKD 1VTKA 4JLPA 1N5KA 5BYJA 3T1QA 4OK3A 3R9IA 4LJAA 6Q21A 2UKDA 5FFMA 1VCNA 1VIAA 1DAMA 3P4XA 3SU8A 3QXHA 4US2R 2OUKA 3EZFA 5AJVB 3K0SA 3WMFA 1G291 1E9CA 1FP6A 3E2IA 2QAGB 3G5UA 5CDFA 2CDNA 5JJIA 4PQFA 1IJFA 2D7CA 1YE8A 4N0EA 4IRUB 3CWZA 2IC5A 4PC6A 2ZI3A 1ZBDA 5JJLA 3T06B 3OIWA 1JPJA 3ADDA 3W8NA 2QMOA 2ZRLA 5EUMA 1XJQA 1K8RA 3B9QA 1GL9B 1KJWA 1KO5A 4Z51A 2Z4SA 3MWJA 3IBYA 1F5NA 1KJYA 1E9DA 4B6FA 1NF3A 1BIFA 2BWJA 3ZYCA 4IW3B 1QHHB 2ZRGA 2G1KA 2FPMA 4HSEA 2W58A 3K0CA 5EE9A 2JLQA 2JIZD 2CJWB 1CR1A 3HU2A 1SVMA 1E9BA 1XTKA 1CRPA 3SJAA 4B35A 5F9FA 4HI0E 1K5GA 1J8YF 3EC2A 4CRWB 3IPXA 2B21A 2X2FA 2IYLD 3GEIA 3RSOA 4V0LA 2AN9A 4C0QC 3T15A 3TNFA 4ABYA 2X1VA 4NCNA 1XZPA 1XXHA 3BFXA 1ZU4A 2RGEA 3U3RA 4A6PA 2ZXUA 4LYJA 3TAUA 3U6KA 4AKEA 4TMTA 4NCIA 2JJ2D 2ZU6A 2ZVQX 4ZI2A 3OESA 2BCJQ 3GLHB 5JZVA 5CJPA 2PT7A 4BECA 2HT6A 3GLGB 5DSZA 2FSIA 4JL8A 4PQRA 2XGJA 2O8CA 2WVJA 4QBHA 3EZ9A 1QDEA 2OILA 3A8TA 1G8HA 2ZITA 1E69A 3BC1A 2IYVA 5JCZA 5DI9A 4C0BA 3QF4B 4ZDWA 4Q1BA 1UF9A 1A5TA 1RE0A 1TQDA 4LBWA 4HAVA 4LJ4A 4LJ6A 5KSZA 1FUUA 3QXJA 3H4MA 3PG5A 1ZM9A 4BLOA 1FX0A 1SKYE 5HZKA 3LBHA 4GOXA 5EP4A 2BKEA 4Q1AA 2W6JD 3QBVA 1LW7A 4H1UA 3ZD7A 1G3RA 4DUGA 4E09A 5JS7A 5DYIA 3QUSA 4P4UA 1M34E 1NKSA 2J0QA 3VKWA 3WRXC 1G7CA 1DTSA 4KFSA 1L7VC 1Z5ZA 4TN1A 2JATA 3W34A 2R8RA 1M74A 1KTVA 3DVLA 1Z22A 2F1RA 1N6HA 1NMYA 1GKIA 3C16C 4BRUA 1NIPA 2I3BA 3BB3A 1A2BA 1YVDA 5FBLB 2Q0HA 3LBNA 2FJUA 3DOFA 3ADBA 4MRNA 5JCPA 4QXAA 1BS1A 1UPTA 4TTRA 2YWGA 1YQTA 3GLFA 1IHUA 4MDEA 2YC4C 3KKOA 2J45A 1QG4A 4LHVA 4XWAA 3RABA 1AN0A 1WRBA 4KV9A 4HAYA 2PEZA 5B64A 3KJGA 3QE0A 3QVVA 4JLJA 3ZZUA 3VHXA 521PA 2ZI4A 2C04A 3NBYC 1CU1A 2ERYA 2IYQA 3NDBB 2ZI6A 3IO5A 1MRSA 1ZM4A 3AGQA 1IY2A 2C9CA 5ELXA 2GK7A 4UNPA 3AUYA 1WDTA 5IT5A 2DPXA 1S1MA 3WMEA 2ZE5A 3RS3A 2OLKA 4Q02A 5FOXA 4IFEA 1YZGA 3CX8A 1Q21A 4U5XA 5AWFC 2Y8EA 3WYFA 1R0YA 4U02A 4B3XA 5KO2A 5DIFA 4GSYA 1CTQA 3SI7A 1E1RD 1U81A 4JLKA 4YONB 3ZQ6A 1D2NA 2WSSA 2RGBA 4A0RA 2JGNA 4PPQA 3D6TB 4BLPA 3AEZA 3U4QA 1Q44A 1UFQA 3FFAA 3AKCA 3LH5A 1P61B 3A37A 2PZGA 4Q9HA 4IFBA 5KDOA 3TK1A 4AC9A 1XEWY 4PO1A 4ZIRB 2ZRMA 3SEAA 4TSFD 1CF4A 1L4UA 2XITA 4LUCA 3UMFA 2DB3A 3SHFA 4OQFA 2FPKA 1AZTA 2N46A 4AD8A 4PTLA 4DLXA 4FIDA 1P5ZB 5EXPA 2G0TA 2O8FB 1NL3A 2QMUA 2C5LA 4N3NA 3AUXA 4XOIA 3EZ6A 1XNJA 3UIEA 1KZGB 4BZPA 2Z83A 4FMDB 1VG9B 1W0JA 1SVOA 3DZ8A 3QKSA 1NVWQ 3RAPR 3SZRA 3GJ4A 1AIPA 4B76A 3B85A 4X8OA 1T3HA 3IEUA 3LW7A 5FL3A 2ZJ5A 4D80A 3EARA 2FGJA 4W5HA 4Z8YA 3GJ8A 4GDFA 1S1CA 1E2GA 2IWHA 2D2FA 3X1DA 1ODFA 2FSFA 2CLDX 2P65A 4ACBA 2B7BA 1W5SA 1TQ4A 4Y0VA 2CHGA 1G41A 3MWKA 4DHEA 4JKYA 2BKUA 4M53A 1W5TA 3LA6A 4HB4A 4BE7B 3P27A 2ZE8A 4RKEA 4NYMQ 2G77B 2ANCA 2ZRIA 3M6AA 4NH0A 1TTTA 3EAQA 2J0SA 4JJZA 1NN1A 3VR2A 3OE7D 2GK6A 3B2EA 1FFHA 1HA3A 1L8QA 4XTRA 4KCGA 2W6JA 5JSZA 2GXSA 4PO8A 3TH5A 1NN5A 4JBWA 2OXRA 2GBLA 4K81B 4EQ6B 1MOZA 3KL4A 4OI0A 1S2MA 4Q9IA 2WV9A 4URWR 4OQLA 1KZ7B 1ZUNB 1X6VA 2EFHB 5C4MA 3A1UA 1XTIA 4HZUB 2V7QD 5KYKA 4JSYA 4OJKA 3EWSA 3PVSA 4B32A 3QSYA 1XZQA 2V6IA 4Q4JB 1JR3E 3RRNA 1NJGA 2ZUCA 4BFUA 4UNNA 5EP2A 