4EQ6B

The crystal structure of psy3-csm2 complex from budding yeast
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
237
structure length
210
Chain Sequence
MEVLKNIRIYPLSNFITSTKNYINLPNELRNLISEEQESKLGFLHIIESDFKPSVALQKLVNCTTGDEKILIIDIVSIWSQQKQRQHGAIYMNSLSCINITGLIVFLELLYDSPMDALRRCQVNFNFQLRGIVIDNLSFLNNLSKFEKLFKILRKLREFLGCWIITKSFPTDFYNGIENTLVPTKLPDSYMKGMDLIIYREVGRPQYRRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromosome segregation in meiosis protein 2
publication title Structural and SAXS analysis of the budding yeast SHU-complex proteins
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 62
structure length 210
sequence length 237
ec nomenclature
pdb deposition date 2012-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16836 PSY3 Shu complex component Psy3, DNA-binding description
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4eq6B00
4C2TA 1ZU4A 1YJ5A 1N5LA 4QBGB 5FBVB 4L16A 4K8OA 4Q9LA 4G3XA 1C1YA 2QN6A 4P0TA 1LVGA 4MYCA 3GJ3A 2ZYVX 1Z6XA 4QKQA 4XTRA 4IDNA 1VTKA 2QAGB 2EQBA 2I3BA 5AUQA 2CDNA 2A7QA 1AZSC 1P6XA 2A5FA 3MAAC 1MABA 3T5GA 5HKKA 1FUUA 4DSOA 1DE0A 3QXCA 4E03A 4A4DA 2FGJA 1KI3A 4EFNA 3VR3A 2OFWA 4D4LA 1XXHB 5A4JA 4NDZA 5EP4A 1CJTC 3HP1A 2GCOA 1P9RA 1NVXQ 2OLKA 3I73A 2G3YA 1ZNXA 5JJKA 2GJSA 1BMFA 3ONWA 5FTLA 2PBRA 2ZSFA 4XIGS 4P4UA 1E98A 5A0FA 2ZRLA 4MDFA 3IPYA 1NN3A 1X86B 1W36D 2QUZA 4A9AA 3IEUA 2KE5A 5JJLA 3W3ZB 1E0JA 3QOFA 4Q03A 3BFXA 1AK2A 5AWFC 2JLQA 2EU8A 2ZJOA 4BPBA 4GOJA 1XWIA 3HU3A 1UKEA 1G20E 4NPHA 3KQHA 4MYHA 4JT4A 2LKCA 4KODA 3VR4A 4NYJR 4RKFA 1OHHA 1ZBDA 2A9KA 4TMKA 3X1DA 4MH0R 4Q1CA 3GLIA 3PEUA 2GEVA 3CR7A 2W6IA 4HAUA 2IC5A 2ZRMA 1XCPA 1XU4A 1C9KA 1JALA 4HLQB 1EG7A 4S35A 4GP7A 4CZ2A 1BO6A 2ZJYA 4TMZA 4JL8A 1PZNA 2P2LA 2IUTA 1I4LD 2OLJA 2W00A 2ZVQX 5EE3A 1XJQA 4PANA 1XMJA 4Q7MB 4D4JA 3IO3A 1S8FA 1X3SA 4UQOA 4B3DA 2G77B 4LV6A 4NKRA 3VQTA 5JHHB 4RFSA 4B76A 1XTQA 2HLDA 3TR5A 2QTVB 1S9HA 4RY2A 5GADl 3PXGA 3SI7A 3O8DA 3HPQA 4V0NA 3BH6A 4OHXA 4JLOA 1FQJA 2VHQA 3K0CC 3LY5A 4M8NE 4B35A 1UPTA 