4EQ6A

The crystal structure of psy3-csm2 complex from budding yeast
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
213
structure length
192
Chain Sequence
MEYEDLELITIWPSPTKNKLCQFIKQNLSKEHVVTQLFFIDATSSFPLSQFQKLVPPTLPENVRIYENIRINTCLDLEELSAITVKLLQILSMNKINAQEPLKIILYINGLEVMFRNSQFKSSPQRSHELLRDTLLKLRVMGNDENENASIRTLLEFPKEQLLDYYLKKNRIKNGDSLAEYIWKYYADSLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and SAXS analysis of the budding yeast SHU-complex proteins
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords Chromosome segregation in meiosis protein 2
total genus 74
structure length 192
sequence length 213
ec nomenclature
pdb deposition date 2012-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16834 CSM2 Shu complex component Csm2, DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4eq6A00
1ZVQA 4U5XA 2G1KA 4XWAA 3SYNA 4B6EA 2B7CA 3EG5A 3MD0A 5P21A 2VQSA 3QSYA 2C04A 2VSXA 2WJHA 3EZ6A 4ZI2A 5KPJA 2IYZA 2OM2A 1RPZA 4GDFA 2C9OA 2FH5B 3X1XA 3KFXA 3QKRA 4LBYA 1ESNA 3W5IA 4DIEA 5JCZA 2F43A 2FZ4A 4MKIA 2BDTA 2C9CA 2FG5A 2H57A 3CNOA 5FL7A 1Q21A 3DZ8A 1VYVA 1RJ9B 3WNBA 3PUWA 4GZLA 4HDCA 3KUDA 4OL0A 3GJ5A 3LY5A 2A5DA 4NCNA 4IKEA 4DCNA 5FBLB 3BS4A 3T06B 3EIQA 1XEWX 4B32A 4BLOA 2RCNA 5HPYB 2YOGA 4IFBA 2W6ID 1ZNWA 3TLXA 2YOHA 2ZJOA 3WYFA 1D9XA 4LJ4A 5EE5B 1PLJA 4K81B 1N25A 1CJUC 4QHTA 1G21E 2CL0X 3IILA 4PQYA 4KITB 3I8XA 4QJ5A 1E69A 2HCJB 2YWFA 2ZRGA 3Q72A 4V0LA 1SKYB 5HCIA 4GOKA 3O8RA 1KK1A 1Z63A 4OHXA 3W90A 3U6KA 3QBTA 4HAWA 3UIEA 3AEZA 3GD7A 4P4TA 3MFYA 1R8QA 1AQYA 1A1VA 4A0FA 4B43A 1KKMA 2FPKA 2IEYA 1I2MA 2QMOA 2WOJA 4KLZA 4A8JC 1NLYA 2CNWA 3DO6A 1QZXA 3FHTA 3C5HA 3IIMA 4UXHA 2BBSA 1D2NA 1T3LA 1WDTA 4DSUA 5J4YA 1XPUA 1G5PA 1G8FA 1OIWA 1MO3A 3BIFA 4H1UA 1HEIA 3UKDA 3BERA 4WIAA 2J7PD 4HUQA 3X1YA 2A7QA 1NMXA 3EA5A 4D4KA 1Z6YA 4X8OA 5FBVB 4B3DA 3ZIAD 4GMDA 4PFSA 3RS5A 3B60A 1DTSA 1LS1A 2WOOA 4KBFA 4M9QA 4GFDA 2O0HA 3K0FB 3JVVA 1OPXA 2DBYA 3KKPA 3QIAA 4Q4LA 5JJKA 1P2SA 2WM9B 4TMVA 3BB3A 4P3YA 5CK5A 2D7CA 4AG6A 4YMVA 1HT2E 3CWQA 2OBNA 3PQCA 3WMFA 3D3QA 3M1IA 1VKJA 2OSBA 5E7IA 4QJ3A 2OG2A 3HPRA 1FL9A 2CHQA 2ZU0C 4NONA 2Z4RA 4ZO4A 5JRJA 4MUAA 5DI3B 4Q03A 1KK2A 1G8PA 3BFXA 3HPQA 2QI9C 4G5QA 5AUPB 1E2NA 1N2CE 1OYWA 4BUJA 3B1ZA 5TV2A 4MGIR 4LOAA 1SKYE 2OCPA 2PZGA 1JR3A 1CF4A 3SJZA 3DMDA 5C4GB 4QM7A 3A1UA 2VHQA 2ONKA 5CJ2A 1JR3D 2CCKA 3ADKA 4Q1FA 2VLIA 2WSMA 4R2HA 2GKSA 4PC1A 4QM6A 3TK1A 2WWYA 3DZDA 3QKTA 4NCHA 1CR4A 4OYHA 4UKDA 2OHFA 4AKIA 3EW9A 3DPUA 1COWA 3LBNA 2W6IA 3GQBA 4Z8XA 1E9DA 2IYQA 5GJCA 1Q3TA 4FCVA 4NP6A 1BMFD 4KBGA 2KBFA 1TQ6A 2XNDA 4LGMA 4LJ8A 1Z5ZA 4A9AA 3LW8A 3D31A 3ND9A 4M9XA 2GVDC 1KSJA 1RC8A 2ZE7A 4UNRA 1KY2A 2FU5C 3B78A 5AUOB 1XMIA 4BFTA 3ZS9A 1OH5A 1R5BA 3D7MA 4NE2A 2QQ0A 3BOSA 4ZDJA 4BECA 2QAGB 3LA6A 2XZPA 1ZUHA 2C5LA 3B1WA 3A1WA 1UF9A 4MKGA 3PUZA 4HLUA 3CZQA 4CEIB 2ZPTX 3SHFA 3GFPA 1XTSA 2E1RA 2A5GA 2ZSEA 1E9CA 3N5CA 1G6HA 1G4AE 4IDHA 3CF6R 5AR1A 3W3ZB 4Q1AA 3NWJA 4B73A 3MCAA 2J0VA 2QTFA 2ZYWX 2QUZA 1Q1BA 3CH5A 4B2IA 1CR2A 2Q3HA 2JLVA 1ZRHA 5CM8B 2ZRDA 3RSLA 3WNDA 3OAAD 3K0CA 3NBXX 4DEYA 2FGKA 3DVLA 1SXJA 2V4ZA 5JHGB 3VMFA 1N5JA 2IYVA 3BD9A 1CKEA 1W36C 1TX4B 4UNNA 4LHWA 1COWD 2GJ8A 3TR5A 2IUSA 3EX7C 4V0ME 1X1SA 3RYTC 3TJZA 3GMTA 4LX0A 4ABYA 2MSCB 3CO5A 3KQNA 2FFAA 2JEOA 1OSNA 5AJVB 3U4QB 2C95A 2GXUA 4OKSA 3SFZA 3SS8A 5FH9A 3KL4A 3QXCA 4MRNA 4CF7A 4TZ6A 2CHGA 1XFAA 5IK2A 4IHQA 2GRJA 3BC1A 4BFWA 3UATA 3EZ7A 4B71A 4UXIA 4YMSA 1RFLA 4ZDWA 5L3VA 3WYGA 2JLXA 5ELXA 1FUUA 3H4MA 4R98A 1XXHE 3HU1A 1FFHA 3SDZA 5ANRB 1RW4A 2B6HA 5EE1A 1E79D 2AK2A 1CRPA 4M4SA 3T35A 2JIZD 1NVWQ 2EU8A 1OXUA 2ZEJA 3T12A 5L3QB 1WBBA 2BHRA 5BN5A 2IS6A 4X8LA 1OHHD 3Q5EA 2OLKA 4IXNA 4W5JA 5B2ZA 2ORWA 3K9HA 4MRVA 3RWMB 2NZJA 3L0OA 2QENA 5HCNA 4DT1A 4AKEA 1N0UA 1BMFA 4PO9A 3MG9A 2QSZA 3KZ1E 1HTWA 3L2OB 2NO0A 3GLHA 1SXJC 4PSKA 2J7PA 1IHUA 1MO5A 2Z83A 2BMEA 4ZCMA 4Q9IA 2CK3A 2J46A 4G5OA 4LI0A 1AZTA 3EC1A 2AR7A 4XJXA 4FWIB 1UEJA 2P3SA 2XNDD 4D0GA 5FBQB 3P27A 2VP9A 5D3MA 4ARZA 4D4LA 1OH8A 2HF8A 4NYJQ 4AG5A 5LBIA 4KFSA 1GG2A 1HT1E 3IPYA 1S1MA 1GTVA 4LHZA 4PQRA 1MO4A 5DYIA 2YKGA 1VMAA 1UKVY 1J90A 4LWZA 3SEAA 1XNJA 3UMFA 3WBJA 2J1LA 1BYUA 3L0PA 2BOVA 2VO1A 1E98A 4QBHA 1W47A 2IYWA 4XD7D 4DSNA 1U8AA 4ZDIA 1GDDA 2R6GA 4PANA 1WCV1 3BB1A 2VSFA 3M4YA 5B30A 4KCGA 3I62A 2OEPA 2A5YB 3VX3A 3RC8A 4GSYA 4DBLC 1AGRA 4IEIA 5BQ5A 5J4LA 3A8TA 3GLIE 4TQ9A 1VHLA 3AF2A 2G1JA 1UBCA 3TSOA 4WXRA 2JA1A 1KO5A 1D6JA 1R7RA 2WZQA 2LKCA 3FHCB 3LXRA 2CJWB 2CDNA 1W49A 2FEMA 1AQUA 4JVNA 4US0R 3RLFA 2DHRA 1IONA 4MGKR 4M2LA 3P4YA 1TEXA 4JLBA 4ZCIA 4HZUA 1S9DA 3QQ5A 5AWFC 3GJ8A 3TH5A 1US8B 4DB4A 3BFKA 3K53A 1AIPA 2WJYA 2XB4A 2YNMA 3ECCA 3DKPA 5JSZB 4NKRA 3UPUA 4G1UC 3I5XA 1NLFA 2GJ9A 4HZIA 2FSHA 5CLQA 3O47A 5KPDA 1LS6A 2FDCA 3MJRA 3QVUA 3AVVA 3WRYC 4MYUA 3CZPA 2WAYA 1N6KA 2ZI5A 1E79A 1U98A 2FF7A 4LBWA 1GRQA 2ZVPX 4IXMA 1SVIA 1S0UA 3R9XA 1OB2A 1HE1C 4W5HA 4XVQA 4AY2A 4LPKA 3KX2A 3AVUA 3LXXA 2VHJA 2P2LA 3IIKA 3CONA 4A0HA 3AH8A 4QHSA 4JJZA 4DC9A 3AB3A 3FWYA 1P9WA 3EC2A 3PR1A 2IUTA 3ZZUA 4EQ6B 1TADA 1V5WA 1T6NA 2RMKA 3RS0A 4KYIB 