2IYWA 1ZM2A 1T9HA 2A2ZA 2PH1A 3FKSD 1A2KC 5K8UA 2J87A 1OIXA 5G3YA 1RRFA 4Q7MB 4DJTA 4U00A 1GUAA 5FPSA 1FPMA 1U0HC 2RKOA 3EIEA 1KDOA 1NMZA 5K8LA 1OLOA 2QP4A 1DADA 1II0A 4URUR 1EWRA 1OH8A 5IK2D 1IBRA 3P32A 3DPUA 2OV2A 4A6XA 3Q7QA 2ZAMA 3HWSA 4JS0A 2JLYA 2NO1A 3R7WA 4C0HA 5G40A 3L8ZA 2P6UA 2QSZA 4MRRA 4HZUA 5EP1A 1ZCBA 2VP2A 1Q1ZA 4UXHA 1RJ9B 2GF9A 3KKMA 1ETUA 3U5ZB 2RGCA 4HAZA 2J7KA 2EYQA 3PUXA 4Q4JA 2JJ2A 3VR6A 4JZKA 4AK9A 5DHFA 2PMKA 5J5CA 2A5DA 2CE7A 2RCNA 2Z4RA 4D0NA 1BOFA 3FWYA 4LPSA 4MKIA 3U7EB 1KI6B 4CDGA 5HPYB 4O2RA 2PLFA 3AF1A 3ASYA 1VECA 3B1YA 4URVR 2G9NA 4Q4HB 1M1YE 1RRGA 2WWFA 4EDHA 4DZZA 3IPYA 2OBNA 1T5LA 1I4LD 2B6HA 2H92A 3SE0A 2EW1A 4DBLC 1KI9A 1G18A 4G1UC 4AWXA 1TPZA 1LB1B 2GZDA 3CR8A 1N6RA 3A58B 3LNCA 3QEOA 3DZDA 4JBYA 3NKVA 3IGFA 5AUOB 2WWIA 2FE4A 2ZYWX 4M2LA 3K70D 5A5GA 3A36A 1N6KA 4PSAA 1D2MA 3TUIC 1RW4A 1SKQA 1W0KD 1KSJA 2ZSDA 2PCJA 5TVKA 3W5JA 4DT1B 4N1AA 2WJJA 3BD9A 3RHFA 2WWXA 4TL7A 3TW8B 4F93B 2BBOA 4AYTA 2W83A 1J90A 4V03A 5FBWB 2X77A 2YOGA 5DO9A 4F4IA 4DDVA 2C8VA 4Q18A 3U7FB 1QBKC 5CLQA 1I2DA 4TLCA 5J47A 2PMDA 1WF3A 4NYJQ 2ZS8A 4LBZA 4DLWA 1QHHA 4BFTA 1D9XA 3TIFA 3AGPA 4DSTA 4CYMA 2JLVA 4QBFA 2F3TA 1XTRA 2PJZA 3LW8A 3N5CA 3QENA 4Q9KA 2CNWA 2XZOA 1IQPA 2QPTA 2XOKA 3LVRE 1G4UR 2REOA 3ADCA 3U7GA 3DM9B 2R6DA 3I62A 1P60A 1OFHA 5JECA 3QPVA 4A2PA 2R2AA 4DRZA 1AS0A 1E79D 2A5GA 2J1LA 3PUZA 4W7SA 3GJ5A 3OHMA 5BW8A 4GZLA 1AQYA 4KFTA 1EFHA 4DKXA 5CM9C 2ZYTX 2CNWD 2LCFA 4GBMA 1QF9A 4NYMR 1VG1A 1TF2A 2ZRNA 2DYKA 3BFVA 1Z63A 4O3MA 4AYXA 3LBIA 1KYIA 1AJEA 1UDXA 2CHVA 5BXQC 1Z2CA 3O8RA 3QKUA 4DLZA 1LS1A 3SQXA 2AWOA 4US1R 3ZLJA 2R62A 1SKYB 821PA 3U61B 2J9RA 1OXXK 3SN6A 1W4CA 4Q5IA 3CRW1 5FTNA 3P1JA 3NEJA 3O8DA 2D62A 2NZJA 4B74A 2Z6VA 3GLFE 4JVMA 2ONKA 4Q4HA 3CH5A 2C03A 3EZ7A 4RKFA 5FTJA 4QRHA 1T91A 1ZD8A 1Z0JA 4URZR 1BMFD 1II8A 1EXMA 3C8UA 1ZJ6A 3K0AA 1P9WA 3TGPA 1OHHD 2GXQA 5AUNB 5KSYA 2OT3B 2QE7D 5SZIA 5EE0A 2AK3A 4HDCA 4YMTA 3U3OA 3ND9A 2CLSA 2H1LA 4L8GA 4PX9A 4B47A 2E9SA 5TY0A 1Q12A 2ZI9A 2EFCB 5F3WB 1Q1QA 4GOJA 1CR2A 2PZFA 3ZD6A 3L82B 1AGRA 2NG1A 1G8PA 2O5VA 2O8BA 3X1XA 5GVRA 1LV7A 1Q20A 2DFNA 1YRAA 4ITRC 3VAAA 3O8CA 2IS4A 1YRBA 1PV4A 4Z54A 2KE5A 4FW9A 1FUKA 1GWNA 2GF0A 2CBZA 4PO9A 2ZRKA 4BZQA 3AKDA 5F9HA 2WWWA 5AR1A 3S1AB 2EU8A 3WHKA 2O8DB 2XTZA 3T35A 1XFAA 4TSFA 4WVFA 4PANA 3E5HA 1XTSA 1VMAA 4D6PA 3P4YA 3BK7A 1SGWA 1G3IA 4GFDA 4QNRA 1OXSC 4EQ6A 2HCBA 5DGXA 4PC1A 5AJXA 3TBKA 2IS2A 1RZ3A 2HLDA 5CIWA 3VR4A 3IBGA 3IILA 1TF5A 1O87A 3L0OA 5JSZB 4L15A 4AG6A 4IDOA 5LPNA 3P26A 3R8CA 4BEBA 2KJQA 3GFTA 1XP8A 3C4JA 1KDPA 3RVBA 3SBEA 3SR0A 2D7DA 1OW3B 2JJ1D 2L0XA 5DISB 3T1OA 1E0AA 4OK6A 2W00A 3PV0A 3AVPA 4FMCB 1XPRA 3ZS8A 1W36D 5F98A 1KK0A 4NYIQ 3X1ZA 1BO6A 1P75A 3EA5A 4LV5B 1TU3A 1GNRA 2CEAA 4GI7A 4I81A 1KJZA 1XDBA 1ANKA 1FL9A 3SJBA 2FDCA 4P3YA 3WY9A 3FKSA 3AF0A 5C46F 2E1RA 4BFWA 3RC8A 3UMSA 3I1FA 4AKGA 1SVSA 3A1TA 4LZZA 4ZI3A 2ZJAA 3U60B 2ZSEA 3CNOA 1HQCA 2QRNA 1GNQA 1ONBA 1W49A 1ZW6A 2VP0A 4FCTA 4A1FA 2ZYVX 1KSHA 4BUJA 1J70A 3L8YA 2WJIA 2NO0A 3QVUA 2BVNA 2IYUA 2F55A 4A8JB 2VHTA 