2XB4A 4XWAA 3QKRB 4ON9A 3R9WA 2CE7A 3VX4A 5JWHA 3TBKA 2B6HA 4NE2A 2QRZA 3UMRA 1OYYA 2GXAA 2LCFA 4NYJQ 4DZZA 4YXWA 2GBLC 4FWIB 3QSYA 2P5TB 3OEED 4YMSA 4A82A 2GEUA 4HZUA 5KTYA 1E0KA 3OF5A 4QOSA 5IRCD 2QGZA 3VMFA 1ZM9A 1LS6A 2J0SA 3WP1B 1YE8A 2ZRHA 1YVDA 3QF7A 1KDTA 1XDBA 5FTKA 1ZNZA 4KYIB 2BKUA 3A1VA 4A2PA 3REGA 1KJWA 1MO3A 2ZANA 4O3MA 5LB4A 1KY3A 3OESA 1E0AA 3RC3A 5E3HA 3GCGA 4US1R 3UANA 5M04A 2H17A 3HDTA 3KXIA 1Z0DA 1S1MA 3U44B 2WZQA 1P3JA 1OH8A 3RNLA 1GL9B 5JS8A 4LHZA 4XWKA 4HEJA 2IT1A 2PX3A 2KSQA 3PIRA 3BXZA 4BASA 2GZAA 2WSMA 1EFUA 2I1VB 4N1AA 3RC8A 2VPPA 4X8OA 4YONB 2QQEA 2CHGA 2R9VA 3VX3A 4AC9A 1OYWA 4CEIB 3N70A 4AYTA 1L4UA 1W0JD 2QM8A 1NVVR 4LY6A 3W5IA 3TIFA 1KO1A 3EZ6A 1YZKA 2YOGA 3TE6A 2QMEA 2D2FA 3Q7QA 4AY2A 4CT5A 4MA4A 1US8B 2ZRIA 1M7BA 3B60A 3ZLJA 1IY0A 2GWHA 4ACAA 3OAAD 3OIYA 4IHQA 1YR6A 4CVNA 2DPXA 2ZXUA 5FL7D 2H8KA 1G41A 3AF0A 3KB1A 1NN0A 4QJ5A 4C3ZA 2EWWA 4XVRA 1G6OA 2IS6A 1XCGB 4E09A 1OB2A 4YC7A 1UKVY 1VPLA 2G0NA 4NYIR 4DJTA 4EIWA 4Q1DA 221PA 1N6OA 2F1JA 4Q7JB 1COWD 3ASYA 4PC2A 2DFTA 1YR8A 2J41A 3AVOA 3HR8A 3UWKA 3MJHA 4BZQA 2QAGA 2ZI7A 4ACBA 2O5VA 3KKPA 2BKEA 3MGCA 3B9PA 2C9CA 5CB8A 1D2MA 4O0MA 1EK0A 5BN4A 1R0WA 5DYIA 5JCZA 3M6AA 4PXAA 3LO5A 1R8SA 5FOTA 3WYFA 1XXHA 3EPLA 1NVVQ 2ZJAA 4QC2A 1U0LA 1O3YA 2G1JA 3KJIA 2OZEA 3KUCA 4HLDA 1OLOA 3OHMA 2NO1A 3SQWA 4TYYA 2QORA 3X2SA 2CE2X 1SHKA 2O8BB 4AURA 1FFHA 1G291 4ILEA 3EZ2A 4JZKA 1YHNA 1YRAA 4K46A 2WJIA 2XNSA 1DAMA 521PA 1F48A 1P2UA 3MWYW 4A0GA 3BFKA 1D2NA 1E1QA 2GJAA 1E9RA 1UKZA 5FTNA 1JB1A 3O8RA 3DEFA 2FSHA 1E79D 1VG9B 4X8HA 1IHUA 2ZUCA 3GLHB 1P2TA 3LLUA 5C1BA 4NYIQ 1NSTA 3WMFA 3AVQA 4PHFA 3LVQE 1BYIA 4MITA 1FUKA 1G18A 1UBEA 3K9GA 3X1WA 3ZVNA 1AM4D 3F0TA 2V7QD 1IXSB 3LDAA 3VKWA 5HR5A 1J90A 2A3RA 3LW8A 2MSCB 2WJYA 4OKSA 3QVVA 2VP4A 4CEHB 4Q9KA 4HDOB 2HXYA 2P6NA 2JJ1A 1CJKC 4O25A 3P20A 1MRNA 1N5IA 4PAMA 1A82A 2F9MA 2GCPA 2OUKA 2CLSA 4MRNA 2J7PA 1HE8B 2IYUA 5GVRA 1Z07A 4AD8A 2QEQA 5F3WB 2WMOB 2Z5FA 3QXXA 4QBHA 5SZJA 2J9RA 1SZPA 3K1JA 2ZRJA 5SZKB 3TKLA 2J1LA 4HLCA 1D8TA 3Q9LA 