3NBYC 4KSBA 1OH6A 3P4XA 1P7CA 4H9GA 4LC0A 1R4AA 4TMZA 3HDTA 4M9ZA 1CR1A 4LUCA 2XJ4A 5GJWC 5A4JA 2ASEA 2XZLA 3OEHA 4U02A 1GKUB 3ZVMA 2IYRA 1G3MA 3LAWA 3CH4B 4Q4AB 4BZXA 1G5TA 2RB4A 1RRPA 4RD3A 5B64A 4C2UA 3P20A 2O5VA 1G18A 2ZVQX 3B7GA 3EZ9A 2A3RA 4FN5A 2HEIA 2R9VA 1DELA 2HDNB 2WVJA 5LB2A 5J4HA 1JPJA 1KAGA 3VR4A 4F4JA 1UDXA 1XJQA 1RVDA 3MRSA 2OT3B 4Q9HA 4AC9A 2DWPA 1E1QA 1XTJA 1VTKA 1PUJA 2REOA 1RE0A 3C4JA 1JEDA 4DLZA 3FFBA 4QNRA 1DAMA 1KJWA 3CWZA 5IDVA 3N2EA 4C4PA 1C9KA 3ZJYA 2FE4A 1HV8A 1F5NA 3J81k 2PBRA 4O2RA 4HLCA 4I1UA 1TF2A 3U3OA 2GETA 3K70C 3I8SA 3N2IA 4TMTA 2O8CB 3CPHA 4B2PA 2ZJ2A 3SYLA 1WBDA 4TLDA 4HB4A 3ICQB 2BCGY 1GKYA 3I72A 5LPNA 3C5CA 5FTKA 5SZHB 2ZYTX 2NZ8A 4GPTA 2W0MA 4M1TA 1KI9A 1PLLA 3T61A 4IDNA 2FNAA 4XSGA 3QXSA 3LLMA 1G8HA 4Q5IA 3IO5A 1YRBA 1U9IA 3A37A 3H1TA 4HUQB 1TU4A 4YMWA 5BN4A 1DAEA 1OIXA 3AUXA 3PITA 1IN4A 1IOZA 1TUIA 3IGFA 2ZRMA 5HKKD 2WKPA 2NO1A 4URZR 3U7FB 3U44B 2J3EA 4URUR 2C8VA 1ZW6A 3WHLA 4DLSA 1LY1A 2R6FA 2W58A 3AKYA 1J7KA 3AF4A 1GP2A 2HT6A 3WRXC 5DNYB 4TT3A 3AVYA 1QF9A 1Q1ZA 5EE9A 4DUGD 3THWB 4Q66C 3VNUA 1U0HC 1EK0A 5G3YA 1F6BA 2PLRA 4LHXA 4HB2A 2X8AA 4NYJR 3X1WA 1KO1A 5F2EA 4ACAA 3T15A 4M9SA 4FMDB 5JEEA 2O8CA 2ERYA 1Y63A 3VR3A 1D2MA 1XBTA 4KSCA 2ZE5A 5JSZA 3SQWA 5EP1A 4JMPA 4M53A 3FHOA 3PUXA 3IEUA 4LHVA 3GLFB 221PA 2W2VA 2B8WA 2WHXA 4Q1BA 3MWKA 2DWOA 4YXWA 3GLIB 4HSEA 5G41A 1HQYE 3MGCA 3IHWA 4P0TA 3W6OA 5FL3A 5IRCD 4QHYA 4NHOA 3QPVA 1QHIA 1G291 3C41J 5KSZA 4EPRA 1DAIA 1XMSA 2G0NA 4DDUA 3EPLA 3TSWA 1LTQA 1D9ZA 1Z07A 1WE2A 4JKYA 4JT4A 2BBOA 3VU9A 4EAQA 5CIQA 3ZVLA 1CULC 2WJIA 2GA8A 1NMYA 3TQFA 2XGJA 4PAMA 5EZ6B 5FPKA 1WF3A 1XEXA 3X2SA 1EWRA 1OIVA 5SZKB 2BKUA 3MAAC 3SNHA 1SGWA 3M0EA 2XSZD 1ODFA 3NHBA 4DIDA 1YZGA 4YC7A 3CRQA 4EFNA 1Q22A 1GUAA 1U0JA 3AVQA 1G17A 1XEWY 4RCZA 1Z28A 1NG9A 2R8RA 4TLBA 1AM4D 2ZITA 4PHHA 1T3SA 2O8BB 1X3SA 1UADA 1FP6A 2XJ9A 2N1BA 2A30A 3BFVA 4AYXA 2VP6A 4BZQA 4DKXA 521PA 3H2YA 1XPRA 4JKIA 2Y8EA 4LJ6A 1E9RA 1DBSA 1NY5A 2JJ1A 4P4SB 2I1QA 4Q4HA 2WPDD 4NPHA 1NSTA 1T0HB 5FPHA 3F3YA 1Z29A 5KDLA 1NVVR 2OCYC 3FMIA 2IC5A 3GCGA 1JEEA 1Z6AA 3VR1A 2OCAA 3PVSA 1G7TA 4UJ3A 2DFLA 4TL9A 1ZJ6A 4HZUB 4FCTA 5J4VA 4CEHB 1YZTA 2QE7A 3FTQA 1KDOA 4EPWA 4ACBA 3U6BA 1C1YA 1Z0IA 3HYRA 2RGNA 2BJWA 3GLGA 1U0LA 2C99A 5BW8A 2CJWA 4YQFA 2GK6A 5GVSA 1W5TA 1W0JA 1ZNXA 1NN3A 1Z2AA 3C15C 1CLUA 4KJZA 4TL7A 3L8ZA 4KFTA 2W83A 2XTNA 2R6CA 4AK9A 2PCLA 1Z6XA 2WV9A 4TSFA 3CPJB 1VPLA 4CDGA 2GAOA 1MOZA 1PLKA 4MRSA 4B48A 3EZ2A 2EYQA 2W6JD 2QTVB 3TUIC 1G8YA 3RS4A 2D74A 4TMWA 3OEED 4DDWA 2VF8A 5BN3A 3EARA 5B57C 1IN7A 2AHOA 3G5UA 3AVXA 1DG3A 2A78A 4PXAA 4JLDA 1W0JD 2PJZA 2QZ4A 2O8EB 1IXSB 2XXAA 2J41A 4DCVA 2BC9A 4RD6A 1NJGA 1E9SA 4US2R 3QF4B 3CRVA 3KKMA 3LNCA 4IVRA 3CF0A 1GRNA 1WB9A 5TB5A 2DFKB 1NG1A 1OXTA 2EFGA 1R0XA 4IOLA 3A1VA 3OFNA 1ESMA 2AWNA 1G5RA 3FFAA 1OE0A 1P9NA 3R8CA 4KFRA 1U8YA 3K0AA 3QG1A 4PPGA 4M1KA 3LFUA 1YZUA 4MA4A 4OQXA 5HZKA 2AWOA 1UKEA 4B3FX 2GJSA 5C18A 1NRJB 3EWAA 3H84A 3VX4A 2YJTD 2ZETA 5K8TA 5KOYA 4JL6A 3THWA 2WSSA 4TMXA 3CM0A 1P75A 1S4QA 4B34A 2J5XA 1TPZA 3RRYA 2NPFA 1QHHA 4LJ7A 1D2EA 2PX0A 1GL6A 2WJJA 5EUMA 5L8VA 4XTRA 1EGAA 3R7WA 5K8IA 4Q9KA 4NH0A 1L7VC 5GVRA 4ZKDA 2O8FA 3S1AB 4RFSA 3RRNA 2RHMA 2BV3A 3UANA 5JWOA 1QG4A 2FPLA 1Q44A 1KOFA 3NC1C 4JBWA 4JT2A 1VYTA 2IEZA 3RDPA 2PJRA 1AGPA 3K9GA 1OT3A 2GTPA 3VFDA 4II7A 3FGNA 1XCMA 1Z83A 3P26A 1AS2A 2F6RA 2ZI4A 2EFHB 3V4FA 4E03A 2J7KA 2OFXA 5BYKA 5FTLA 1G3RA 4JZKA 1ZBDA 4S2EA 3THYA 1ZUNB 3KKOA 3B9PA 4LJYA 1M1YE 2OZEA 4P31A 4UQOA 3LW7A 4D2IA 3T34A 2QY9A 4QL3A 4UNSA 4WOPA 2YYZA 2IXEA 5F3WB 1M7GA 3AGQA 3KB2A 1PVOA 4UNPA 3Q5DA 1W1WA 5KSOA 2UZ3A 5FFMA 4Q00A 3UWOA 2I3BA 3THOA 3PENA 3L8YA 3AUYA 3VHXA 3C14C 5DLQC 2VP0A 1S3SA 1RKBA 1HE8B 1EFTA 1TAGA 1DOAA 1ZC4A 1U90A 3CRW1 4HLQB 4JVSB 3K9LA 1S2MA 5JRZA 2UKDA 1JR6A 2NOAA 3C8UA 2ZXUA 5TMPA 4DUGA 1XCGB 4A0RA 5CJPA 4QBIA 1BO6A 4RZ2A 1IM2A 1J8MF 3HU3A 3I1FA 4JL8A 4BFZA 2WWGA 3KQLA 2W2XA 1BOFA 1QBKC 4PPQA 3B9QA 4F93B 2P6UA 2ZYVX 4RFVA 3ZIAA 1WQ1R 1CIPA 3TE6A 2ZRFA 1NNEA 1GFIA 4LJAA 1E0SA 1FTSA 2X19A 1DARA 4HB0A 5LD2B 4FWTA 3DKVA 3EPHA 4AWXA 4IOJA 1KDRA 4LV5B 4RD1A 1II8B 3TVTA 2ERXA 2GEUA 3L0IB 1IQPA 1N5KA 3IKJA 1Y3AA 1ZCBA 1F2UB 2GJAA 1CP2A 4ZIRA 4AURA 3EIHA 1EFHA 3KFVA 5CITA 1XWIA 2O52A 2Q3MA 1XEXB 1M34E 2JASA 5TY0A 2I4IA 1EFUA 1LF0A 4R71A 1UJ2A 3FPAA 1S1CA 3VR6A 1ZM3A 5CDFE 3ZS8A 3DM5A 4B2LA 5CB6A 5J40A 6Q21A 1Z0FA 1PZNA 2FA9A 2WWFA 3KQHA 2O8DB 2XAUA 4J0QA 2JDID 4QGAA 2C77A 2G6BA 2G88A 1IN5A 2IXFA 4K46A 5DN6D 4IDPA 3QI2A 2H92A 3OIUA 3L0SA 3U4QA 4GT1A 1U8ZA 1J8YF 2WJGA 3KXKA 1F2TA 4I1OA 1W44A 3FOZA 1E1RA 4HI0E 2R6AA 4OHVA 1GILA 2ODWA 2W0SA 3UG7A 1BIFA 5FL7D 1XP8A 3SFVA 4EPXA 3A58B 2P5SA 1NBMD 3SU8A 1R10A 2NO9A 4QFMA 4WZ6A 3RHFA 1P72A 4C0KA 2ZJYA 2F3RA 2KJQA 5FUYA 2QP4A 3HWSA 1G1MA 1KMHB 1Z47A 1LVGA 4LK2A 2YV5A 3NBFA 3Q7PA 4XD7A 4EFMA 1QG2A 2ZM5A 2HXYA 3BH0A 3WMEA 1YZQA 4PAOA 4XH9B 1EFRA 3K70B 4PO1A 4XTCS 1F2UA 2IXGA 2Z4SA 2EWWA 4OHZA 1SVWA 1WMSA 1KI8A 1Z0AA 3RAPR 5FI0B 1T3HA 1ELOA 4G5RA 4XOIA 2VRWA 1YE8A 2JAQA 1RZ3A 2O0JA 3C16C 2Z0MA 4NCJA 4Z1MA 3UG6A 3U44A 