4W5JA 2D4HA 2O0KA 3H86A 5FI1B 1Z8FA 3GLIA 3ZH9B 2AK2A 2J7PA 3REGA 1JR3D 3BB1A 4Q9LA 2VP9A 1N3BA 4RD3A 3ASZA 3LO5A 4RZ3A 3JVUA 3F8TA 5CITA 2JAQA 2XTMA 4AKIA 5FOWA 4EFMA 4Q48A 2OM2A 4GMXA 4UQOA 4ASUA 2O8EB 2BV3A 3HR8A 1SVWA 1D8TA 3AB3A 2QAGA 2V3CC 3QBTA 4B2PA 2DWOA 4V02A 2VQSA 5DH9A 2F9LA 3W5IA 4YC7A 2FSGA 5C18A 4JJKA 3CW2A 4A36A 1DOAA 1E9SA 3EIHA 1PLLA 3H1TA 5HCNA 4PPFA 4B3BA 1GL6A 3NHBA 4V0MA 2F7SA 2FMXA 3IQWA 2Q9AA 1P9NA 2R6GA 2JDID 3QIAA 5FI0B 4HZIA 2NGRA 1YZLA 1IN6A 4LYAA 1SHKA 4CT4B 3QJYA 1IN5A 3EPKA 2WPDA 3OEHD 4Q4LA 4XD7D 4BFSA 5DLQC 1T0JB 4V0ME 1E99A 1O3YA 1XEXA 2RGGA 4PC7A 3Q8XB 3T34A 1MR3F 3ZIAD 4D4MA 1N6NA 3QXXA 2GCOB 2ZAOA 5AJWA 1R4AA 3M1IA 3WNBA 5EJEA 2N42A 2IXGA 2E87A 2BJVA 1OFUX 2WAXA
chains in the Genus database with same CATH superfamily
1P5HA 2GRJA 4QYIB 4RD2A 3CGWA 2DJIA 4GBED 5T8KA 3IMGA 4U6NA 3H75A 1FSSA 4Y1GA 4D97A 1MJGM 4LV6A 4DQXA 4XVUA 4ZDKA 5JNSA 1QCZA 3IVRA 1YA8A 5A0FA 1E1RA 2I7TA 1FA9A 3GT4A 1QB8A 2AZXA 1JPNA 1X19A 4TT3A 5D86A 2GK4A 1GGFA 1Y3CE 2VF7A 4YNBA 1K2VN 4F5EA 4B73A 3L6UA 2NX2A 2C78A 3A1NA 3T9AA 3V97A 3VR0A 1QPGA 1CR4A 5K3AA 5CDYA 1W2WB 3M49A 4HGRA 4OI4A 2EQAA 5LB4A 1CRQA 1DAIA 2HJGA 3H9JA 3W0LB 4AECA 3K5PA 3NVDA 1KL7A 3N8IA 5E0OA 4B71A 1HQYE 2WYIA 3RFUA 3G8YA 5JSYA 1MKYA 5B2EA 3C41J 1OWNA 2DSTA 1VHLA 4YK7A 1SAYA 2JK1A 3WZLA 1ZIDA 4B4KA 1YBHA 1Y33E 5BR4A 3J81A 2X8LA 2HGSA 1EIWA 1G5FA 3E5MA 1I2AA 4NOJA 1WP4A 4LF9B 2JGAA 1Z8NA 1UJ2A 4HAIA 2R96A 2YVQA 3OE5A 4LJKA 4TM8A 2E89A 1BW9A 1VLQA 2FV8A 1QG2A 1KDVA 5FBQB 4UTNA 3U9LA 5D51S 3KD3A 1H85A 1MZVA 4HDMA 2B4RO 1PDOA 2E4YA 2ET6A 2L2QA 5E8JA 3LYAA 4XFKA 4HATA 1ORRA 2F1JA 1E2DA 1R8QA 1RM4A 2W7TA 3GRZA 3HRKA 1RQNA 3DHEA 3GPLA 2IPLA 2GAAA 2ZRPA 3HXLA 4ZKEA 3TE6A 1BMFA 4LJ9A 4X8MA 2CNOA 3QEKA 1ULZA 3EGXB 4D4KA 2DBYA 3ITEA 121PA 2QU8A 3KUDA 2W9XA 5L4LA 2R7MA 4MZDA 3WV5A 1JQBA 1U90A 4RIHA 4CTMA 4OATA 4S1OA 5FYQA 2R8PA 2VF5X 3OZXA 1YOBA 2JKYA 2VEOA 3E1SA 5EFOA 3BSWA 4NRDA 1Z06A 4FHGA 1GT91 2C0QA 1WB5A 1CLUA 4MVJA 1H0HA 3F46A 4AJPA 5AVSA 3WDSA 2B6NA 3OPXA 1U99A 5IKMA 1VQ1A 2D5LA 2B36A 3ELDA 3DV0A 4FU0A 4C76A 1VLVA 1PS0A 1LI7A 1X9IA 4RTQA 1XOIA 3PQ7A 5JFGA 1I6MA 3HKDA 3K9NA 4W9NC 1RRKA 3LLUA 2QLTA 2VJQA 4KYIB 5LMUB 4WA8A 3K6JA 3MUOA 1G3QA 1F2TA 1G4HA 4MVJD 4ERXA 5DNYB 2J3HA 1Z34A 3K1JA 3OJFA 4KZKA 1RAAA 2JFBA 1DAGA 2XVMA 3MYRA 4NMMA 4PHFA 4WZBE 3AUKA 2DZDA 4MR7B 4ZN6A 2PJRA 3ANLA 2CE2X 4CXMA 1QRTA 2VA9A 4XUEA 2JIOA 4N0DA 1WVMA 3RDPA 5A3QA 5EMNA 4F4CA 1TM3E 5CG1A 4EQZA 1M7HA 2CL5A 2NYAA 3CF6R 1KBOA 3EGWA 5T4HA 1YKSA 2ZANA 3DOUA 4E2FA 4R1PA 1UC4B 3UZUA 1ADGA 3VDRA 2PFSA 4HC4A 4OPMA 4IDCA 3A3KA 5FBKA 3UBMA 3DFUA 3MINB 3VI3B 3T0GA 4D4IA 1EPUA 2QG9A 3R0IA 9ABPA 3C6ZA 4RACA 2W6IA 4DV3B 1XXHE 3V4SA 4UBNA 5G4KA 3NH6A 3O4IA 1BQEA 2OHIA 2X23A 2X0NA 1UJ4A 2PH5A 3A2LA 4V0KA 1TADA 3GEBA 3FZQA 4N3AA 3WSVA 5HF9A 3I58A 3U0BA 2GS9A 5KSOA 5JWHA 3KYJB 1O0BA 1W48A 3I6IA 4YQZA 4F9GA 1Z4IA 1TJPB 1TZ2A 4BRZA 4PY2A 2Z43A 2GEKA 2ECOA 1RYYA 2VG8A 4KQMA 4PCVA 2CUZA 2XUAA 4R3NA 5LQNA 3E9RA 1E6CA 2EIXA 3THYA 3F3SA 2OV1A 4M1QA 1DPFA 3IT3A 4U0JA 5EE5B 