2AFHE 1A2KC 1Z2AA 4OL0A 4NTZA 4KFUA 1EFCA 1G3MA 3ETLA 4FCVA 4PO8A 1ZCAA 3OFNA 1NJGA 1LFDB 5CJPA 3SHWA 4JLJA 4LJ6A 1DEKA 4URWR 3WY9A 2Q3HA 2FZ4A 4HUQB 3CPHA 1CP2A 3FPAA 3QKRA 2O8EB 2FV8A 2RHDA 1CR1A 2GVDC 5UKDA 1T8TA 1Z29A 5FI0B 1TQ6A 1ANKA 1ZYUA 1E2NA 1HA3A 3G82C 3RLFA 4B2IA 4RJLA 1N6LA 1VIYA 1NVWQ 2C9YA 1N6RA 4JKIA 2XITA 4PQRA 3PQCA 1PLJA 3DDCA 2RGGA 4EQ6B 4FMCB 1PV4A 4G01B 2JDIA 1D5CA 3QJYA 2F3TA 3RS4A 1Q1ZA 3HYRA 1TNDA 2OCPA 1W4BA 1CJUC 4NMMA 4X8MA 5L3RA 3CKLA 3ZQJA 2CJWB 3W8NA 4ZIRB 3HU2A 4AIIA 2FPKA 4TSFD 3EASA 3LV8A 4L4UA 1P2SA 4JKYA 3PCRB 3SJZA 3Q8XB 1KDPA 3C16C 2ZAOA 3DVLA 3LXXA 4LOAA 3EPKA 1KKLA 4DHEA 4US2R 3U44A 1GL6A 3WYAA 3SFVA 3ZDQA 3ZJYA 4BWYA 1DAKA 3CNLA 1E2KA 5CLLA 3Q85A 2E87A 3CRQA 4G5RA 3X1XA 1FMLA 1ZC4A 5J4YA 2VIIA 4TTPA 5KPJA 3O8CA 1WA5A 4HAXA 3A6PC 1WE2A 1W36B 4CEIA 3IBYA 2ZYUX 3W8RA 1J8MF 3EZ9A 4YQFA 1XD2B 3EPHA 1ZM4A 1W0KD 4GPTA 1UF9A 4LV5B 1ELOA 1QHYA 1Z2CA 5FOUA 4B6FA 1TF2A 1US8A 3GJ4A 1CR0A 4M9SA 4AYWA 2GXUA 4KU4A 5FOXA 3T1OA 2BBSA 2H57A 4JLDA 1N25A 1CIPA 1DAGA 3QUSA 2D7CA 4JL6A 4DUGD 1M7HA 4MYUA 3F5FA 3BBPA 4BRUA 2PEYA 4D0LB 4Z1MD 1W4CA 4TQ9A 5HTKA 1XJ0A 1E2LA 2ZROA 4DKXA 3QVUA 1AKYA 4JYCA 4DT1B 3CX7A 3T12A 2PJZA 2J3EA 2YVUA 1P73A 4KFTA 2F1HA 3UK6A 4HI0E 4B74A 4DB4A 1OE0A 3FWYA 4AG5A 4NL4H 1GILA 2F1IA 2FMXA 4PAOA 1OXXK 1GNRA 1Q44A 1GG2A 3IBGA 4QBFA 2ZI3A 4RFVA 3QEJA 4D2IA 4QGHA 4YDHB 5HZHA 2Q21A 2Q3FA 4A0RA 2F7SA 621PA 3Q72A 5JWOA 2I1QA 1NJFA 5CIWA 1G17A 3OIUA 1QHNA 2OM2A 2WWXA 4TQUS 4C0AC 1NMZA 1NNEA 3ZD7A 3BK7A 3NG1A 2FFAA 1KI8A 1ZINA 2O8BA 1P5ZB 3NDPA 4EFMA 3P27A 3SYNA 4Q00A 4BFTA 4TTRA 4Z54A 2HJVA 2OBLA 3L0SA 3VR2A 4AI6A 1P9WA 5C4GB 1T91A 3FE2A 5FPKA 2OESA 1VYVA 1CKEA 3U3JA 5EXTA 1KMQA 1OFIA 1KAOA 3K9HA 1GUAA 1R5NA 3GLHA 3QXSA 3IO5A 1JI0A 3A1UA 4QL3A 2QROA 1XTIA 4YLGA 1NKTA 2AKAB 2QU8A 2ZRCA 4S2EA 2VP0A 4QHSA 2GF9A 1E2PA 3BORA 1UEJA 2YV5A 2GK6A 4DSNA 2LKDA 4OQLA 2D74A 1W4RA 1G4AE 1XF9A 2J0VA 2GTPA 4CEHA 2WTUA 2DWPA 4DXAA 3I8XA 2ECKA 1MOZA 4Z51A 2CK3A 4IVRA 4Q9HA 1P60A 3BH0A 1IXZA 1W49A 5CM9C 5LPNA 