1YU9A 3WBKA 1QVAA 1S8FA 3K0EA 1JAHA 4URWR 3DM9B 1SHKA 3LWNA 2WJVA 4PZYA 4RFSB 1GNQA 5C1BA 3IEVA 2RGAA 1JJ7A 1TTTA 5H68A 1DAGA 2VIIA 4DHEA 2QG6A 5DHFA 4FMCB 4F4IA 5DH9A 4D0NA 4OHWA 1AK2A 2P67A 3I61A 5EXPA 5FPYA 2V9PA 4BPBA 1JXOA 2ZREA 3F0TA 3NHAA 4IDOA 4RD0A 3ZZ0A 1T8UA 3IQWA 2YWHA 3NC0C 3QPWA 4Q48A 4EJSC 821PA 1XB2A 1P2UA 2HLDA 2R62A 1T4GA 2GEVA 2Z5FA 3PIRA 4RJLA 4NU0A 3SBEA 3BBPA 4G0NA 5GADl 1W2GA 2ZTSA 4DSTA 3V9PA 3I3SR 4HLDA 4Y0AA 4OI4A 1FMLA 1CJKC 5K8UA 2EFEB 1P9RA 1DS6A 5AK0A 4HDQB 1SQ5A 3FVQA 3TSZA 2G3YA 1L4YA 4QRHA 2AD1A 2EW1A 2H18A 4EUNA 2O8EA 3M6AA 4A6PA 4D82A 2AN9A 2I1VB 4AIIA 2A5JA 3PCRB 4Q4JA 3PEUA 4E22A 1T5LA 2WWWA 1FNMA 1UBFA 4K8OA 1NSFA 1OFIA 1G8GA 4C0QC 3ZLJA 2ZR7A 2CCJA 2EFDB 5DGXA 2ZRNA 5FBRB 2OV2A 5FTNA 4D4MA 4QGHA 1SVSA 1ZNZA 2QEQA 1GVNB 2LKDA 1W0KD 2VP4A 2ZRJA 1G7CA 2OILA 4QNMA 4TYYA 1ZM4A 1Z3IX 4OQLA 4AI6A 2ZAMA 4X8MA 1TF7A 621PA 1KI4A 2N42A 1IY0A 2XX3A 2QGZA 4TQUS 2NGRA 5AJWA 4MYTA 1M7HA 3QJYA 1E9AA 4I1VA 4PPNA 5J47A 2OCBA 2CXXA 5FI1B 3IDQA 1QHNA 2R65A 4PC7A 1E9BA 4O3MA 2Q21A 2ZUBA 3FKSA 1XEFA 1ANKA 4F38A 2BEKA 2WAXA 1DVRA 3QY0A 5KYKA 4HAYA 2YC4C 3WP1B 3BORA 4PPFA 2ZSDA 1K5DA 5BYJA 3TAHA 3QKRB 2IS4A 2FOLA 4GMXA 4DLYA 4QGGA 3SZRA 3U3MA 4EDHA 5JZVA 3AP1A 1CJVC 2D2EA 3KXLA 3SJAA 4UNQA 2AKYA 2KSQA 4LYHA 1P73A 2K5UA 2CHVA 3LD9A 4L16A 2QL6A 1YR7A 4GOXA 1W36D 1TEVA 1ZUIA 1DAKA 2R6DA 3L82B 5KDOA 1MR3F 2C78A 2RGNC 2ZRPA 3QBVA 3BH6A 4H1VA 4S35A 3QXJA 1X8LA 2Q9CA 1OKKA 4LDJA 3ZDQA 2ODNA 3GJ0A 5L3RA 4HAUA 4ZV4A 1ZU5A 1GKIA 3EIEA 1G4UR 1V43A 1IY2A 5FOVA 1E2LA 4RSGA 2VTKA 3F5FA 1JPNA 1KI6B 3PXGA 3A4MA 5LDDC 1AKEA 2UVQA 1Z0DA 2BEJA 4Q1DA 3SQXA 3E2IA 2PX3A 4NBSA 1B0UA 1YKSA 1M74A 4WZBE 5FOTA 1JALA 2IYUA 1W4AA 2QT1A 4CIDA 3FDIA 4M22A 4F92B 4NMMA 2XB2A 2V7QD 1GNRA 2RGDA 2QPTA 3B82A 5DIFA 2FWRA 3OEEA 3G0HA 5DISB 2VHTA 1XD9A 2JJ2A 2R44A 2JLRA 2PZEA 4MYCA 2IYTA 1X6VA 2KI5A 2WKQA 5D3QA 3SHWA 1M8PA 2JATA 3DHWC 3CB4A 3EAQA 4PC6A 4Q1EA 5FTMA 1YR8A 1GITA 3GEEA 3TQCA 1G3IA 2V6JA 1M6NA 2OAQ1 1NKSA 5JLJA 3CX8A 3QXHA 2A2ZA 3H86A 1R8SA 1XJ0A 1NBMA 1G3UA 3OHMA 4JLKA 5JJIA 4CRWB 2D2FA 1LFDB 3P32A 1N6LA 4JBYA 3BGWA 2IS1A 3PG5A 1YHNA 3RRZA 5E7JA 4KODA 5JS7A 4OQMA 2TMKA 3QKSA 4JLMA 2GCOB 3MWJA 1TQ2A 2J9RA 3QKUA 4IOKA 4Q9JA 1E9EA 4EPTA 1ZCAA 4M8NE 1VG0B 3N70A 2JJ1D 2VA8A 3SBDA 3UWKA 3KKNA 3OIVA 4DB2A 5JJLA 3PUYA 1R5NA 4Q7LA 4HAXA 4JVMA 1UDWA 3VTKA 5IF9A 4G5SA 2BKEA 2RGEA 4KLNA 1P3JA 3HR7A 3NXSA 4Z51A 3NVAA 5L3QA 5KHOC 3AKEA 2HF9A 3THXB 2WWIA 1I4TD 1VG9B 4LV6A 1OW3B 1N0VC 1U99A 1E2JA 1E2MA 1OXXK 3EXAA 4FMCF 4Q18A 1VHTA 5DYGA 1W46A 3GFTA 1XTRA 2ANCA 2ORIA 3NG1A 4TYQA 1VIYA 3MSXA 3RC3A 3KQUA 4V03A 3CNNA 2BWJA 3KB1A 1JAIA 2JLSA 3QNUA 3LBIA 2J59A 3TGPA 2ONJA 1Z2CA 2B92A 3B2EA 4PHGA 3FE2A 5FOUA 4C3ZA 2W2TA 5L3SB 5E95A 1P2VA 1II0A 2P6NA 2CVFA 5HE8A 1A5TA 2N46A 2OBLA 5E3HA 2DY1A 4YXWD 2AL7A 1IXRC 1J99A 4M1MA 4JBXA 1NBME 2H17A 4OQFA 1U2RA 4ZPXA 2Z43A 3L43A 4A4DA 1R0WA 2QP9X 4EJSA 5JMTA 1RJ9A 2IYYA 4Q4AA 1ZD1A 3O8BA 3U7GA 1H65A 2AX4A 4OK6A 3LLUA 1HH4A 4L5BA 4US1R 1PJRA 4DLRA 2GNOA 3AVTA 1SXJB 5EP3A 2RGXA 2BIFA 4JSYA 4PZZA 4ILEA 5FPSA 5C46F 4L4UA 2BMDA 2QP3A 5AJZA 1GNPA 1NVUQ 4NTZA 4PC2A 3K70D 3MWYW 3GPLA 1II8A 1SVKA 1FP7A 2CMKA 1GL7A 4AYWA 1Z22A 2ECKA 5TDHA 2J45A 2QROA 2WPDA 5TXGA 5EP4A 2GILA 4LC1A 5H1YA 3W8NA 4EQ6A 4F4CA 4CEIA 2F1RA 2ZROA 3Q85A 4PX9A 1WXQA 4Q4HB 1UKZA 2JIZA 4M0LA 2E9SA 2L0XA 4CEJB 2G77B 3B1XA 2F3TA 2IYLD 3MUFA 3SOPA 1KJYA 3BAFA 2ZI3A 2WICA 4AKGA 4MGYR 4L9WA 3NEYA 2OESA 4OHYA 4A2WA 2O8BA 3LDAA 3AV0B 4KI0A 2ZJ8A 1L2TA 2PLFA 2OBMA 2ZRKA 2C96A 2NMVA 2ZSFA 3B85A 3LQQA 4Z8YA 4XWKA 1GWNA 4GP7A 2OXRA 1KI7A 3IHLA 5A0FA 3RSOA 2ATXA 5EP2A 2IUUA 2REBA 3KUCA 1C4OA 1IN8A 1Z06A 3OESA 4JLJA 4QBGB 4R7ZA 1IY1A 4FW9A 1FPMA 1G7RA 1E2GA 2GESA 1KI1A 4IVQA 1XRJA 2VH5R 1G9XA 4N3NA 4D81A 4QC2A 2DFTA 2FEOA 3SR0A 1MT0A 1X8JA 2MMCA 2ZRCA 2B8TA 4Q21A 4NYIR 4A8JA 4ZI3A 1VDZA 1E6CA 1F48A 5EXSA 2QGNA 2XEXA 4MQBA 1DAFA 4JJKA 1CU1A 3R20A 4A2QA 2QT0A 1OF1A 4BZPA 3U60B 1IN6A 2LCFA 1E2QA 1IAQA 4BLTA 2Z6VA 2VHUA 4BFYA 3CR7A 3TVDA 5KDDA 3ZD6A 4DLUA 4XVRA 1X1RA 5L3SA 1J70A 4WZAE 5FR2A 1II9A 2IW3A 4ZKEA 1H8HA 4A82A 2NO6A 4XSHA 2PZFA 1VYUA 2ZS9A 2KBEA 2WWHA 2ZRBA 4FD2A 4D6PA 1KK0A 3R9WA 2FZLA 1SXJD 2JGNA 1T91A 3AVPA 4LPSA 2GXSA 1WP9A 4DEXA 4GI7A 2NG1A 5CYPA 1H8EA 1E0KA 4KYUA 4C0JA 2CLCX 3REFA 3QF7A 3ZQJA 1VCMA 2VHCA 3VKHA 1XMVA 3K09C 5D3MB 2P65A 2OLJA 2GWHA 3GLHB 1JXMA 1IJFA 1XX6A 2ZSBA 5UKDA 1JJVA 1OV4A 2ZAOA 1JNYA 3TRFA 1P60A 4DCSA 1XPOA 2ORVA 1KAOA 4RZXA 1GAJA 5JEDA 1P5ZB 4MYHA 2IWRA 2ZI6A 5G40A 2OFOA 3G82C 3LX8A 1EFCA 3GLHE 2V54A 1XD8A 5KO2A 3FYHA 4OI0A 1QDEA 3UMSA 2YOFA 2KWIA 3OZXA 1I4LD 3EZFA 2AFIE 4B3GA 4MITA 4TTRA 4WVFA 1RYHA 1ETUA 3R8FA 3A1SA 1P6XA 1OB5A 4W5WA 3I32A 4C0SA 1VG1A 1D8TA 2WKRA 1A2BA 3LQRA 1K8RA 2RAPA 2ZANA 4NYMQ 1NVXQ 1EX7A 1X8KA 4GRAA 4I1SA 4NYMR 2IX3A 3FKQA 5H70A 3LO5A 2X1VA 3X1DA 2A9KA 1IBRA 1YQTA 1ZAKA 4M1YA 2C98A 4QG7A 5DI9A 4JLVA 5KSYA 3D6TB 2IF2A 2X77A 3LVRE 1R5OA 2CEAA 5F98A 2QRZA 1SVMA 1KO7A 2GXAA 2H5EA 2JJ2D 2ZIAA 4V0OA 3ETLA 1E4VA 4HDOB 1CS4C 1A2KC 4W7SA 3C7KA 1KMHA 3KQKA 3BRWD 