3FTDA 2Q1WA 3BH6A 1OXBB 2MWMA 4GOMD 5CMLA 4V1CI 1L7MA 5JVDA 1W581 3O94A 1YB5A 1RHRA 2DPMA 3TDNA 2Z6AA 1QJCA 4C2BA 2AOUA 3KV3O 4IJUA 1KDRA 2ID8A 2QM0A 4RPGA 1IXRC 4G5OA 4A5OA 4BO6A 1DTWA 2O2YA 4URYR 3T7AA 4HSGA 1G42A 3HCWA 1DKUA 2FP4B 2LD4A 2RGXA 2V55B 4YTEA 2DBVO 7ABPA 1XKLA 5TS3A 4GI1A 4Q3KA 2DUUA 3A4VA 1JHOA 1AMUA 8ABPA 2OFFA 4YV1A 4FOOA 2F8TA 3L9XA 5FEUA 4POAA 4RJTA 4IIEA 2Q3CA 1V5WA 3HJHA 4LJSA 4MVXA 5FA8A 2ROQA 5K3SA 4JC0A 3MERA 2O14A 3DO5A 1KH2A 1XDUA 4Z99A 5BNFA 4RSMA 5FUBA 4CFYA 2AN1A 2ZWMA 3EXG2 4DNQA 4ZCTA 5IJ0B 4FFMA 2B82A 2ETVA 2VTKA 5FJJA 1V48A 1QZXA 2IIBA 2X4IA 3OEHA 1AXRA 3K9GA 5FWDA 4ZVLA 5HE9A 3RROA 3NOVA 2NSLA 5KYWA 1EG2A 1E6EA 2AI1A 4GWLA 3H11B 4M9XA 4NTZA 3GLHE 1R74A 1YJCA 2J59A 4L5BA 5A7GA 1QLHA 3JZAA 4WLOA 5EIWA 4ENPA 4XRGA 3FBWA 1XTQA 2Y0CA 3IE2A 4IX9A 5F3RA 3CF4A 1OOEA 4RPKA 2X0JA 3S4YA 2VHEA 4CL2A 2A9JA 5C31A 5C1IA 4ZQIA 3EX7C 1CWUA 3QMVA 4NBRA 2RJOA 1D09A 1I3KA 2DR3A 1V96A 1YOVB 5IT0A 5HXAA 1YD7A 4PZZA 4IIVA 1MX9A 1IY0A 4GZ5A 4W82A 4YXWA 2G6BA 4EHKA 5KKCA 3FSRA 3A31A 2VTVA 1G59A 2ZJYA 4PHTA 3WB2A 1J5XA 4BTEA 2QDXA 3MPOA 4HL6A 3MPUA 4OP1A 5B3AA 4R7GA 1RJDA 2XADA 3SR4A 3DZGA 1ZOIA 2I66A 1XNGA 4IP0A 4JQYA 3HCBA 1GPAA 2CXRA 3SQOA 1JW9B 4U9HS 2QJFA 3KTAB 2XE4A 2FEAA 1U0NA 2JFXA 3IDQA 4HUJA 5FNVB 5CVVA 3ZDYB 4GX5A 3ZV5A 4PRLA 3TM5A 2Q5JA 4WL0A 3JAMA 4WBXC 5K2MA 1ELOA 1OTYA 3DEZA 4QDJA 3RANA 3SS8A 4EJSB 3HO8A 5U1PA 3A2NA 4I3GA 4JI6B 4PGAA 1EGHA 4JY7A 4OFBA 2NO7A 2WWTA 1RQGA 2NPOA 2XNSA 1NYRA 1T4BA 3DOEA 3D5QA 1QVAA 4YCSA 2QTHA 1FQKA 1KSGA 1G66A 2PA0A 3BTUA 4YI3A 5JYEA 3AUSA 5JAIA 5K8VA 2I80A 1CVRA 1IOZA 2MJLA 3E8SA 5E1MA 2PBFA 4OU5A 3RIEA 3SX2A 3UKOA 1U3TA 1W46A 3DBHB 2GJ9A 3A6KA 1NZJA 2B35A 1LDYA 3AHJA 1N5OX 3GFOA 4D0RA 3ESRA 1YIOA 4PG8A 1Z26A 1X13A 2PUHA 2M6KA 2IF2A 1KQNA 1WZNA 3UPDA 4LWPA 1L5RA 2PHZA 4LC0A 1G16A 5CA0F 1SZCA 2UZ3A 2GEVA 2WMDA 4AO8A 4ZO6A 3E3LA 2V9ZA 4CCAA 1TM2A 1UOEA 2AT1A 3CSDA 4LJYA 1TVMA 5HKKD 4LTMA 3L6RA 4V3BA 5KOHA 2IGBA 5T57A 3U2QA 2JI4A 1JLKA 1ZXBA 4UXJA 3OQMA 4HGYA 4EMSA 1P2VA 4OI1A 4Y9DA 3AM3A 5K6AA 4NFYA 1G5QA 2HU5A 3A1DA 3TSWA 2ST1A 4FYHA 4QFDA 3PT9A 1XVIA 1ZNXA 2WUEA 3EMKA 4YS6A 1R66A 4BNGA 5IC4A 5EE1A 1FE8A 3BRQA 4ETNA 1QPZA 1JJVA 2MINB 2YBEA 3FVQA 4R5HA 3WNVA 2OQIA 4P83A 3AVYA 2OHGA 1UBCA 3IOEA 2PG3A 1NLZA 2AQKA 2CYAA 2DLDA 4H1VA 1DWPA 1H8EA 4ZDIA 1G3UA 4R40A 3TSAA 1MLDA 2LE0A 2RHJA 2D2VA 4CMCA 3LY8A 4LE1A 1XL0A 3FETA 3ZVLA 5DBIA 1OKKD 4LN1A 5A4IS 1HLDA 2QN9A 3A4YA 2YN2A 3WGGA 4EI2A 2PYDA 4D6XA 3Q5EA 3RSLA 2DEUA 4YAWA 1J8MF 1HT1E 3M5DA 4X00A 2GR9A 1T26A 1TL7C 4HDOB 5A2QA 5EMMA 2VZEA 1HDCA 1DNPA 2WF6A 5LVAA 1JI0A 1ZJ4A 4PVCA 2ASEA 1EGQA 1XF1A 5E6RA 1N92A 2AOVA 2ZTLA 4Q05A 3ZW8A 3C3CA 3EWAA 3HSYA 1IY8A 5EMLA 1KR5A 1JF8A 1WNFA 2X4GA 3QWIA 5BP7A 1AG9A 1OXTA 2PQMA 1D5CA 5ALMA 2HK6A 1MJGA 2VDKB 2W4IA 4A1OA 3LFTA 1U31A 2JJ8A 1C14A 2FN7A 3PQCA 3QE2A 5K0NA 5CURA 1JDSA 3G13A 4TMYA 1PJQA 4WKCA 4ZT4A 2WPDD 3PIIA 4H15A 4PXAA 1EFPB 1KVTA 4X64B 4YMVA 5FUQA 1F8FA 3E9QA 2BRUA 4R2IA 1U1GA 3O47A 4TZTA 4CKYA 2RGAA 1GN9A 1A9ZA 1GYPA 1S3FA 2GD2A 4KLRA 