1ZC3A 2ZSBA 4GT1A 1H8EA 4KHZA 5TB5A 5EZ5A 1GRQA 1EWQA 3CNNA 1XMIA 4LBYA 5J40A 2AD5A 2IL1A 4P3YA 4B2LA 1NG1A 3I62A 4IKEA 1G16A 4JLAA 1Y3AA 1Z83A 4LJ8A 4C4PA 1VKJA 1KJYA 2WKQA 2WWFA 1YZGA 4M21A 1JPJA 5AJYA 2QMUA 5GJVC 1CR2A 4C7OB 1IBRA 3PVSA 2ZE8A 4AWXA 3JVVA 4HUQA 2CL0X 2O8EA 1NBME 1HV8A 1M34E 4MUBA 3P4YA 5EE9A 2JJ2A 3FKQA 4ZI2A 1CJMA 4TN1A 1KOFA 5CK5A 3E2IA 2VF8A 4Q9IA 2PT7A 3U3KA 5JRJA 2GCOB 2QG6A 4LBVA 3L82B 1UBCA 5DSZA 3EXAA 1GRRA 4EQ6A 2CCKA 1E94E 4QG7A 4HDCA 4CIDA 4MGYR 1HUQA 2WJVA 1XTKA 1OIVA 3FMPB 1M7GA 3LRPA 2CJWA 2OCBA 3AP1A 4ZIRA 3FMFA 2VBCA 5JFGA 1II0A 4A8JB 2HJGA 2PX0A 1NY6A 1ZIPA 2ZVPX 3I92A 4URUR 4D80A 5KOYA 3QNUA 1GIAA 3R7WB 4LV8B 4C9BA 2EYQA 4IEIA 3L0PA 2HT6A 3E1SA 3AVWA 1KO7A 2EYUA 2GJKA 2XX3A 1XTJA 4GMXA 3ZVLA 1SXJD 1T4GA 1D2EA 1T5LA 1CXZA 4G5GA 1N5JA 3RANA 2QMOA 3L0IB 1EFHA 1AGPA 2BJVA 3DOEA 4C0JA 2G0TA 2OBMA 3CH4B 1FPMA 2O52A 1FNNA 1G3QA 2NIPA 2RAPA 5JBQA 1JEDA 1Q0UA 1HTWA 1XD2A 3LBIA 2NPIA 1CR4A 1RRPA 2R8RA 4WZBE 1T9HA 3B8HA 4B3BA 4HUTA 1B23P 4RFSB 4LJ4A 4NCIA 5HE8A 4OHWA 1Z0FA 4AYXA 2HYIC 4EJSC 5CLQA 2O0JA 1GWNA 1A1VA 3T35A 1LS1A 3I3SR 1PJRA 4NBSA 1R5OA 2Z4SA 3H86A 4M2LA 1U98A 4I1OA 3K8YA 4DDTA 5FBLB 3TK1A 4ZPXA 1DS6A 1Z3IX 4Z8XA 1OIWA 4DT1A 3RVBA 1QDEA 4P4SB 1TEVA 1W47A 2PMKA 2BEKA 4UNQA 1SGWA 3SBEA 2IW3A 3FOZA 3AM1A 5KDLA 3PENA 3P1JA 2IYWA 1S96A 3T15A 1E2GA 4LBWA 4M53A 5KUTA 3A58B 2IYVA 2SHKA 4DLXA 1U8AA 1KSJA 1RRGA 1T0HB 4L9WA 2P67A 2FJUA 3ZVMA 1TU3A 4RZUA 4QGAA 2E9SA 1WRBA 3OIVA 3EARA 3EIEA 5K8IA 4V0ME 2CCGA 1Q1EA 3H4MA 1KJZA 5GJWC 2HT1A 4II7A 5LDDC 4BZPA 2CK3D 1T5IA 2ZI6A 3AVVA 5H68A 3NEYA 3OEEA 4PPGA 2FPMA 1ETUA 2REBA 1KKMA 2KBEA 3I8SA 4FMCF 1DG3A 3LBNA 2UZIR 1SKQA 4TTQA 1R8QA 3T1QA 1KK2A 3AVPA 3GJ5A 2RGCA 3TUIC 4DBLC 2D62A 4A0FA 4RZXA 4KXFB 1GL7A 1ZVQA 3WNBA 2B8TA 2F55A 1XP8A 2V1UA 3TQCA 2OFOA 4GI7A 4I1SA 3H2YA 1F6BA 4GFDA 4GMDA 2WWHA 4NYMR 2F6RA 2D7DA 2WV9A 1G6HA 2JCSA 2C98A 3LNCA 2OXRA 1Q20A 3W5JA 2Q9AA 3MCAA 1RYHA 2ORWA 2ZR0A 3B1ZA 2QA5A 4JSTA 5DN6D 4L9SA 3ND8A 1W4AA 5JMTA 1R0YA 1OIXA 2R65A 3MMPA 2RGNA 