3GLIA 3DEFA 4IW3B 1Z08A 2VYFA 3DOEA 4B33A 4A2PA 4MRRA 2FPMA 2QA5A 2VP2A 2QRNA 5F9HA 2YINC 2Q9BA 3WMGA 4BLQA 3Q8XB 4XWOA 1KI3A 2QQEA 3DMNA 4C0HA 1AKYA 3QVVA 1KHTA 4WBSA 1A7JA 2F1HA 1HY3A 1M7BA 1TQ4A 3BE4A 3GLFE 1PV4A 4F91B 2C2HA 3GEIA 1SULA 1F3OA 2DPXA 3NH9A 1VCNA 4BRUA 4MKHA 4FIDA 1O3YA 1UM8A 1ZD9A 4BLPA 5FUXA 4L9SA 4QJ4A 3FMPB 4R2IA 4JIMA 4M21A 1W2HA 3W6NA 3SC3A 2HV8A 4L8GA 4AD8A 4I99A 2YWEA 1XD2B 1Q1EA 3A4LA 3HR8A 3EPJA 1CEEA 4BQSA 3IO3A 4ON9A 2DR3A 4ZIRB 2RKOA 2X2FA 2EQBA 5J5CA 2FGJA 1TNDA 4Z1MD 3RANA 3T1OA 4B74A 4G3XA 4A1FA 5HR5A 1NLZA 3AKDA 2VSOA 4BLSA 4C0AC 4W9MC 4DCTA 1Q0UA 1US8A 1XZQA 2BCJQ 2FX3A 2YVUA 2D3WA 2OE2A 3B1YA 4G01B 2FSIA 1FUKA 2IHBA 4C0LA 3KJHA 1VIAA 3CUEF 1DO2A 3ZGXA 2C03A 3OIWA 1OFTA 2OUKA 3KJIA 4QGFA 2PH1A 2QAGC 4PR0A 1P4SA 2W00A 4YDHB 4URYR 1H8ED 1I4DD 2IBMA 3EA0A 3QOFA 5E7MA 2B7BA 1QRAA 4D4JA 2CL6X 5KUTA 1JR3E 4BFXA 1RRCA 1OJLA 1QHSA 4BFUA 2BMFA 2VBCA 1RIFA 1E1RD 5EZ5A 4P32A 3KTAA 1OYYA 2QTHA 1UKYA 3U3RA 4CT5A 3W9YA 2ZRAA 3LX5A 4TL6A 3RS7A 2JLYA 1FW6A 3LVQE 2O0KA 5SZJA 3OE7A 4NCIA 1VCIA 1YZKA 3PJRA 2REXB 2ATVA 3ASYA 2F7SA 4LV8B 3CNLA 3IIJA 3K0SA 4ZCLA 3NTUA 2QM7A 3QXXA 1UEIA 3AKCA 1G64A 2ZI9A 1N6OA 1GOTA 2ZS7A 5CIWA 1XU4A 3BH7A 5DO9A 3CKLA 5KNBA 3PUVA 3T1TA 5JWHA 4ARZB 3U5ZB 3THYB 5J4KA 2DYKA 1YVDA 2QPOA 3CW2A 2HLDD 3H0KA 5DI3A 2O8FB 1JI0A 1KO8A 4IDQA 4KXFB 3U3JA 3CBQA 1Q3HA 4B6FA 3ASZA 5G53C 2D4HA 4V02A 5EQTA 3QG5A 3LH5A 2H7VA 1UBEA 5HKKA 4Q19A 2NIPA 1D5CA 4DZZA 4CT4B 5GJBA 2FN4A 4N1AA 1S96A 4KVGA 1KDTA 1NIJA 2PCJA 2GVZC 4BFSA 1FMJA 1DO0A 3TR0A 3OEHD 3S1AA 2OXCA 2C9YA 3K0FA 2Q0HA 1CBUA 4D80A 1CJMA 3QE0A 2XZOA 1Z6GA 3AF0A 4POAA 4YLGA 2ZQ5A 4A36A 5FOSA 3ZYCA 5CB8A 3PFIA 1U94A 2QSYA 4RCYA 1DE0A 4Q02A 3B8HA 2ZS8A 3RWOA 1XF9A 2WMOB 2RGGA 1UBGA 1N6NA 5G3ZA 1LW7A 5IK2D 2BVNA 4PTLA 4E09A 3SN6A 4HAVA 5HTKA 1Z8FA 1UFQA 4ITRC 3P1JA 4ESVA 4OJKA 1T9HA 1MV5A 3F8TA 4PSAA 2NO7A 3GJ6A 2ZJZA 2ZSAA 4CVNA 4PZLA 4A6XA 4MDFA 2NTYC 2F1IA 1N5LA 3U61B 1W4CA 1G19A 1QHXA 4HUTA 1FNNA 1U9IC 1OXSC 3I73A 1AA9A 1KK3A 1HURA 1T5IA 4TLEA 5DHAA 4BASA 3O8CA 4RKFA 3I5YA 1XTQA 2V1XA 3ZZTA 3TUZC 2BM0A 2B21A 3WP0A 1BH2A 4MRPA 1NJFA 2AXNA 1CTQA 3SE0A 5BWMA 3K1JA 5FR1A 4M1WA 3ZH9B 4P4UA 1N6HA 1Z0KA 2Q6TA 2GZAA 3W34A 2AKAB 1Q1QA 5BXQC 5A5GA 1ZM2A 4NL4H 2CE2X 4TYNA 2XTZA 4TTQA 2D62A 2ZU6A 3FB4A 2ANBA 5EE0A 5H8WA 3PEVA 4XVUA 5KSPA 3WXMA 1X86B 1OXVA 1E0JA 4MH0R 3NKVA 1HUQA 3R7WB 2VPPA 3TIFA 2H1LA 4URXR 4LJ5A 1P61B 1E2DA 3K0CC 4U7DA 4RZ3A 5FBWB 2GAAA 1QHYA 4HEJA 1LF5A 4I81A 1MABB 721PA 4DVGA 1A82A 1YJ5A 2XOKD 5CM9C 3VR2A 4B44A 1E2KA 4WW0A 2CLSA 3CX7A 4KFUA 4ERNA 3SJBA 4BEJA 4TL8A 2MSDB 3T5DA 1QHGA 2H16A 2V6IA 3RRMA 2YC2C 2GHIA 3I92A 3GJ4A 4M1SA 4CYMA 1XD2A 3CIOA 1E2EA 2GJKA 2WBLC 4HATA 3TW4A 1LV7A 1SZPA 4TYWA 2PL3A 1I2DA 1P2TA 1YRAA 4QXAA 1CR0A 2FFQA 4B3XA 4F7WA 5KNCA 1XDBA 2FFBA 2J0QA 2Q9AA 3GFOA 4OBEA 1JB1A 4LY6A 4E5UA 2QMEA 2VL7A 4FMDF 4O2LA 5HE9A 2JLQA 2VF7A 4DJTA 1RRGA 1BKDR 3NEJA 1E2IA 4Q01A 1XZPA 4Q47A 4DLXA 1A4RA 2ODEA 3PV0A 4MKFA 3UXMA 3UMRA 4LYJA 2V3CC 1W0KA 1MKYA 5FTJA 4BEBA 3W3AA 1WRBA 4HB3A 3VU9B 1TQDA 1BYIA 2HUPA 3RNLA 4D25A 2VP5A 4IVPA 4V0NA 3A36A 1FQKA 421PA 3OF5A 4TWZA 4KU4A 1PUIA 4Q4JB 1YZLA 1R6BX 3Q3JB 4JL5A 2RGBA 3MLEA 1F2TB 4TQAA 5EUQB 1E0AA 2J87A 2O8DA 2HJGA 3VR5A 3A4NA 5JI3E 3B6EA 4LHYA 4AYTA 2ZJAA 3KTAB 4B3BA 4JLOA 2EYUA 1AN0A 5C2JB 3TKLA 3JZMA 3WHKA 3MMPA 3A6PC 1VG8A 4EKDA 2W6JA 4X8HA 2JLUA 3OAAA 3BWDD 3JZAA 2GEDA 4TYPA 5DN6A 2PEZA 2ZJBA 3KJEA 3T5GA 4C2TA 1W7AA 1E32A 1SVOA 1XJCA 4PHFA 1TUEA 5KU1A 2F55A 4B47A 4N0EA 1UPTA 1L4UA 3GJXC 3SYKA 5KNDA 2QPAA 4LBVA 4C7OA 3GLFA 2MMGA 2XITA 2QBYB 2GZDA 4V0KA 3NDPA 5LB4A 3GJ3A 1SVLA 1OKKD 1KSFX 1ZMXA 1R0ZA 1T0JB 3OFND 1NIPA 4LYFA 4DT1B 1DG1G 2WSSD 1FQJA 5JBQA 1YR9A 1OFHA 2G0TA 2LWIA 3IPXA 1GIAA 4B35A 4GP6A 3HYTA 1E2PA 1E4YA 3CR8A 5EJEA 2ODBA 4MUBA 4Q9LA 4EPYA 2ZRLA 3QF4A 1YZNA 1MH1A 2IF0A 2ZI7A 4YDSA 3DOFA 1Z0JA 4P33A 1GL9B 2H8KA 3OE7D 1E96A 1TF5A 4HYYA 1NY6A 2GF9A 3MWLA 4BWYA 1ZM7A 4YONB 1SKQA 2ZR9A 3CPEA 1R2QA 1YR6A 3TMKA 4N0DA 1U81A 4NCKA 1NN0A 2OAP1 1HA3A 1M2OB 1NF3A 2FMXA 4XIGS 4D0LB 4DSOA 1EXMA 1KKLA 2IA5A 3QEJA 2P6RA 4BGDA 1DEKA 1F60A 2GF0A 4JLAA 2JDIA 3FMFA 4A8JB 4TSFD 1OH7A 3SJCA 4Z54A 4TN1A 3AVOA 3DDCA 1G7SA 2GCPA 1G20E 4JLNA 1Q20A 3VQTA 2ZYUX 4C0BA 1QHHB 1UAAA 1DAHA 2WMNB 3U3KA 2IYXA 1KGDA 1NL3A 4ZDKA 1L8QA 2E87A 3NH6A 1W48A 3U7HB 4LSGA 1K5GA 2UZIR 4DXAA 5JHHB 2BMJA 3GLGB 2QM8A 1E2HA 4JYBA 5AUNB 2D06A 2P0EA 4TLCA 2AFHE 2QNRA 3NIBA 2EWVA 2NQ2C 2IWHA 1NMZA 4KHZA 4FI3C 3BK7A 3T1QA 2GBLC 3K0AB 2FSFA 3BB4A 4DWJA 2HT1A 2PEYA 5M04A 4B76A 2J0UA 1JQJC 2ZE8A 3U7EB 4BE7B 5HZHA 1GM5A 3B13B 1KIMA 2JCSA 1AS3A 4LCBA 4WA7A 3Q7QA 3FKSD 5AJYA 2F9MA 1NI3A 4UXJA 3CRRA 4KVAA 1KTVA 2OFWA 3UK6A 4JVLA 1OHHA 2YHSA 1J2JA 2QMUA 4A15A 1OFUX 2ZE6A 3ZVRA 3AP2A 1ONBA 3VNVA 1MRNA 3Q9LA 2GCOA 2AK3A 3CF2A 1KI2A 1S3GA 3QKSB 4GNKA 4FINA 4TMKA 5AUQA 4P4SA 4C9BA 1NP6A 2IL1A 3D8BA 1R0YA 3AVWA 3TAUA 4IOMA 3LBHA 4D26A 3B5JA 5DE3A 4LYAA 4LJ9A 2P5TB 2KE5A 4OI1A 2G9NA 2F9LA 3IBGA 3TNFA 5DSZA 3AP3A 2OO7A 5B58C 1IJEA 3IUYA 1H8HD 1KZGB 2GDJA 2XXAB 2ZJ5A 3VKWA 