4HQFA 1C3JA 5LQKA 4LHSA 4KH0A 1LBTA 3IE0A 5J4VA 4EMBA 4H7KA 3U4QB 1TM5E 5SZHB 5DP1A 1Y7HA 3UFXA 2QTCA 1NQWA 5H3LA 3EK2A 4KXNA 1PHPA 1YCDA 2H65A 2R84A 1F0NA 5D1HA 3DJYA 3RI3A 2P5SA 3V1YA 4FE4A 1T2AA 2ZT8A 1M7BA 3PRHA 5AW0A 2QTTA 4AUEA 4JBGA 4ZWNA 2JCYA 1O97D 2G88A 4OXQA 1RNLA 3SX4A 2FEKA 2OKGA 3JSAA 4YAUA 1Z0AA 2BM8A 2ENWA 2DGDA 4JDPA 5ALYA 2PRIA 3NAQA 3PYXA 1ESNA 3AM4A 1KJJA 2Q2VA 3N9IA 4KX3A 1XTZA 1JAZA 1NMQA 4M1SA 5KVSA 4M1YA 3DKVA 4BLWA 4R1NA 1GR1A 1Z2EA 2IPNA 1E64A 1FEZA 2XNDD 4TLEA 2DT5A 2RBKA 1STOA 3O74A 4N41A 1TJ3A 4KODA 1SURA 4TYYA 4A2QA 3ILYA 1KYYA 1IAQA 2NXWA 4J90A 1UP7A 2PRKA 1Y8ZA 1GNLA 2OLJA 5DV9A 1CF9A 4UEKA 3AVTA 1ZP6A 5C81A 2PRSA 2PZAA 3ESQA 1G0OA 5DNVA 4QEKA 3SF8B 4EGSA 5M7EA 3A4NA 2CVPA 4MRMB 4TS9A 1SC4A 1RJ9A 4BNIA 2Z2JA 1E4VA 2VSOA 1GN8A 4HDRA 1CDZA 1S3SA 3GDGA 5AKGA 3RUDA 1UAYA 3SC2B 1Y3DE 4OMFG 4O2BA 5CYOA 1E66A 3QV1A 1ZGGA 3LQKA 4MIOA 5EZYA 1JLLB 1NUTA 2RI1A 2YRFA 5JY1A 1V9LA 2X58A 4YJFA 4GRAA 2VCEA 1TM4E 3SFZA 2XYPA 3TE7A 4OIMA 3WJ1A 2LIVA 1J22A 5KEIA 2K7FA 5MN4A 1W9MA 2ZR8A 1SZPA 3WLMA 3LWBA 4OCZA 1EWQA 1NV8A 2W2MA 4LSMA 1E0DA 1NX9A 3PCTA 4EJSC 3ELUA 1VCIA 3KB1A 3FCUB 2JFPA 4F38A 1DQSA 2V7PA 3V55A 4OG2A 2R8OA 4BJ3A 4RD0A 3ZGLA 1L8OA 2I2BA 2OFOA 3UK7A 3UXYA 4KXLA 5T8KC 1QQAA 1UBSB 1L3IA 1YU9A 5CD1A 1NXVA 2LDXA 4X1YB 4LRWA 1K4KA 1PP4A 1I5RA 1OREA 1K6EA 4XR4A 5HILA 2QX9A 3OC0A 3D54D 5GMOA 1ST3A 3P5SA 5JNUA 3R7NA 3UWSA 2VC2B 4EVSA 2G5CA 3OPYB 3DT6A 3L2OB 2BM0A 4BBJA 2IYFA 1D2HA 2Y2UA 2FE1A 3BMQB 4JQCA 4MEAA 1T1JA 2BTOA 4PLVA 1B6TA 5D01A 2E0IA 2AMYA 4JLDA 5FWYB 5M34A 4BLRA 4O4HB 3VQTA 1CP2A 1GT6A 3MGCA 3RBVA 5FRDA 2RH8A 3A1WA 1P4JA 1YRQA 4G0VA 4M83A 3OA2A 5BXYA 3CYFA 2VSXA 3ECSA 1W44A 5AOCA 1QU3A 1T35A 4JNKA 1S3GA 1Q3KA 4HAUA 1FQOA 2ZSIA 1KQOA 1TAQA 1IOVA 1EUCA 4GR9A 1K6IA 4MITA 2VYNA 5BN1A 3IA2A 4RXTA 5F52A 1OI4A 4M0LA 2XJ4A 2OP0A 1AGNA 3HB5X 5FIUA 1YZYA 2WIAA 4GOND 2ATEA 4OUKX 4URFA 3KT3A 3CZPA 4G5HA 1HKHA 2D2XA 3KELA 3HV0A 4H4DA 2EL9A 2I3ZA 4J0JA 3TEMA 3PXXA 1U5AA 2AEFA 4J16C 2Q2QA 3MWEB 5SYMA 1L3CA 2RB4A 5A3SA 3ZH2A 4DMUB 3RREA 1OBOA 2CDRA 2AN4A 3CB2A 1P17A 4L3VA 4HADA 3WGNA 4ATNA 5AMXA 3DE7X 3ONFA 2WJYA 2PQ6A 3GCWA 1P3JA 1NLYA 3GBSA 2J4DA 2J9XB 3AQ4A 1C9NA 2HA6A 3EGXA 5IBPA 1FFBA 3JVVA 1H3FA 4P5PA 3GPBA 3U3KA 4C5AA 3O8QA 3TRHA 1QYRA 2H8GA 5EQTA 1R0WA 4QWWA 1M67A 2ECFA 2I67A 2YN0A 2CZCA 3IUSA 3GQBB 3TRIA 4IRXA 5FHRA 2REBA 1KFEB 2C3PA 2AHRA 3H16A 2GOYA 2I4NA 4IV8A 5DYGA 2O59A 1KGDA 2CHUA 2OCIA 3D2BA 4X90A 5CCXA 1PJLA 2Z04A 4MGYR 4DLTA 1XZHA 5A3RA 1LC3A 3VM6A 4AP6A 5ARBA 4C3UA 4DMHA 3GHHA 1YR3A 4OJQA 1TD1A 1PSDA 2D8MA 5GONB 4ODIA 2O7RA 3WVNA 4AYWA 2HA5A 5L3VA 4PYNA 3OZBA 3SLRA 4ARZA 1HDYA 1NY5A 1QH8A 4ZDJA 2PX3A 3KBBA 1XRJA 3S1LA 1F4VA 1JWAB 4B43A 4ECAA 4Q4CA 5IM4A 2YXEA 4S2EA 3EQZA 3G9XA 2NQTA 4FOLA 5D87A 1MA3A 3RKSA 3V2IA 2Q21A 1XKTA 4LWOA 2WFMA 3ZZNA 3Q98A 1OVGA 5E6SB 3B20A 3HA3A 4PZAA 3IQGX 2AC4A 4LZLA 1XROA 2YWDA 1OX6A 2I8LA 5DSTA 4DY6A 5TR9A 1LBQA 1ZNZA 4L8LA 2DQKA 1RDFA 4B31A 1Q3TA 5K03A 2GEFA 3E22B 3QKRA 3PYMA 1ZQ9A 4V2IA 4EHNA 5HRUA 1Z6GA 3WK8A 3SXPA 3M81A 