3BRWD 2IHYA 2Z4RA 2GESA 2X2FA 5LBIA 721PA 2OFXA 1JR6A 1UM8A 1QHHB 1IJEA 3PR1A 2AKYA 4TWZA 4JJKA 1W0JA 3ZQ6A 4C7OA 2EFGA 4ASUD 2CBZA 2XJ9A 2ODBA 2G88A 4WA7A 1G1MA 3LLMA 5J4VA 1KGDA 1CJVC 4W5HA 4JLMA 4DDUA 1OPXA 2AD1A 2XZOA 1JBKA 1QHXA 3OAAA 4JJZA 4M4SA 3F3YA 1BKDR 1DAEA 3U6KA 1Z8FA 4BLSA 5FL7A 4PO9A 2JATA 1JXMA 5J4KA 4B33A 1XB2A 2NTYC 2PCJA 2PH1A 4NYMQ 1TUIA 4Q5IA 5G40A 3NVAA 3ADKA 4DLTA 821PA 2O0HA 1G4UR 4WIAA 1COWA 1VMAA 3U7HB 2AXPA 2FFHA 4V0LA 1YU9A 4C0HA 3ADCA 4UNPA 1Q3TA 4A8JA 2WWWA 4AKEA 5BWMA 2BMJA 1E99A 4OI0A 3R7WA 2CHVA 4KVAA 4LHWA 4HAWA 2EFDB 1WBBA 3ZIAD 1KO5A 4PTLA 1JPNA 5G41A 5J4HA 3AB3A 1ZUIA 4XTCS 4U00A 1SHZA 3BJIC 5DE3A 1M74A 2R62A 4BLPA 3AKCA 3KJHA 4PPFA 4R2IA 3K0EA 2Q6TA 3C5CA 2CEAA 3REFA 2Q0HA 3ZVRA 1L2TA 2OE2A 2G9NA 4IOLA 5B58C 1E79A 3IPXA 1IN5A 4V0OA 4WAUA 1EFRD 2O8CA 5CDFE 1G7RA 1ZD8A 3LVRE 2PL3A 1OXSC 4FMDB 4LK2A 2AX4A 4OK3A 5DHFA 2ZQ5A 3WMGA 4JBYA 3IHLA 4GBMA 1RIFA 1MO5A 2V7QA 3Q5DA 4LJ5A 3CPEA 2ONJA 1KI2A 3PJRA 2KB0A 3DMNA 4BFZA 5JECA 1P9NA 4LJYA 4D25A 3C41J 3LQRA 5E7IA 2YYZA 1J8YF 2DR3A 3GEHA 2FSFA 2Q9CA 5BN5A 4RZ2A 1WXQA 1VYUA 3T34A 4U7DA 4P4SA 4CYMA 1A2BA 3UG6A 3I61A 3Q3JB 4WXPA 5KDDA 2QNRA 3LBHA 3D6TB 2A5GA 4URZR 2OT3B 3L8YA 1ZM7A 4TL7A 3SZRA 1IY1A 1NBMD 4Q4HB 1IXRC 3A37A 3FFAA 2VRWA 1QG4A 3QEOA 3EPJA 1H8HD 2VP9A 1MO4A 4DVGA 5KYKA 3KFVA 1RW4A 5L3QB 4UNSA 1YZLA 4PQYA 4M1MA 4Q48A 4JLKA 1FNMA 4LX0A 4CT4B 4OI2A 2GCNA 5TDHA 3VKHA 3KKNA 1TQDA 2ZS8A 1AS3A 3BE4A 3IGFA 4L15A 3K53A 2QY9A 3KXKA 5H8WA 3FKSD 5FOVA 3SYLA 2FH5B 2QENA 4ZDKA 2PMDA 1KSGA 4JVLA 5B64A 5GVSA 3V00A 5JLJA 3CWZA 4P32A 4F38A 2FFQA 3CUEF 3LXRA 4GZLA 4Q1FA 5KDOA 3DOFA 3EA5A 3MD0A 2X2EA 3IIJA 1F60A 1D6JA 2FSIA 4QXAA 4QHTA 5B57C 4AKIA 3QENA 4K81B 4JLNA 1M6NA 4TSFA 2QT1A 4PPNA 2JLYA 1AIPA 3WRYC 1XNJA 3KTAB 4LHXA 2H92A 3DMDA 4AK9A 4A6PA 1E2HA 1E2FA 1X1SA 4BRWA 3QPUA 5KHOC 2Q9BA 2RGDA 1JNYA 1OXUA 3KX2A 1IM2A 4US0R 4OK6A 5FUWA 1NVUQ 2QT0A 1R10A 5BYKA 4HAVA 1SXJB 1QVAA 4ZDIA 3GJ6A 4UNRA 3CRW1 1QHHA 4XSGA 3AF3A 4ZDJA 8OHMA 3PV0A 3NBFA 4OQNA 4IVQA 2V3CC 