5EXTA 5EE3A 3GJ7A 3RS3A 1E1QD 3QEOA 3NDBB 1GRRA 4DLTA 2G83A 5C4MA 1E99A 3EWSA 4RKEA 2GZHA 4URVR 4I4LA 2CBZA 1E2FA 4E07A 5KTYA 1G3QA 1CXZA 2GK7A 1TMKA 2CCGA 3JVUA 4RD2A 4A92A 4EPVA 3B1VA 1DPFA 1Z6TA 4GBMA 1XXHA 4ESHA 3ND8A 1KNXA 1XCPA 4JSTA 3X1ZA 4Q7JB 1ZYUA 2CK3D 5GJVC 1Q57A 4DDTA 1FOEB 4PHTA 1KNQA 4B3CA 4CZ2A 5JWRA 2YZ2A 4RD4A 1JQLB 3EASA 1ZNYA 1KJZA 4EIWA 1FX0B 3FMOB 1GSIA 1SHZA 5JCPA 5JFGA 1KZ7B 1HQCA 1N3BA 3ICEA 1P62B 1EWQA 3K8YA 2DCUA 3W6PA 4GL2A 5FOWA 1MABA 3KDSE 3O8DA 4TTPA 2VEDA 3W5JA 4CEJA 4PO8A 2SHKA 5FOXA 2BBWA 1KSHA 2QE7D 3BJIC 3ZD7A 4L15A 2QN6A 3CX6A 4AKHA 2IYSA 1NN1A 4FMBB 1AJEA 2FV8A 2GBLA 4JLPA 1ZIOA 1G6OA 2Q3FA 5AJXA 2QU8A 3W8RA 121PA 2BBTA 4NYIQ 2EFCB 2PMKA 3NBZC 2IK8A 1GZSA 3ADDA 3REGA 1ZU4A 2DWQA 4FCWA 5JI2E 2PT5A 3IQXA 5FPTA 2AD5A 2QMHA 2CLDX 2V55B 3E5HA 5TVKA 4LBZA 2WIBA 5CDFA 3MJHA 1RYFA 4NDZA 1W36B 2D7DA 2BM1A 1XTKA 4WXPA 2X2EA 4TZ0A 1AS0A 1NKTA 3AF1A 2ZUDA 2PMDA 2PT7A 2J0SA 3QENA 3ADCA 1LNZA 5CK4A 3LV8A 3T1VA 1AZSC 1VCOA 3HP1A 3QUSA 5E4FA 3I4LA 4OI2A 4RZUA 1XMJA 3VAAA 2V7QA 4TLAA 1K6MA 2RHDA 4FXPA 4EJSB 2JJ8A 4KO8A 3SI7A 1E94E 4IRUB 3ONWA 2XNSA 3RS2A 2GCNA 5CLLA 2MSEB 2DB3A 3AQ4A 1W5SA 4HAZA 1G16A 3ADBA 4EFLA 2V8OA 1N6RA 3TBKA 5IT5A 1KO4A 3PEWA 2IHYA 2HJVA 1N6IA 1CRQA 4NZYA 1KSGA 2GXQA 2CE7A 3AM1A 1OLOA 4Q1CA 2HCBA 2BJVA 4ASUD 2QORA 3ZVNA 4IJMA 1FZQA 4RY2A 1N5IA 4YMUA 2ZUCA 3HJNA 1E9FA 2F43B 2YWGA 3RVBA 4DDVA 2KB0A 5CYOA 3RABA 1IXZA 2FFHA 4O25A 1MO6A 4PSVA 1ZINA 2FSGA 5TARA 4IEEA 5F9FA 4PAQA 3THXA 2QAGA 3KXIA 4YMTA 3PEYA 3IBYA 3OIYA 2CVHA 4OK3A 2IT1A 1B23P 1KY3A 1EESA 3CRMA 4KV9A 4C7OB 1KMQA 4A0GA 1NN5A 3ZQ6A 3K09A 3KJGA 1EG7A 1W4RA 4OQNA 4RVCA 1W4BA 1QVRA 1ZP6A 2HYIC 5IHPA 4OJQA 4DLVA 3QPUA 1CJTC 3GEHA 2WIAA 2R2AA 1BS1A 1FX0A 5FUVA 5JS8A 2ZRHA 3GLGE 4QBFA 4CGZA 3WY9A 4GOJA 3CLVA 4Q7MB 3A1TA 4WAUA 3GP8A 4KAXA 4JS0A 4BFVA 1SXJE 1ZIPA 4U00A 4UJ5A 4LZZA 2QBYA 4MDEA 1ZC3A 3TUJC 4OK5A 3TW8B 1WA5A 4ASUA 3R9IA 4BRWA 1KDPA 2XSZA 1XXHB 1TU3A 2V1UA 4Q7KA 1FTNA 2QAJA 1VECA 4JYCA 2WTUA 2HYDA 2JLWA 3AGPA 3VHLB 4B75A 4PQFA 4V0MA 2NPIA 4QKQA 4O0MA 1MRSA 1KYIA 2F1JA 2CNWD 3K9NA 2ZR0A 4C30A 2CL7X 2JLZA 2AXPA 2FJUA 4HLUC 1N0WA 1Q12A 1G41A 4R9UC 1E3MA 2DFNA 1S9HA 1T8TA 4LRWA 1NVVQ 5JECA 4BLRA 1JBKA 4GZMA 4MGZR 3LRPA 4CEHA 1ZM9A 3AF3A 3V00A 1XTIA 1N6PA 2XTMA 3E70C 4DLWA 1ZD8A 2A5FA 2WWXA 5LD2C 1RRFA 2HXSA 1JECA 1KI6A 3EPKA 4TT3D 1DADA 3BXZA 4QOSA 5FUWA 4Y0VA 2IS2A 3V4RA 4CW7A 1TL7C 4M1OA 4DRZA 4IFEA 2RGCA 3WNCA 4G5GA 2EVWX 1LB1B 3KKQA 1O87A 3VKGA 4DCUA 3WYAA 8OHMA 1EX6A 2ZRIA 2RH5A 1HYQA 3HU2A 2XOKA 1EFRD 5EXXA 4PC3A 5SZIA 3E1SA 2J0UB 5K8LA 3DL0A 3U2QA
chains in the Genus database with same CATH superfamily
4BO2A 4U5XA 4B6EA 3QMWA 3FYTA 3EG5A 4TTVA 3HYSA 5EA2A 5DCLA 1Y9AA 4EMUA 3O31A 1JA9A 3D3KA 2C04A 4HNQA 3TLJA 2VSXA 5KPJA 3QSYA 2C3YA 4EF5A 5LP6A 2FH5B 3WMWA 2PHZA 3H4TA 1ESNA 3FMVA 4IG4A 4RHCA 2XOEA 3C0KA 4ZAZA 3W5SA 3O8QB 1ZQ1A 3CLHA 5ADUS 1EXDA 3ZYZA 1RJ9B 4N0PA 5FNZA 4EHHA 4ND3A 2RHBA 4YWHA 1OWPA 1Q1NA 3HFJA 2PGXA 2AVDA 5FT9A 5LIRA 5DULA 7GPBA 5CDUA 3GJ5A 1RQ2A 5CG1A 8MHTA 2A5DA 4QUGA 2VPZA 1N5DA 3C5WP 5CNKA 5SY6A 2BEWA 4KXYA 5KJ1A 4MW0A 2ZBRA 3HEMA 4NNPA 4OCZA 4DCNA 1QRRA 4G5XA 5ALSA 5LQSA 1RHJA 3OZFA 3UB3A 5LWHA 3T06B 2VQEB 4MS4B 4B32A 1RLMA 2BFMA 2R87A 1SUCA 4TVSA 2KLBA 2R4UA 4WVLA 1UBUS 3CGGA 2W6ID 1ZNWA 3GA7A 4HAIA 2ZJOA 4B3JA 1R9NA 1VA5A 1E92A 2OGWA 5I7WA 3P9YA 4LSWA 1DDOA 2XMSA 1N25A 4UTPA 2WU0A 4D8VA 2CZQA 1G21E 4G0VA 2L69A 2O1EA 3BKWA 3LGSA 1H22A 2LZ0A 1NRWA 4QJ5A 4L4RA 5JNUA 1T43A 3DJYA 1STOA 2YWFA 2ZRGA 3P5SA 3Q72A 4OSEA 1O6BA 4V0LA 4W1PA 5DYTA 3QWFA 4D9MA 3O8RA 4LYGA 1O57A 3EY9A 3P94A 2JI7A 4H16A 4O4LF 5B4TA 2O3SA 4NC9A 5F23A 1M1XB 4OHXA 3W90A 3U6KA 1IJKA 3S1LA 4YRMA 4GX5A 2RAUA 3VOBA 1KKMA 5B12A 2FPKA 2IEYA 1I2MA 1QE5A 5K4HA 1H9CA 1YF3A 1T4CB 2ZZNA 2XCLA 1V9CA 2Q8PA 3DO6A 1MNQA 4UEQA 5EWLA 1RXVA 3FHTA 4C01A 3IIMA 3QWAA 2BBSA 1WDTA 2R4TA 3NP9A 4UXHA 3IXQA 4OJMX 4NPAA 3OJEA 4X1IA 3VO8A 4H6PA 5K09A 4FDLA 1ID1A 1G8FA 5A5EA 2CLOB 2H2FA 2ODTX 3DB1A 4H1UA 3HVRA 5AVUA 2J7PD 2RHOA 3X1YA 2A7QA 1KJNA 1NMXA 2GR9A 2R1TB 1SU7A 4Q16A 1SUAA 5EMLA 4V39A 4JOCA 2AVNA 2JEZA 1RCFA 4FFLA 4K03A 3RRBA 1TCVA 2Z2YA 3ICPA 4B3DA 1JLLA 2ZKIA 2BHLA 5J58A 2WIDA 3KR2A 4N18A 5KWIA 3U4HA 4GMDA 5JLAA 3B60A 2QLNA 4C3UA 5GV7A 4LCEA 1HNNA 2XXJA 3ZCTA 2Q0SA 3JQRA 2GUGA 1L7QA 1RWXA 3GYGA 4M9QA 1BFDA 1K8YB 3OJCA 2AXEA 4Q4LA 1OPXA 2V45A 5D5QA 1TTHA 4FIZA 2UUCB 2RI0A 4C4TA 2H1VA 4YMVA 4P3YA 3JVDA 5TS3A 1VLVA 3H87A 4RIFA 2PUCA 1HT2E 1M6EX 5B7GA 2XMPA 5M3BA 3ZVKA 4XKJA 3TINA 4HNGA 3I2YX 5ADVA 4DBLE 2FVXA 4NK4A 2VI5A 4OA8A 3DXYA 4QJ3A 2OG2A 3A4TA 4OJTA 4TVBA 2NXCA 1TCUA 5CB4F 2IPLA 3HA5A 2CHQA 3WQHA 2ILTA 4WXYB 2AQIA 4V2IA 4CTKA 3T5TA 4G5QA 4LKOA 4DGQA 3NIGB 1LDMA 4MV4A 1GGHA 1E2NA 2PGLA 1LLQA 1RACA 3IOCA 3ICWA 1G8MA 3H3XA 1BX1A 5TV2A 4BUJA 4EELA 3ZHUA 1OU0A 4QREA 1X7WB 1YDWA 2Z09A 4LOAA 1WCWA 2YRXA 4I55A 4ZQBA 5BQPA 3U81A 5AD1A 2PWZA 4UBKA 3TPFA 2PMEA 1JDVA 3DMDA 2PSSA 4Z9XA 3A1UA 2VHQA 3AEKB 3WQSB 5FI3A 4EO7A 4QM7A 2ONKA 5AHKA 1QX3A 2F3PA 3F6YA 4OAOA 1P80A 1EH5A 1SIBE 2P9YA 1Z16A 3DXXA 