1GFIA 1XTTA 2W8BB 1DGQA 2NOAA 4GWGA 1HEUA 1K75A 1L4BA 4HAXA 4KN6A 2GBLC 4NQZA 1PQPA 5L8VA 1XJCA 3K0KA 3AVQA 4TYWA 1NHGA 3L8GA 4XYMA 1TTPB 3BH7A 3IHLA 3ILXA 4HQLA 4CTJA 5JAHA 3LTNC 1BX3A 4MW7A 3L06A 1O08A 2P8JA 1C30B 1P45A 3BWBA 4LI0A 4LWZA 3RC2A 1FXSA 2CUTA 1VPEA 5F2OA 3R5KA 1R8JA 1WP9A 2B5WA 2DAPA 2XLBA 4IDFA 3VX4A 3NVKI 3IA7A 2P2SA 1E94E 2Y1XA 4J3NA 2Z8ZA 4MW2A 2WYHA 2HIMA 3VDNB 4B34A 4UM9B 3LOUA 3LZCA 4A3SA 2ZM5A 4FFBB 2JI7A 3H6HA 1K06A 4EJSA 1UMDA 1NQ5A 5EPUA 3VU0A 2HMSA 5IJ9B 2Q5LA 3OKPA 1K98A 2FSSA 5J40A 4TKMA 2H16A 2LCIA 4RANA 4YROA 3W6NA 5F7XA 2NYVA 3F8SA 1SBCA 3KQQA 3NP7A 1FS5A 3PC3A 4RVCA 2GJSA 2P90A 5HEKA 4C21A 4R1MA 4EUNA 3W2EA 4EB6A 1YVRA 4G8DA 1ISMA 2W6OA 1AM4D 2BE7A 2CBXA 2GN4A 2IEGA 3HE3A 2CGEA 3IUYA 3AX6A 3OWOA 4JT2A 1NTOA 2VK4A 1Y5IA 3ZJ5A 1P9OA 3JZDA 3KOUA 3TAHA 3R9WA 5LA6F 4BBPA 2FWNA 3NTLA 3TNLA 3GZNB 3DZJA 4FFDA 1XU9A 3PHIA 1WOMA 3CIOA 3OO0A 3QFHA 3ZQJA 3IEKA 3AFOA 4RM2A 4IG9A 5SY4A 3C7DB 3OO1A 2COUA 2IUSA 3QYAA 1SNYA 2ES4A 3OTIA 1YJQA 5ESDA 5FHQA 4AFNA 4OX9B 3ZTYA 3CT6A 1KSFX 5I3ZA 4FKMA 2B5OA 3D64A 1O0SA 2Q3MA 4DLUA 5CGQB 1M66A 1FMTA 1S7CA 1Y7TA 3K0HA 1GRQA 3MOSA 1VB3A 1A2QA 3M4JA 5AICA 4ZTBA 1DLJA 2C96A 4I55A 3NHLA 4DVJA 4ALJA 5EY5B 5IT5A 1DG1G 1XWFA 2R9VA 3D6HA 1TTTA 3ZGVA 1R8XA 2C31A 1Z29A 3EMVA 4KVGA 4NZZA 2PNJA 2FW9A 2A0KA 2BHLA 4AQDA 4I6JA 4E14A 1KH3A 1WZCA 3LCCA 4DSOA 3HADA 3C7TA 4NHEA 3K5HA 1H2BA 1IB6A 1DEAA 2EP5A 4TTVA 4FZJA 3CLUD 4TSRA 5CW1A 1GPH1 2ZRDA 2IYRA 4Z8XA 5AIBA 2EXXA 2GTPA 3E1KA 3QVGA 3TQCA 2XPCA 5JSQA 1M0EA 1BZYA 4K3UA 4D8VA 1H6AA 4BKMA 3HVIA 2NACA 5DSXA 1SOUA 2UYHA 4YMLA 2P9FA 2WWHA 1ZC4A 2D5AA 4FDLA 1L5NA 3RB8A 4JMLA 3TEFA 1U3FA 2CXHA 3NDJA 3GQVA 4J1NA 5GJWC 4TROA 1AGXA 2PWPA 5A9SB 1Q15A 2HF9A 5DIZA 3CG0A 3UN1A 4E4YA 4ER7A 2XRYA 3H18A 2PLRA 4KITB 3KQWA 1C0EA 3R5FA 4OQPA 1R6BX 2C2ZA 1WSBA 4LXIA 4XEHA 4WDQA 4ZVVA 4Q7QA 1DUIA 4NDAA 1YDHA 3SHQA 1ZGBA 1XN4A 4TV8A 1ZLYA 5U4QA 3BA6A 1JQLB 4C4TA 3SLGA 3MBKA 1DCFA 4CKBA 3AVUA 4LKRA 1Y9DA 5IYZB 3HXOA 2XX3A 2BFEB 5AKYA 2X19A 1S9HA 1I1QB 1TK3A 4NS4A 5FX2A 4X91A 3C1TA 5DTIA 3ZBTA 3RIMA 1NW3A 3ASVA 3KKQA 5DX1A 4L6IA 5AK5A 3U09A 1C7JA 5C4IA 3K4QA 3PENA 1PJCA 2JZCA 5SV2A 4F8JA 1KYVA 5J63A 1GZ4A 1O4WA 4K87A 4R8VA 4AY2A 1EVZA 5AVZA 1B0UA 4DAEA 1EDBA 1RLOA 1SJ9A 3COSA 3GH3A 4KRFA 5BYKA 1NW6A 1V16A 3IPAA 3WLLA 4YECA 3G2IA 3RQSA 5K8JB 1D2GA 1RXVA 4KPYA 2QN2A 2BFCA 2VP6A 2ZI5A 1AQ6A 3L6OO 4ZAGA 5KKAA 4NCBA 1UK7A 1SY7A 2WD7B 2GETA 3NX4A 2VJCA 3I9OA 2BDEA 3OWHA 4B6SA 5AW1A 3AVWA 5DE3A 2DLNA 2OSBA 5J4HA 5LR6A 5COBA 4D9CA 5EGSA 2CLEB 2RGDA 3AINA 2PZBA 3JAWA 3EIFA 3QPWA 1DMSA 1GSHA 3HLYA 4RE5A 5CEFA 3FPKA 1UIRA 3IHWA 4D9JA 3DFZA 3QEJA 3FB1A 1ZSYA 2GJ8A 3QNUA 3O73A 1TI7A 1YNOA 4GX2A 4GUAA 3VR4D 2HLDD 3R3YA 4RTMA 4RZUA 4KG7A 1QQ7A 1NV9A 3DV0B 3L93A 1IONA 2J4FA 4XWTA 4JQSA 1MT3A 2ZT7A 1W36C 3Q11A 1IK4A 1Y37A 4E5NA 3MQ4A 2ODNA 1TGVA 2FW1A 3CS3A 4QLBA 1ZUNA 1ZOPA 2W2KB 1Y89A 4HUTA 4Q3BA 4MCJA 5TGTA 1Z5OA 4LRSB 3HBLA 1T3TA 2JGKA 1U8ZA 4PWZA 4V38A 5ALQA 5LIPA 1II8B 2HSWA 1WIWA 4FUQA 3W5HA 1MC5A 1D6JA 3DZHA 5DXJA 3B82A 