1A5TA 3GLFE 3FGNA 3SN6A 3J81k 3SJAA 1Q12A 2J87A 3M1IA 1W0KA 2IYSA 4PO1A 5DISB 1S2MA 4HAZA 2F43B 1OXTA 5IF9A 1HT1E 1GVNB 1UDXA 4B44A 4BFYA 1IQPA 6Q21A 2QTFA 2WSSD 4A15A 4KYUA 4HZIA 4M9QA 2RKOA 4DUGA 3CWQA 1G7CA 2MMCA 4LSGA 2NO0A 3B85A 3WNDA 1RZ3A 2AFIE 2VHJA 1ZP6A 4Z1MA 3WBKA 4ABYA 3W6OA 1NL3A 1KDOA 2ANBA 5LB2A 4JMPA 4PPQA 4JS0A 1IN8A 1OB5A 4TYWA 2QAJA 1JAHA 3K0AA 1XEWY 3TUJC 5TV2A 2RHMA 3NHAA 5CIQA 4B34A 2IYLD 3IILA 5HPYB 5EP2A 3U61B 5J47A 1UDWA 1WB9A 3BIFA 1R0XA 4A2QA 2IF2A 2OCAA 1XX6A 2C9OA 2ZRGA 1FOEB 2H7VA 4G5OA 1BH2A 4OI4A 2GVZC 1BYUA 5J5CA 3THXB 4KVGA 1RE0A 1J7KA 1Q1BA 3Q7PA 1WBDA 2ZRKA 1G8FA 3SEAA 5B2ZA 4BLTA 1OFTA 4JYBA 3RWMB 3DHWC 3AVXA 3FDIA 3NBXX 3KKOA 2YWGA 4BLQA 5D3QA 4EPVA 3T1TA 4HB2A 3P26A 3RABA 3IIKA 3KXLA 4JIMA 1XPOA 2D06A 3WBJA 1EFTA 1YZUA 2IS2A 4D81A 3B2EA 4IXMA 5LD2C 1VG0B 2B7CA 2IA5A 2DBYA 1OJLA 1OFUX 3NHBA 2ZJ8A 2H1LA 3C5HA 5HCIA 3G0HA 1EX7A 4G5SA 5FTJA 2JLXA 1FX0B 4KJZA 4B3FX 1E2QA 2ORIA 1FMJA 1X6VA 2QBYA 1QRAA 2UZ3A 5L3SB 4IXNA 2QPOA 4IOJA 2GA8A 5EXPA 2JJ8A 2A2ZA 2ZEJA 4DLRA 2YJTD 5J4LA 1DVRA 3DM9B 4Z8YA 4KBGA 4B32A 1W1WA 2ERYA 3ICQB 3NTUA 4BE7B 3LFUA 5EXXA 3O47A 3SFZA 4BQSA 2FF7A 2QPAA 2BBTA 4Q4HA 1N6PA 1NRJB 1RC8A 1G3IA 4V02A 4TLCA 2FWRA 4UXJA 2VSOA 3TVDA 2XB2A 4E22A 2C99A 3RHFA 2WIAA 5L3QA 1G21E 1U9IA 1YZQA 1SVSA 4WW0A 421PA 3TR0A 2IYYA 4RD2A 4B2PA 4EPTA 2DB3A 1RRFA 2BV3A 2JA1A 1U2RA 4LDJA 3ZH9B 2RB4A 4PSAA 4R2HA 5G53C 1WF3A 1CLUA 1VCIA 3RS0A 5DO9A 1FZQA 4DLWA 2DWOA 1OH7A 4LC0A 4TYPA 4B73A 1SVIA 1UEIA 1HURA 2VA8A 2PZFA 3KKQA 4D6PA 4CRWB 2QE7D 4PZYA 5G3ZA 4BFWA 3JVUA 4BFSA 3EIHA 1RKBA 4PSVA 4GOXA 1NF3A 3RSOA 3DL0A 4LCBA 3TMKA 3BB4A 1EWRA 4MKGA 3KTAA 2ZITA 3RDPA 2JEOA 2E1RA 4LGMA 1TX4B 3M0EA 1ZJ6A 2YWEA 4RD4A 1ODFA 3Q5EA 1V43A 3C15C 4POAA 5BN3A 1LTQA 3NC1C 2G83A 4FW9A 5CYPA 1CRPA 4R9UC 2JAQA 2CVFA 4RCZA 1SXJA 4OBEA 4TMXA 3A36A 3MRSA 2AR7A 4Y0VA 4LHYA 3PUVA 1HYQA 5K8UA 4B6EA 4ZCIA 3PUXA 2VQSA 1T0JB 3HYTA 4XSHA 4OHZA 2ZI5A 3AGQA 4D82A 1E9FA 1SQ5A 2W2VA 3I4LA 1TU4A 4IJMA 4XH9B 5CM8B 1YKSA 1Z28A 1NLFA 2OILA 3T06B 