2IHJA 2WSMA 2H9YA 1PQWA 3BCHA 2YASA 4CL3A 3I01A 4QM6A 1M1UA 3TK1A 1UDAA 2OV6A 2BSXA 4IUCS 4B17A 1MAVA 3JQ6A 4UKDA 2PX2A 2FLWA 5GZ1A 1X1CA 1L4MA 3HDQA 4AKIA 3EW9A 4CXMA 3PHGA 5IM4F 3DPUA 4G0UA 4LZWA 2OCLA 5HIMA 3BFJA 3C6XA 4COKA 2R00A 3GQBA 4Z8XA 3VM6A 5GJCA 1Q3TA 4YACA 3EF0A 1BMFD 4KBGA 5LCXA 3MMXA 1TQ6A 4U2FA 3M4JA 3A1NA 4KXUA 4A9AA 2JGKA 4G63A 2GVDC 3T7TA 1KSJA 4MUFA 2L2QA 2ZE7A 2HSJA 3RYIA 5HBRA 1RC8A 1VLMA 3B78A 4Z0NA 2J5QA 2VJMA 1A9XA 2HA0A 3VZPA 4DMMA 1GY8A 3GJRA 3DZIA 1J6UA 4JOSA 4F9EA 3OQ6A 1R5BA 1TE2A 2QQ0A 2WZBA 3AI7A 3CS3A 4ZDJA 3CJTA 2PRZA 2ZAGA 1VJCA 2XZPA 3WL8A 3ZWXA 4A6EA 2C5LA 2W9XA 3B1WA 5CCXA 2WUGA 4HLUA 2ZIUB 4MV0A 3CZQA 3K1TA 1OCEA 3U39A 4EKYA 3N0TA 5CDHA 3W04A 3HXTA 2FQXA 2RJ3A 3G2HA 2A5GA 4P3KA 5DSTA 4IDHA 1V5FA 1G4AE 4EG5A 3KJQA 3NWJA 3MCAA 1E59A 4JX9A 5KTRA 2QUZA 3JX9A 4K9RA 1EGQA 1YRYE 3DBRB 3N2NA 3DZHA 4Y2VA 4I19A 2P1ZA 4UBMA 5CM8B 4FNAA 4NK5A 2GBIA 3E22B 4OJNA 4EG6A 1KVTA 3ECSA 4DEYA 1RI2A 3KLOA 2FG7C 4HMQA 2BISA 1D09A 1RMTA 1NXVA 4I1YA 4KIUA 3USCS 5KOHB 1SXJA 3WG9A 3LYLA 1KFJB 1YR1A 4CLRB 2V4ZA 1H2ZA 3EMDA 2AFRA 2IYVA 4LTDA 2VTBA 5ERGB 3EIXA 3SE7A 1Q5PA 1TX4B 2ECFA 2QYSA 3OE1A 1WPXA 4M0DA 4DGSA 5BSEA 4IF4A 4L3OA 1PS0A 1ISRA 4I46A 1QYCA 3H9GA 3LIIA 1JEQA 1UDCA 3AC0A 1GPMA 3RYTC 3KWJA 5GAJA 4C4YA 1N2CA 1P2DA 3HACA 3KJXA 4HGYA 3Q3HA 2L17A 1RDFA 3AMVA 3U4QB 2CHUA 2LP4Y 3SS8A 1WG8A 2F8MA 3KL4A 1CUHA 1OFUA 4C3OB 1UBHS 2P3LA 4CF7A 4LZLA 3BC1A 2IXAA 3JY6A 2GZ3A 5C3MA 2DH6A 4YBZA 5JC8A 3JQ9C 2VPTA 2NU6A 1XVAA 1XRMA 2CWWA 4U2DA 5EIEA 5L3VA 4ZDWA 5A4IS 1L1FA 3NTRA 1MXHA 4CI0B 2VCEA 3GNQA 4R98A 4YJ2F 4G25A 1NQXA 2H29A 3MS4A 1RW4A 5T41A 4H4CA 3TCXB 3I6IA 1SKUA 3JYOA 3LHKA 3FPCA 2AK2A 2WLSA 1U0BB 2P2DA 1E6LA 1NVWQ 1PT7A 3TPCA 1OI7A 1W94A 5HM8A 5KKCA 5JZSA 1JE1A 1XE3A 3HRIA 1OHHD 4FHGA 3WK5A 8ABPA 3QX3A 3GRPA 1QGUB 2P6MA 1B76A 3RWMB 4EVRA 3SS9X 1WWKA 4BKMA 1N0UA 4WCFB 1EZZA 1RNLA 4L2IA 3A6JA 3RKRA 3KZ1E 5LLTA 1HTWA 5HS6A 4R2XA 3HSKA 4CI9A 4S1WA 3AR9A 5F7XA 4PSKA 5CNJA 1FFCA 1GCAA 2Z83A 1MO5A 3VHRA 1R27A 1FSGA 1MQ9A 3WNVA 3OSZA 2QW8A 4Q9IA 4LTMA 4XD2A 4G5OA 3BJMA 4RPCA 2WYHA 2ZTHA 3WLOA 4F04A 3OLXA 1V48A 2ORED 5B7NA 4FWIB 3U3JA 2P3SA 2XNDD 4FOTA 4ZXFA 1A77A 5IN4A 1ODCA 5I5GA 1FB5A 5D3MA 4ARZA 3R24A 3STHA 1U8FO 1GYQA 5TGTA 4DNQA 4QODA 2Q8QA 4A8PA 4AG5A 2W22A 4UTXA 4AT1A 1BRMA 3IPYA 3WK9A 2X5OA 2O19A 4W1RA 1ZA2A 4AROA 3TLMA 1UKVY 1J90A 1OUMA 4BO5A 4YLYA 3WBJA 2BOVA 1BKSB 2VO1A 3NAZA 4KREA 4QBHA 4XD7D 3BZUA 6ABPA 4DSNA 2HQOA 4ZDIA 5EZYA 1GDDA 1OBOA 4PANA 3QBDA 1WCV1 4KR3A 4D3DA 2VSFA 3UT5B 3M4YA 1JKIA 3DYIA 2OEPA 1YT5A 2G1UA 3IDFA 3VX3A 3IQEA 4GSYA 5CFPA 3KBBA 4IEIA 3HKBB 5B37A 5BQ5A 3HDJA 3GG2A 2TYSB 1VHLA 1M1YB 3AF2A 2Q6IA 3JXEA 4CMKA 1LFAA 3TOSA 1D6JA 3LXRA 4WFQA 2O50A 5T57A 3RJZA 4H17A 3UJ9A 3KC2A 1R0BA 2DHRA 1U7HA 4CLRA 4MGKR 2ZIXA 1PV2A 1GTG1 4EQZA 1RFGE 1WMBA 1ECBA 2PIAA 1DWQA 3VZSA 2D13A 4NENA 1E1CB 4GWGA 1JSZA 5A0TA 3JQAD 2GK3A 2AJBA 2WJYA 3ECCA 1NW6A 1Y3DE 4YRTA 3KSAC 2DHCA 2O4UX 3I5XA 1NLFA 5CCBA 2DHDA 4R69A 4MYUA 3RFCA 2RK4A 3CZPA 5U9CA 5IAAA 1SBHA 2NNWB 2VRCD 3DE0X 3JQDA 4I4CA 4HAOA 4LBWA 1DKRA 3JZDA 1YAJA 1SVIA 1S0UA 3HZHA 4IXMA 3U4GA 1WMFA 4AY2A 3GQVA 3GUCA 3KPYA 4PINA 5CA0A 4BO7A 3ZOKA 1RRMA 5CVDA 4A0HA 3AH8A 4JJZA 1W581 4N0MA 4DC9A 1A9XB 1ZESA 2P8JA 2PGDA 5IG2A 5KBYA 4RE6A 1AY0A 3OQIA 3UMBA 5JNSA 3ANMA 1CC1S 1PJ3A 1T6NA 2RMKA 3KWFA 5AVTA 2IBTA 3P4XA 2LIPA 2I34A 4HH4A 1CVIA 4TMZA 3WADA 3VBEA 4MOWA 1ZKDA 4OLFA 3PD7A 2VZ9A 2ZDQA 4YIKA 1QYWA 1CR1A 2IU0A 3TSYA 3EVEA 3V8QA 1Z56C 3A9UA 3SEFA 2NYUA 2A9JA 5H16A 2XZLA 3OEHA 4U02A 4M7RA 1GKUB 2P4UA 3LAWA 3V8PA 5L7WA 1G5TA 1X92A 1DEXA 1RRPA 1YR3A 2MDTA 3W2TA 1E7YA 3KFLA 4G0MA 1EP3B 1T1SA 1JQBA 2WVJA 5F21A 3KT8A 5LB2A 4IIFA 1JPJA 2Z95A 4D99A 2R68A 1KAGA 3VR4A 4FMPA 2ETVA 4F4JA 1RCUA 3KDAA 1YK1A 4AC9A 4Q9HA 1UODA 2OT3B 2DWPA 1D3AA 2DKOA 2Y27A 2ZUWA 4RK6A 3AKZA 4E13A 3NS7A 2VNJA 4FGUA 1VTKA 1ZQ9A 3BD7A 2REOA 1RE0A 3C4JA 4GBJA 2I87A 3BFPA 4O0LA 4DLZA 2AB0A 3HO6A 3UB2A 4MPJA 5IDVA 2WHQA 3M6FA 2AE2A 2ZCVA 4GEGA 2O7QA 2FE4A 1AT1A 4O2AF 4C4OA 4CETA 1ACJA 2XCSB 1F5NA 3J81k 2PBRA 3NX4A 4NAUA 3U3OA 1TF2A 2GETA 2WP8J 2O8CB 5CA1A 3CPHA 4KNYA 3HSSA 1ZHHA 1C8BA 4II2A 4B2PA 1GEEA 1E1KA 1UINA 4TLDA 4HB4A 4ND1A 2HNBA 3DAFA 3BE8A 4K05A 1T9GR 2ZYTX 2FW1A 2NZ8A 3INTA 4GPTA 4D7AA 2W0MA 4M1TA 1P4JA 2HDWA 3Q9NA 3T61A 4IDNA 3V1TC 3GLRA 5CA1F 3IC5A 3KV3O 4MHTA 4Z53A 1PSZA 2J9GA 1RM3A 3GH1A 5CFRA 3OUZA 2IS2A 2EX1A 1TKBA 3QV1A 5CHYA 4D3XA 4DM4A 4G5HA 5JD4A 1UMCB 1DAEA 2E49A 2ST1A 5AW4A 1HG1A 1E6WA 1IOZA 1QFMA 1CF9A 4YGXB 3SZUA 1MC8A 2NO1A 2VBFA 3BMQB 4UTVA 1X9IA 3DTNA 2C8VA 4IDDA 2WQ6A 5BR4A 3WHLA 2CYAA 1E6MA 3T3DA 4DLSA 3O91A 3AKYA 2RI1A 1J7KA 3AF4A 2FRDA 3WZLA 2ACEA 1ORRA 5KOJA 3QYFA 3BMOA 1DQYA 3AVYA 1H3NA 3THWB 3OZSA 4Q66C 3GJQA 3N75A 1JF8A 2QVLA 4IIGA 1DTWB 5G3YA 2AA3A 2PXAA 1Q15A 4QTTB 3WVNA 1RWMA 2PLRA 3MMSA 4A23A 1ZEJA 5EVCA 3AWIA 4GBGA 3UCEA 2RC5A 5F2EA 3TZQA 2PVPA 3LWBA 3O2SB 4FMDB 2VJKA 4U9IS 2ERYA 1R6UA 1GN9A 2UYQA 2O3RA 4MPDA 4JAVC 5FWYB 4CKZA 5FHQA 3SQWA 2W4IA 1HRDA 1R00A 1SXHA 4HH0A 3FHOA 3PUXA 1DV1A 3H13A 4LHVA 