4PGFA 3ZJ4A 2J6BA 4QDKA 1KEWA 4WOKA 1G20E 1IN1A 1GUZA 3D6FA 3GEMA 5I6DA 4NFSA 2DCUA 4OGLA 1F9AA 1L5FA 4BMPB 2M9MA 1JMKC 1TLFA 4DWWA 2NZXA 3QLVC 4M89A 5IZCA 1RYBA 3C3DA 5DF1A 3FPCA 1SUIA 2A8YA 2XT0A 3FNRA 2VT3A 3PA6A 1CRWG 2P3SA 5K4AA 1RYEA 1HH4A 2DUNA 2FW0A 2AUMA 2HLNA 4NYIR 4RIEA 3WX0A 1BYUA 4HXGA 4PPGA 1KFBB 2Z58A 2OWDA 3D7KA 4GO1A 4J6EA 4XVRA 5FR2A 3W78A 3F6SA 4MGIR 1Y6JA 3B2NA 5KOJA 4S24A 4CF7A 4B7CA 3OHPA 2BUBA 5TGDA 2ORIA 4HYQA 4AUKA 3KPJA 2MYNA 1WKBA 2VS1A 4ZOBA 2GVDC 1D6SA 2OZEA 1BE8A 2NZYA 1K7YA 1V1JA 2GDJA 2G83A 2COKA 4IY1A 3SNKA 1EIZA 4WERA 3NNDA 1ORWA 2PU5A 10MHA 2R8ZA 2QDKA 3UCEA 1HLGA 5JSHA 4TYNA 1K63A 1P0IA 5I48A 2QJRA 3K20A 2RIPA 4C0KA 3A25A 1IY1A 2VPZA 3GRRA 3PFBA 3WA6A 5IANA 2Y1CA 3VU9A 2Y1GA 1E3JA 2B7LA 3WMGA 3IIKA 2QE6A 1JDBC 1BXRB 3CXRA 2P5TB 3L1HA 4DJAA 4L4YA 2CUKA 3WP1B 5EJIA 3PKIA 2R1VA 1XV5A 2AB0A 5EXXA 2QPOA 4M88A 4XIFA 3RTBA 1XRSB 1U94A 3C1OA 4G56A 1PUJA 1G2OA 1R4ZA 4DT1A 1FMFA 1W1IA 1N4AA 4IGFA 1SXJE 1R7RA 4X94A 2RGNC 1ES9A 4JSTA 1JHAA 2HNAA 4D79A 5GIPE 3MXTA 3JWHA 3QVMA 4CFSA 3MRSA 4DEYA 2JCVA 3M3PA 3RS4A 4Y30A 2BI7A 4ZGBA 3TIIA 1U8YA 1VYVA 1ZS9A 4ARBA 1X7GA 2CXOA 1V6AA 4QOJA 3SD7A 1CK4A 3RUCA 3QLUA 4TMKA 4EZBA 4DR6B 4YP7A 1RWKA 2BP7B 2R4QA 1NVVQ 3BMCB 3B60A 5ES3A 4OOFA 4L0MA 4PPNA 2VWPA 4EELA 3HUTA 4BVGA 3F8WA 4RQAA 4DCPA 3R6DA 4MVJF 3CRNA 3LVQE 1D8AA 2V4ZA 4ZODA 3HK2A 3EE6A 2QM3A 4K0RA 4WINA 4DG5A 1XSEA 2EZ4A 2I6TA 1PQYA 4RJLA 4K1XA 3DTTA 4B6JA 2YKGA 1OGIA 3EQ7A 1ZR2A 3RSFA 5HZHA 2SHKA 5KO2A 1SBQA 2HHCA 2W48A 4RA6B 4X95A 1SG9A 4PV7A 4BTVA 5GTDA 1UK6A 3NEYA 2HNBA 3L5OA 5GV7A 3C74A 2ZM6B 3RC1A 1LF0A 2P40A 5F21A 4BNDA 1IZ9A 2TMDA 4BE4A 3FNHA 3E2PA 1X7WB 2OZVA 2VJBA 4RK0A 1MDBA 2PKXA 3CMMA 3FHCB 5A4JA 2G5PA 3IRUA 1NX6A 2IHYA 2O57A 3IS3A 1AK9A 5BT9A 3OQ1A 4JX8A 1ZIYA 4U63A 3QZUA 3I2GA 1VE7A 1YA6A 1NQOA 1CS4C 1G21E 2A1TR 1W0KA 3GUHA 4FDMA 3ROZA 1TTQB 5JRJA 1YTUA 4YJFB 1C1DB 1TFRA 2AYYA 3BERA 2AWNA 2XD4A 3EPPA 2JRLA 1MAAA 3F5DA 3IDFA 1BS2A 4G5SA 3K1YA 4HYEA 3UAXA 1UQUA 4JUDX 2VT7A 3GVCA 4KPUA 3OF3A 4II3A 1MAVA 5LQSA 4PAQA 4ES6A 1W25A 4H4EA 5I7WA 3RTDA 3Q12A 3CZRA 2CJYA 2H59A 5DCLA 3ESDA 2LRHA 2IY8A 2VJMA 5HE8A 3VYUB 3WNDA 4NBLA 4Y9SA 3LC2O 5HQTA 1EUZA 2FP3A 1Z7GA 1N6OA 2Z2YA 3IOCA 2ZBPA 4YJKA 3A4MA 5L3ZA 5IZ4A 3WMRA 5FUVA 4CV0A 4FN5A 1JNYA 4ECEA 1V3QE 4MVJI 4ZO4A 4GP6A 3OLVA 1DFGA 4N8DA 3LM8A 4XXHA 1ULSA 3F5QA 1T9AA 3CN7A 1B76A 2QMZA 4MPJA 4HX5A 2IYTA 4C22A 4M6WA 3N76A 1J2EA 5E7QA 1LEHA 3T5AA 3SJCA 1A8IA 2VYQA 1AU9A 2E4UA 1VE5A 2JZOA 1DJQA 1SBIA 2VHWA 3OFJA 2XUDA 4Q93A 1S3IA 5FPHA 5K51A 4PLFA 2I9PA 5CDTA 2NV2B 2ZOSA 4QJBA 2YWFA 2C9OA 2R6JA 3LGSA 1P5JA 3PUYA 1F1JA 2KLBA 4R8KA 1HYQA 1U2ZA 4X85A 1Z82A 1O5OA 4PSUA 3WYAA 5K8CA 3FWPA 2YS6A 4J91A 2HA2A 1DOZA 4I3HA 4A4DA 1B8VA 2FMHA 3AUTA 3DD1A 2HX1A 4MQMA 5LDGA 3JQ8A 4GGPA 1YRLA 3LWDA 2HSZA 1IG0A 3ZQKA 3ZZTA 4MTLA 4DADA 1U0JA 1SEPA 1N2CB 5CK4A 4R41A 4W6ZA 5DW3A 1E9AA 4FI3C 1N7GA 2FRXA 1K4YA 2A3NA 2Q3BA 3ANNA 3OX2A 1CJUC 2FYTA 2HT1A 1KF0A 3RRZA 2R47A 1KBZA 3W7VA 3FCEA 3OCWA 1BJRE 3O9ZA 1JFSA 4F71A 4XFDA 9LDBA 4G84A 2I29A 