1P75A 1Q1QA 3C7KA 4KAXA 2F43A 3SNHA 1BIFA 5DHAA 1KZ7B 3AF1A 1E9BA 1LF5A 4M1SA 3LX8A 1QVRA 1HH4A 4DCVA 2ZRPA 2W2TA 3K9NA 3AH8A 1EESA 4F91B 2GEDA 2GK7A 4NH0A 5DLQC 5FPYA 5BYJA 2PCLA 1ZD1A 5AJWA 5DI3B 3KFXA 4PR0A 2BMDA 3B1WA 1ZRHA 2ZE5A 3MWLA 4F7WA 4DDVA 2FEOA 3FHCB 1Z08A 1KNXA 1LF0A 2QRNA 2J7KA 2HF8A 1OXVA 3AKEA 2IF0A 1Z0JA 1IN6A 5FI1B 3SQXA 1GDDA 1LB1B 2OV2A 1T3SA 2RGNC 2NO9A 4F92B 1AA9A 5K8LA 2IS4A 5JI2E 1VCNA 1W46A 3VR6A 2ZI9A 1JXOA 1G5PA 2K5UA 3THXA 1WQ1R 1ZCBA 3AEZA 4XVQA 2VP2A 3WYGA 4D4KA 4PZZA 1YQTA 3QE0A 3A8TA 3ADBA 2BDTA 2NO6A 3GLGE 5FOWA 1FTNA 1HE1C 2A5YB 4NU0A 4DSTA 5CK4A 5ELXA 3OZXA 1W5SA 2ATXA 2HF9A 4AKHA 1GP2A 2ZJBA 2NOAA 3QKSB 2W58A 2ASEA 1NY5A 2PLFA 2J0UB 3A4LA 2PZGA 3ZGXA 2FZLA 2VL7A 1XTSA 1XPUA 1F2TB 3EW9A 4QM7A 1KSHA 1KZGB 4A1FA 4PSKA 3TSWA 2WPDD 5JSZB 4Q4JB 4RD3A 3CLVA 2AL7A 4A8JC 4MDEA 3FVQA 1FX0A 4TYNA 1ZIOA 2ZI4A 3TH5A 4MGIR 1QHIA 3ICEA 2CLCX 2QSYA 5L3SA 3BOSA 2OO7A 2OEPA 4DCUA 2ZRFA 4FIDA 4TYQA 1RVDA 5L8VA 1Z0AA 1G3UA 4OJKA 2C2HA 1GKIA 1N0WA 1U90A 2NGRA 5DN6A 3TW8B 2FSGA 4BEJA 2AXNA 1G7TA 5IT5A 1E1RD 5FTMA 4EPWA 3U3OA 4W5WA 4GRAA 4PX9A 1TUEA 2VHUA 3KKMA 2YHSA 4E07A 1XTRA 2XGJA 1N6NA 1OV4A 2WWGA 1JECA 3TLXA 3E5HA 1G3RA 1L8QA 5E95A 2WKRA 2JLUA 1E4VA 1JR3E 4M1YA 3R9IA 1RYFA 3EA0A 4ASUA 1N6IA 2P5SA 4KLNA 4DCSA 1KY2A 2JGNA 4XWOA 4FWTA 3RAPR 4DRZA 1SKYE 5C18A 3HR7A 2XEXA 1E9AA 1VIAA 1OF1A 1K5DA 1GRNA 2XNDD 1I2DA 4TMWA 3ZD6A 4DB2A 2PLRA 4TT3D 1ZMXA 2QMHA 1GKYA 2WAYA 4MKFA 4MKIA 1G8PA 3DKVA 3FTQA 2B7BA 3CIOA 1Z5ZA 2YINC 2J59A 5JS7A 4UJ5A 1OSNA 1U8ZA 2Z0MA 3UIEA 4MRVA 3V9PA 2WM9B 1Z6TA 2OAP1 2VP5A 2NMVA 2GZHA 2EWVA 4JL5A 3WNCA 3SBDA 4URXR 2OAQ1 4URYR 2HCJB 3GJXC 5TY0A 4F93B 2FU5C 1N3BA 3KL4A 2O8CB 1NN1A 3PUYA 4N3NA 2V9PA 1EX6A 4GNKA 2VO1A 4KO8A 3R20A 1IN7A 3GFOA 3FYHA 3K0SA 4M1WA 1MV5A 3ZIAA 3MSXA 3N2EA 3X1ZA 4EAQA 3K70C 1NKSA 1X8LA 5IK2D 1IAQA 2R6AA 1ESNA 1B0UA 3MG9A 4RD1A 4LPSA 3UATA 1XEFA 1X8JA 3GJ0A 3QBTA 4KBFA 2J0QA 2ZR9A 3ADDA 1JJ7A 5ANRB 3RSLA 5TVKA 4NCKA 3IEVA 1WP9A 2FA9A 3EX7C 1D9ZA 2V8OA 3VR1A 1RPZA 2C5LA 