4BWFB 1SG6A 1TVKA 2W2VA 5AQEA 4DIMA 4EVIA 5IKXA 3MWKA 3GT4A 2YTZA 3TDKA 3MXOA 2ZP1A 1HQYE 3MGCA 3IHWA 4R40A 1KMIY 3T9CA 1ZD2P 4TRNA 4B46A 1G8SA 5FL3A 4E2YA 1VRWA 3EYWA 1B93A 2ZJ6A 4NHOA 2NPOA 1UC9A 1HMPA 1G291 1QHIA 3HBNA 5KSZA 2XF8A 3K8ZA 1OBHA 2LUOA 2P9CA 3EXHC 5BW6B 5B7PA 3WGNA 2CKMA 4A03A 1D9ZA 1NXQA 2NTNA 1G0NA 3AEUB 1QS0A 4GAEA 1Z07A 1LDYA 5LQCA 3W6ZA 3F96A 3VU9A 3ZGLA 4RTKA 3QJGA 4ND8B 3AUUA 4BOYA 3RK0A 1MA0A 1ONOA 4P80A 5ISMA 2WJIA 3AESB 3HI6A 3PNOA 4OIFA 4PAMA 4E5KA 2F90A 5HKAA 4LDPA 2QTZA 1EWRA 3VYRB 2TMGA 4OIMA 4AX8A 4KL8S 2R6HA 2ZRQA 3DDZX 4J03A 1HKUA 3BX1A 1AKRA 1YCGA 4F86A 1EHYA 1SGWA 5BOSA 1ODFA 2IU4A 1E7MA 5LWQA 2I1WA 2B83A 4QOFA 4OX9Y 5A5DA 4FE4A 1U0JA 1XVLA 3SEZA 1SCNE 1SD5A 4RTMA 1NG9A 5FJJA 1GZUA 1TTQB 2M6RA 4B2YA 3ZI7A 1T3SA 3RVPA 2IGTA 1X3SA 3VPFA 2OYRA 4QDXA 1AZLA 3GP5A 4DKXA 1KC1A 5ALNA 3MTJA 2OQIA 5BQFA 4G37A 1XPRA 1M54A 3AM4A 1YA4A 4JY7A 1E9RA 1NY5A 2JGLA 3EDOA 3M9WA 2HMYB 3BGOS 4TV9F 4ENPA 3SHOA 1GG9A 1Z29A 3ZQKA 1H2EA 1WD5A 5KDLA 4BVJA 1SCUB 1WXHA 4NFSA 1S3IA 2IC5A 4AG3A 3GCGA 2GA9A 1JEEA 3NAGA 1Z6AA 4M49A 1IU9A 2GPBA 4UJ3A 2DFLA 5JOQA 4O4IB 3BHNA 1RCTE 3NVKI 1L1QA 5FRDA 3VH2A 5HDBB 1HR0B 1DIOB 1OLXA 5EFZA 4CM8B 1Z25A 4MVJI 2H08A 1QLJA 2QE7A 5BN4B 4EPWA 4ENTA 3IEMA 1Z0IA 3N7UA 4MEJA 2RGNA 4EYKA 3DZFA 5FF9A 1DJMA 3UWPA 3MERA 4OYLA 3BGSA 4I2VA 2X0RA 1XCBA 3GU3A 3KQTA 1YR2A 2GK6A 3MOIA 3UY4A 4F6RA 5AESA 4ZJYA 2NUBA 3C15C 4N54A 1HFKA 3O8NA 4KJZA 5CPBA 2OCIA 4KWHA 2NXJA 4YY3B 2HGZA 1IDN1 1P5HA 3AOEA 4HPXB 3L8ZA 2YJNA 2BFAA 3BXXA 1C7RA 2W83A 3OCYA 2XMRA 3RRJA 5WRFA 2ZG6A 1I5EA 4E12A 5SICE 2ZWVA 3U62A 4DQDA 1XRQA 2WV9A 2HREA 4O1HA 4MWDA 1VL1A 1E5XA 1PLKA 1M0EA 4MRSA 4G0WA 1AE1A 1AKWA 2V97A 4C4AA 2EYQA 2W6JD 2QTVB 3H11B 5E0OA 3UUEA 4Q4DA 2C58A 3UFXB 3C8HA 1CIVA 1JN0A 2AQHA 1J0XO 5F4BA 5ITVA 1DKOA 1X19A 3MRXA 4H7HA 4JQSA 4MCIA 5AW8A 1FYFA 4BL5A 5IT9A 4P9NA 1C2YA 2QZ4A 4BBAA 1FNDA 1FS4A 1TFUA 1XNGA 1NJGA 1Y34E 3EXHA 4RD6A 4ZYZA 4US2R 4PG7A 3REQB 3ZIDA 3KKMA 1EP2B 4ILKA 1YFLA 4V1CA 2I2XB 4IVRA 4EB6B 3I64A 2NN3C 2BE7A 1GRNA 2PN1A 3QELB 4WY8A 2DFKB 4I50A 4RV9A 2EFGA 1NW3A 1XZDA 2BKLA 2P7HA 3A1VA 4IZHA 2RGWA 2AWNA 3BM5A 3FFAA 3MVEA 4HDRB 2X8JB 3E3MA 4HD8A 4KFRA 1B15A 2PRJA 3W77A 2PSJA 1XVTA 2AG5A 2AOTB 4FBLA 1Y81A 3ZY4A 2Y0PA 1NTRA 2YJ4A 3K94A 1JMVA 5IBRA 2AWOA 1UKEA 4GGPA 2PBLA 1OXMA 4ZQHA 4YMIA 1N57A 5C18A 1NRJB 4KWIA 5FV7A 3FOCA 3VX4A 2ZETA 2JCYA 3BD8A 3THWA 2CXTA 2X6QA 3RUHA 2ZWAA 3CM0A 4MMXB 1S4QA 2PLWA 3PQ6A 3JVIA 3PWZA 2BHSA 1MB3A 1W9HA 3L7BA 1D03A 3N39C 1QHHA 5IN5A 3TXAA 1QAOA 5L8VA 4CG0A 4DM7A 2LIVA 4CKWA 3EDMA 1OBFO 3NYQA 1ULUA 3GT7A 5GVRA 3TZBA 2O8FA 2BTQA 4P36A 3MJ4A 5HF9A 3RRNA 4A0SA 1FDUA 2JEYA 4LJRA 2BV3A 1T26A 4H60A 5EJ6A 1ZXXA 3P0HA 1XEAA 4IV0A 3DLBA 3EXHB 3S70A 4R05A 1R74A 1NJ2A 4Y1RA 3NHWA 2C5BA 2FPOA 1N2BA 3R40A 2BE9A 2EJWA 4BNGA 3LC2O 2HCTA 3FGNA 1R6XA 3HMQA 4UMFA 2OFFA 3VR0A 5TMBA 1TKRA 3P26A 4RXMA 4K6GA 4DV1B 2F6RA 2ZI4A 3HLTA 1XZKA 4Y6SA 4E03A 1M33A 3LHSA 3GZJA 5CLHA 4HN4B 3J7AC 1JDJA 4JZKA 4S2EA 3I9JA 3KKOA 3ZDXB 4LJYA 1M1YE 2OZEA 2SNIE 1JSXA 1KJ9A 3H9CA 3LW7A 5JPCA 1WXWA 2PQMA 2J67A 4E4YA 5JROA 2ZBFA 2IXEA 4IAOA 4Q6BA 1M7GA 1K1EA 1ULBA 3LFTA 3N0XA 2P2GA 3EHEA 1YI0A 4MSUA 4Q9AA 4ZI5A 4CF3A 5LQJA 3UENA 1TYBE 1DXHA 4B4WA 1R1DA 4RWZA 2CMHA 3H3FA 3UWOA 3ILYA 2VTEA 2I3BA 1UXHA 4EGFA 1MTZA 3IYLW 4LXIA 2CXOA 4NU6A 3HO8A 4OOEA 1KGSA 1SRQA 3DO5A 4JVOA 3C14C 3C43A 2C4UA 4RAOA 3RGGA 3T7RA 2FPPB 5CB0A 1DOAA 1P0QA 1U90A 1T9GS 2BP7B 4K6CA 4LMPA 4TTSA 1QTNA 3MT8A 1UQUA 2JARA 3GVHA 3UJAA 3DW3X 1UFOA 5TMPA 4EL5A 3K1AB 4QBIA 2X0DA 4YCMA 2D59A 3H05A 2EXXA 4UUQA 1J8MF 2DTXA 2P4EA 3I1FA 2I4MA 4Y2UA 1M67A 3E2PA 4OHUA 1I33A 2W6CX 5AW1A 5AKLA 1H42A 3R9XB 2ZYVX 1VXOA 1XUOA 2FHPA 3JD1A 3TE6A 2JIPA 4A16A 3G1WA 3IMCA 3LBAA 4BGUA 4DV3B 1DSSG 3DAOA 4EW2A 1DJNA 1FTSA 4PO3X 4E7OA 5JAPA 1PNQA 2AG8A 1O0SA 2F4VB 4AWXA 2AN5A 1JG3A 2B4AA 4KIWA 3NDIA 3TVTA 1Y7PA 3UEOA 2ERXA 5J23A 4IHJF 4WN3A 3V48A 1SBTA 1RLIA 3OPNA 3IKJA 4EATA 4QWMA 3NT5A 1Y42X 1LDEA 2J3JA 2PL1A 1LBHA 2PE5A 1ZN2A 1PFQA 1F2UB 3AL2A 3MSCA 4YCBA 4ZALA 2XVXA 4JJEA 3OMXA 3EPRA 1RLOA 3O95A 5G0WA 2QUBA 3OOJA 5AO9A 4BMOB 5BSVA 2PBZA 3OQNA 4M87A 2JASA 4R71A 2I4IA 1EFUA 1UMDB 1UJ2A 2GARA 3FPAA 1QCZA 3VR6A 2HQSA 3C6BA 3DUFA 5L4SA 3U1BA 1F14A 1J9ZA 5LMCA 6Q21A 4MEAA 1O4WA 5J40A 3TOZA 4FGWA 4KFCA 4V24A 4F9FA 3OQJA 3CVJA 1NF9A 4LE0A 2JDID 4MS3B 2AEMA 2G6BA 1IN5A 5FKJA 2HIAA 2ISQA 1H9AA 1OLSA 2XIQA 3IUEA 3OIUA 1U8ZA 3BIJA 1T1IA 3HDGA 3ESBA 2OCXA 1F2TA 3KNZA 1W44A 3KXKA 3O38A 2VQ6A 4I1OA 4M6WB 1YS2X 3AY3A 4MQEA 4XX0A 1GILA 2W0SA 5TQ0B 4FX5A 4FHDA 4IR7A 2PMCA 4X1OA 5B4VA 3SFVA 1HTTA 1R5JA 1NBMD 3E1KA 1REQA 1GXSA 1HK7A 3GLQA 3SU8A 3BT7A 3RHFA 4S12A 2W71A 3MCVA 3KQWA 3EFOA 1UJBA 2F3RA 2KJQA 3HB7A 5FUYA 3ZWKA 1G1MA 1Z47A 1J9GA 3DAGA 3NBFA 3Q7PA 2RC6A 4O6VA 3TI9A 4OMUA 3A1EA 2POQX 1QG2A 2I99A 4QO7A 2HXYA 2FHSA 1MB2A 1T8RA 4KTVE 1YZQA 3WMEA 2ZM5A 5IJXA 1FFYA 3F8WA 5IU6A 2W42A 2WJ4A 3D6JA 4OBBA 3H9JA 4OHZA 3VPDA 3HCBA 4OMCA 1XVUA 4IGIA 2Q1WA 1KI8A 5AI5A 4ZRMA 3R7AA 3SQDA 1FFXA 1JXQA 4EY4A 2E5WA 5CCEA 3BUSA 1ELOA 2XQKA 