3WK6A 4Y6PA 1COWA 1ZW1A 4OAQA 5C32A 3UT5A 4P2GA 4PLHA 3NHJA 3B6EA 1I5EA 3H04A 3TJMA 1SCKA 1C29B 1QXSA 1Y8AA 2A9OA 2GBIA 4O4JB 3SGLA 3S2SA 3UK2A 3DEHA 1RXIA 4WFIA 3LWNA 4IHKA 3VAYA 2H2FA 1QRAA 4AUNA 1SOWA 4KAAA 3OQVA 3HHPA 3VKFA 4R5MA 4B80A 1N1DA 4KI0A 1WWKA 3SHVA 3JY6A 2GLUA 1Q0PA 2V1XA 4FYMA 1LLDA 1JEAA 2L18A 4DA6A 2H9YA 4B8ZA 3S2EA 1BE6A 1Y3FE 2ZCJA 4RZ2A 4CNBA 1TYDE 1YH3A 1G2QA 1LSUA 4S12A 1QOQB 3E03A 1OZFA 4RFSA 4DCUA 1PT7A 1OA0A 2W71A 3WSTA 4M38A 1N5IA 4GM1A 4P4LA 4FINA 3KDPA 3RYHA 2H2AA 5BW5A 3PX3A 2XH8A 3R3HA 3OBIA 1C4OA 2O6HA 4PSVA 2UAGA 2BGLA 5EHXA 1G8GA 1NSTA 1ZD5A 2I62A 3EEBA 4N4AA 3FPEA 4TL9A 2VWQA 4ZV9A 3SJZA 3UTCA 4AAYA 4KR0A 4ZCPA 2V7UA 3LUFA 5ECWA 4ZT7A 2W2TA 1GY8A 4XJXA 2YY6A 5KQSA 2BISA 4KRGA 1UBEA 2W2NA 1Q0ZA 4OGWA 4GM0A 4R2KA 4L78A 5K1ZA 621PA 5LBTA 2BGNA 4UCFA 2OBBA 2LR0A 1M1XB 2OFWA 1XQ6A 3DZCA 3N2IA 2H54A 2AJ8A 1YE3A 4YUAA 4UBLA 1XF9A 3FPFA 2W8ZA 3KSRA 1EAYA 1MO5A 3S1SA 1NJ2A 4HS9A 5G1OA 4F2WA 3GEPA 5CB4B 2BN4A 2CLOB 4QD3A 1IJKA 2VH5R 5A6SB 3RVLA 4UASA 1A7JA 1RS0A 3HXTA 5JO0A 3DMTC 5J1SB 1SIBE 1G6Q1 3RS2A 2Z98A 4TQAA 2YJ6A 3VPSA 3UH1A 4Q9JA 3JYLA 4C07A 5KDLA 5BMVA 5KSZA 1QDUA 4TKLA 2NT3A 4XOUA 3LUBA 2QAJA 1NC3A 3B7PA 2FPIA 3HB4X 4HT3B 1C1YA 1THZA 2WHPB 2WUDA 3OIUA 1FQJA 1GEGA 1Y9EA 1S2LA 2AMVA 3ORRA 4JVSB 4X44A 2DFTA 3ONVA 5IN4A 1FDIA 3AEKA 3NV9A 4JLOA 1JS1X 5AKZA 4D74A 1E6WA 1EK1A 1RYFA 2J46A 1VSBA 4QOEA 3HU3A 3PFHA 1B6GA 2O1EA 3CZQA 2AG0A 3LF2A 2Y4NA 5BSTA 2C59A 5TVGA 3I73A 4YT4A 1GRNA 1CULC 1WNTA 4XCQA 3C5VA 4IM7A 4V0RA 3TWOA 3BB4A 4N8SA 4CLOA 5FI5A 2CK3A 5JMOA 4LF6B 4KE9A 1SB9A 4AICA 3LSTA 3CLSD 3THWA 3BZWA 4MAAA 4QU0A 4E03A 1Z0SA 3CH4B 1YDWA 1M2KA 2A0UA 3DMRA 3WGUA 2VO1A 2WF8A 3LPMA 3HYRA 3OIGA 3MTQA 1OB2A 4TN5A 1D7AA 4Q4AA 5BQFA 3Q8MA 1GTL1 1DC7A 2R97A 4F04A 5E3JA 3WJ2A 3FJYA 4BAGA 1YVEI 1IRXA 3MJHA 9LDTA 3LXRA 3VR3D 2Q1UA 2Z1DA 2C3OA 1EJ0A 3K2IA 4E7OA 5ITZA 1QGAA 1SUAA 2IKQA 5JCJD 1ZL0A 2VP5A 3ICOA 2YCLA 1ZICA 1QE5A 5REQA 4II2A 4Y2HA 1GTRA 1D6MA 2PJUA 1XMPA 3C3KA 4UDXX 2GD6A 4BMZA 3RJ9A 1T5BA 4OL9A 3MEQA 2GPBA 1ECPA 5TB5A 1ESCA 3DE5X 3ORHA 1Q3HA 2O50A 3IKJA 2CXUA 3TQQA 3AKYA 2C2XA 1PWHA 2WBLC 4GKAA 1AKWA 4IRMA 4UVIA 4BXOA 1OBHA 3E9EA 3GNQA 1F8UA 4QFMA 4BNLA 3ES9A 3D5TA 5JXHA 2DFPA 3HKCB 3PKZA 3Q15C 3BTOA 2O3SA 1SRRA 1Z6ZA 4KBGA 2CMHA 4MPRA 3LCVB 3QV2A 3TO5A 2XSZD 5AI6A 3V4FA 4E94A 2J0UA 1QPBA 1L4NA 1IXSB 1LPMA 1B43A 2I6GA 3AVOA 2GHIA 2VYCA 1ZOLA 3GRVA 3GVPA 3PC6A 1C4WA 4NF2A 4RHTA 4F6RB 1IBLB 4J75A 4C43A 3IAHA 1WDKA 5GY7A 5A1JA 3KLOA 4P3PA 3G59A 3ZWXA 1E2HA 4Q9AA 2O8CB 3K8YA 4NCKA 4Q1EA 4I1VA 1FNBA 2HO4A 4RY9A 2GBGA 4LVOA 4A23A 3KSBC 3GRPA 4P8RA 1TUGA 2RHGB 3U9TA 3TGLA 5CK5A 3I42A 4ND8A 5EE3A 4CM3A 5JHHB 3BS4A 4YXFA 4UD6A 3NRBA 3IUNA 3JAWB 4RQBA 2BTQA 3UAWA 1VKNA 3RUIA 1SXJD 4R8RA 2HXSA 1UT8A 4UD2A 3W4KA 3F73A 1C9MA 4GS5A 2P6OA 2WABA 2Y76A 4CPDA 1YACA 2GH1A 4AI6A 2NSDA 3CF0A 1AXGA 3MT0A 2OFXA 3OZCA 2D5CA 1CG6A 2AUNA 4KQEA 4XFJA 3A28A 4YCBA 3P8ZA 4CMKA 3PQFA 4J2TA 2QPLA 1KEZA 2X15A 1JQKA 3CVUA 5DBOA 1T9CA 1VMIA 1T4GA 1WU7A 2B1GA 1JDPA 2C99A 3R3JA 4PR3A <