4G5RA 4IMPA 5EJ5A 2BSAA 4PLCA 1UC4B 1YE8A 2XDWA 2RAVA 2HBZA 3UG6A 4B7AA 1DFHA 4J1QA 2Q45A 4UHBA 1LPOA 1A7KA 5I9IA 4TYWA 3WLAA 1K8QA 1Z13A 3GFRA 1X77A 1W25A 5ERXA 2WJVA 3FCCA 4PZYA 1FS6A 3DR5A 3PDHA 5TMEA 2H7CA 5EKDA 1L5MA 1WIWA 4HTFB 5DHFA 5K4GA 3IUSA 4MTCA 1AK2A 1QMGA 2FDXA 4OHWA 3JQ7A 3RFUA 3ZW7A 1PEYA 3E2MA 5TJHA 1HWYA 2PZAA 2LXNA 1FEZA 3F0TA 2ZBPA 3OTGA 1Z74A 3AINA 2O2EA 3A3PA 3G2OA 1VB5A 3ZZ0A 5AM3A 1JHZA 4LXGA 4N40A 4QZVA 3FOFC 1MQSA 1P2UA 2DPLA 4IDFA 1M6VA 1M2JA 3WI7A 4WOBA 4DR4B 2AF4C 4XXHA 3M33A 4E33A 3JAKA 3IP5A 4G0NA 3T94A 1E5TA 2VQ3A 4AWBA 5KQLA 3I3SR 1BHSA 3CUKA 4HLDA 4IUYA 4Y0AA 3X43A 2Z9BA 1FMLA 1LNQA 4BMXA 1E4OA 1N2ZA 1UJ4A 1DS6A 1GGFA 1A9PA 1TYEB 2PUWA 4QU5A 5IFKA 3TSZA 1ZN7A 2JC3A 4J29A 4MCAA 4QRHA 2H18A 5L3ZA 1NQTA 4D82A 4Z5XA 3B1KA 3OECA 3OCXA 2QTBA 3K1YA 3PEUA 5C8XA 1T5LA 4IZOA 5DASA 2R751 3DDUA 4ZZ1A 2OZVA 3ZJ5A 2NO5A 3NB0A 5EEGA 5IC6A 1JDBC 3DEHA 2L82A 1RQNA 2BCEA 3B6JA 2H65A 1N2EA 5TIIA 1TYZA 1AKUA 1MAWA 4X92A 3VKFA 1QGOA 2OILA 1UT6A 1TDJA 1X74A 1PFUA 2W37A 3GAAA 2ZAMA 4W9NA 1K3FA 4CQNA 1QYRA 1TF7A 1JQ3A 2R2GA 4RKRA 3A3YA 3KZVA 1Q7TA 3QU7A 2J0EA 4KQ9A 4QYMA 4LQLA 1ZCZA 4LZOA 2X0NA 1YFKA 2C3MA 3ABSB 1XRLA 1PWZA 4KC0A 5FI1B 2CXXA 5DHRA 5ADHA 3GGGA 4P38A 1QR2A 4NXNB 2EG9A 2PSFA 4HTFA 2Q5HA 3ILXA 4PXSA 1HFWA 2O2GA 4J2TA 3Q7EA 4J2HA 2Q21A 2WNIA 2ZUBA 4P92A 1GCOA 2C1EA 2QZSA 4KO2S 1PR9A 2BEKA 3SZOA 5KYKA 3CX3A 3HBLA 3QVTA 3BORA 3L4KA 3FWZA 1ORHA 5T4BA 3TTTA 1O89A 2FOLA 1JWBB 2ZAIA 5HF5A 5IW8A 3SZRA 5HUHA 2Z1MA 3AP1A 3KXLA 2ODPA 1GRCA 1LBEA 2CLMB 4CUKA 2CHVA 3W06A 3NFRA 3SLRA 4J16A 1X7ZA 1O9GA 1YR7A 2AIRA 1ZUIA 4KK4A 3VR6H 3COJA 3OLZA 2OG1A 3ZUGA 4FFRA 1VKOA 3VPHA 2EZ9A 5P8WA 4G07A 2E2WA 2FPUA 3IAXA 3V2UA 2XWSA 3QMVA 3QU2A 1GSAA 1OKKA 3H2BA 4LDJA 3ZDQA 2ODNA 4NV1A 4LZNA 4NZ9A 5L3RA 2ZIXB 4HAUA 1YZYA 1ZU5A 2JBAB 1GKIA 4J1NA 5FOVA 5JS6A 1N8KA 2XD4A 3DL7A 3D8NA 4RSGA 2VTKA 5L4LA 4Z4FA 2HSDA 3FW1A 3HK2A 1IB0A 1FP1D 4CIBA 1GTL1 4HZGA 1RKUA 1Z2NX 3A31A 3CJRA 3NIWA 1MB4A 5BSMA 3HR4A 2HM7A 1Z7BA 3H1GA 2JNWA 1XL0A 2Y1DA 4WZBE 4C1BA 4BTLA 4M6WA 5FOTA 2IYUA 1JG1A 5LNK6 4QDZA 3WRVA 1TCCA 3G2JA 2JH9A 4HF7A 4UASA 4NZMA 2D6FA 2A9OA 1PU2A 5TEWA 3W4JA 4M22A 4F92B 3RAFC 4NMMA 2XB2A 3PGLA 2X4LA 3JSXA 1J07A 2PAFA 1U3VA 1U8XX 1ZIYA 3EULA 5K03A 5CT6A 3PTZA 4KWEA 5C4MA 5DISB 2EC5A 4BWVA 2ZB2A 2IODA 4PYRA 3HO1A 2C2BA 3OZDA 3M2TA 4MYCA 5F2NA 2IZOA 3BWCA 2GHRA 1ACLA 1D7AA 5AK4A 3H19A 2QK4A 1AOXA 1O2DA 4GWKA 3TQCA 2V6JA 5I7EA 1H2BA 1UM9A 2OAQ1 3G8AA 1JEYB 5JLJA 3H8WA 1VKZA 1UBRS 3QXHA 3H86A 4O4JF 4BB6A 1NBMA 1ZLYA 3I5UA 3OHMA 2IP1A 4N49A 3ND6A 4IP0A 5L51A 1M1ZA 3QI7A 3R0JA 3VVMA 1CUCA 2QHXA 1VDMA 2ZPAA 3PG5A 5CYFA 2ZBVA 4G8CA 3IL2A 1QYVA 2KYRA 1GLNA 4RIIA 1LEHA 4KODA 1F4LA 2A4KA 5JS7A 4KTTE 5KYYA 3O26A 2XV1A 2APJA 2BGLA 1NM5A 3QKSA 1RBZA 4JLMA 1YQWA 4PEVA 4IOKA 4Q9JA 1IWBB 1K97A 3U17A 3VO1A 4EPTA 1DC7A 1VG0B 3BDAA 3TLGB 1AU9A 3AONB 2GSWA 4U9HS 1MU0A 2QUHA 5ECDA 2QB5A 1QBGA 1NW9B 2Q07A 3OIVA 4OM7A 4ZVLA 3CTPA 4EENA 2V03A 1N92A 3WFZA 5LJLA 4TWIA 3G8YA 3DHVA 3UBTA 2E0IA 5DXAA 4RDCA 1AKQA 2FW0A 3HR7A 1Q2XA 2CUZA 3FZQA 2PFKA 2H31A 5MN4A 3NVAA 2XD9A 2JFVA 5DVZA 3AKEA 3EQ7A 5GPBA 3R5HA 4OP1A 4ENVA 1N0VC 4L73A 1XNHA 1E2MA 2DM6A 3B7PA 1DC5A 3EXAA 2FW6A 3PNPA 4KXXA 3QHPA 5D85A 3UA3A 3L1VA 3JATA 3PXXA 4G4JA 1FUIA 1W46A 2CZCA 2NAPA 3GC6A 5DYGA 1XTRA 5ESRA 2ORIA 2HMVA 4ZVSA 2GPYA 2YL2A 3TRHA 4TYQA 5CUQA 1LPMA 4MQ4A 5K3FA 4N6GA 4X1IB 5EVJA 3LS2A 3FI9A 1CY6A 3KQUA 3CNNA 4D74A 2BWJA 4EO4A 5AW7A 3UK2A 4C0XA 1H5QA 2I7CA 3TGPA 3I83A 1Z2CA 2FPGA 5FTWA 1R3DA 5ALTA 5EQJB 5FD8A 1ORIA 4ME6A 2I66A 5K0LA 3IE1A 4J2OA 1OZ0A 4IIYA 3WIEA 4ZOBA 1NPDA 2N46A 3BILA 4ESVA 2JI6A 1JGTA 4XX0B 4B4UA 4YP7A 3C7CB 1FVFA 3KUKA 4HRVA 1NOIA 4LS3A 3TCNA 4Q7EA 4TTTS 4FUQA 2CV0A 4M1MA 2GRUA 2VF2A 1RJEA 4I1PA 3L0ZA 3ENNA 1R0LA 2H17A 3O93A 2EWMA 3CC8A 4R0NA 4BVKA 1QRUA 4Q3EA 2DHEA 1ZOSA 5ALHA 3ZCXA 1YDHA 3L43A 3TQRA 4DC0A 4GLOA 4YRDA 2VHZA 2HI0A 4EJSA 1GZ3A 3HHEA 5JMTA 2BH2A 1DZIA 3DBRA 3S29A 5I4BA 1JDTA 1EWYA 3R2JA 4DMHA 3P9IA 1NFFA 3M5PA 4ZOEA 1IAVA 4P4GA 2AX4A 3LLUA 4L5BA 4R3WA 4US1R 5E9WA 5I7HA 4DLRA 1SC6A 2NYAA 1UMKA 1T0PA 3FB1A 1JIQA 1KJ8A 1YZHA 4H1HA 4N82A 4PZZA 1VHJA 3QUBA 5FWAA 5G0VA 1QF7A 2BGGA 1I0ZA 4L4UA 1U2TA 1WW3A 4B84A 1I1OA 4R1LA 4G0QA 5GTDA 2QP3A 4RGVA 5AKEA 4PC2A 3K70D 1OYOA 2EGHA 1P9OA 1HYEA 1SVKA 2CMKA 2PPLA 3M3DA 4AYWA 4BQOA 2ECKA 4UMEA 3ONFA 2WPDA 1X0XA 5TXGA 2IBSA 4OAQA 2NYVA 1DGQA 3DT9A 5KEIA 4AZ3A 1UBLS 2V3WA 3QUCA 3L04A 4YV1A 2QTGA 3ZE9A 2BR5A 1VGQA 4J16C 4RTQA 1UKZA 1SA0A 3UJ8A 2E9SA 1KQGA 1VL8A 2L0XA 2P79A 2Z1DA 3K1ZA 3RTAA 3SC4A 3B1XA 3B48A 4UPEA 2G09A 3KPUA 3F2IA 4YR7A 4MLPA 2WAOA 1R0CA 1OQAA 1ZD5A 3E9RA 1KJYA 2Q62A 4JJGA 3WYDA 4DNOA 1K06A 3X2FA 4UVGA 4CTOA 4XSVA 2OESA 2WD9A 2IP4A 1MCZA 3B70A 3HYLA 4RWEA 4OHYA 2ID8A 1EFKA 4OM8A 1VRVA 1C3XA 4QLBA 1B2RA 4JP2A 3KQOA 4O02B 1EFLA 4UM7A 5AVWA 3KYCB 2DECA 3K35A 1W85B 3SCZA 1NUPA 4U9UA 1J0CA 4EY8A 1R6AA 5EJMA 4Z8YA 3JWHA 1MJ5A 1WTAA 3KBOA 3C8MA 2OXRA 1SC9A 4F5ZA 2ATXA 1ENPA 4TKLA 5EP2A 1DRUA 2DJIA 3PDIB 1SIOA 3NGMA 1E2GA 4HQKA 2C3OA 1XRJA 2AN1A 4AZVA <