2NQ2C 3D7MA 5JWRA 1EFRA 5EJEA 3KQLA 2XOKD 4KSCA 1KO8A 4IDQA 2GAAA 4Q1BA 3BB1A 2FDCA 5KO2A 2ODNA 5P21A 2W0SA 3D8BA 1VG8A 5KNBA 1DO2A 3T61A 3U4QB 4UNNA 2RMKA 4DLSA 1PVOA 4QJ3A 4A0HA 1KNQA 1CRQA 1FP7A 5DI3A 4I1UA 1GOTA 4LUCA 3SU8A 3GEEA 4EDHA 3GLIE 4JLBA 2R6GA 4GSYA 4YMTA 4N0EA 3SJCA 4DCTA 3RYTC 1SVLA 3LD9A 3AF2A 1JQJC 2CHQA 1P2VA 1Z6AA 2WMNB 2KWIA 1VCMA 3AP2A 2D2EA 5HE9A 3VNUA 3VNVA 2ZS7A 2AN9A 2BIFA 2F1RA 1FL9A 3JZMA 4HB0A 4PHGA 3WRXC 1VG1A 3C8UA 4PAQA 1NBMA 2GJ8A 4EJSB 2CXXA 5IHPA 3NC0C 1DO0A 2AHOA 1H8HA 2WOJA 4MRRA 4Q02A 2QAGC 4D0NA 4QM6A 4ZCLA 1KIMA 3AVYA 2C04A 3CONA 4EPYA 1AGRA 3DPUA 1N5KA 1NI3A 1KHTA 1R6BX 4TLBA 4IDPA 3QG1A 5C46F 4JBXA 3EC1A 2ZAMA 4JVSB 2D3WA 3GP8A 4LHVA 2WWYA 3FKSA 3B1VA 1H65A 4LWZA 3QKSA 1KTVA 2OBNA 5DYGA 2J0UA 3O8BA 3THWA 3I1FA 4A36A 1FQKA 1KAGA 4LYFA 4ERNA 2B21A 4NP6A 1F2TA 4J0QA 4MQBA 5EXSA 3SR0A 2QPTA 1S3SA 4JLPA 5JSZA 5FR1A 3TGPA 4Q4JA 2QQ0A 3B78A 1E2JA 1U0JA 4X8LA 2CL7X 3SYKA 3H84A 4OQMA 4NCNA 3MLEA 1SVMA 3U7FB 1C4OA 1K6MA 5KSOA 2TMKA 3WHLA 3TNFA 2BHRA 2I4IA 4OQFA 1U99A 1KI6B 4M22A 1ZW6A 4NCJA 4PC7A 5AK0A 1IONA 3U2QA 2J46A 1WMSA 2VSXA 1J70A 4Q66C 2WJHA 1SVKA 3WMEA 1DAHA 1ZUHA 2A78A 3SE0A 5JI3E 1P72A 3NBYC 2KBFA 2WKPA 1OKKD 2VTKA 2HEIA 1AS2A 2P0EA 3EC2A 2CNWD 4DIEA 2XTNA 4G1UC 2YOHA 5FBQB 2ZYTX 1Z0KA 2VLIA 3OE7D 4RCYA 1S9DA 2DY1A 4MKHA 2YNMA 3UXMA 3GPLA 2DFLA 3W9YA 1CEEA 1X1RA 3K0AB 2VP6A 1K8RA 1XEWX 3IHWA 2ZR7A 3HPRA 3QKUA 1P61B 3QPWA 3GFTA 2XZPA 1G9XA 4E5UA 1G5RA 2ZRDA 2WSSA 1RJ9B 2FFBA 1CBUA 1AKEA 2EFCB 2R44A 2ZYWX 2FN4A 4DDWA 5KNCA 2XSZD 2WIBA 2C95A 2RCNA 4WXRA 1Z47A 2IK8A 2OG2A 2IS1A 5H1YA 2CCJA 1R0ZA 2WJGA 3VU9B 1T6NA 4PC1A 4TLEA 3W6NA 4XVUA 1JQLB 4LJ7A 3ZZ0A 5CB6A 4IOMA 3OIWA 4ZDWA 1G8YA 2QP4A 3B82A 4Q1EA 5DH9A 5DNYB 3N5CA 4OHYA 4LI0A 4V0MA 3EWSA 3UMFA 2R2AA 2X1VA 2H16A 3I5YA 5FUVA 3A1WA 3NBZC 3TRFA 2QI9C 4BLRA 2QP9X 4B75A 1LW7A 3CNOA 5GJBA 2ZU0C 2Z83A 4RKEA 5SZIA 2YKGA 4DC9A 1U9IC 3BC1A 1OT3A 3QI2A 2XZLA 1P4SA 4NCHA 4QBIA 2L0XA 3GJ7A 4BFUA 1II8B 3CRRA 1S3GA 1ZUNB 5KU1A 2QBYB 1XXHE 1HEIA 2C78A 2GILA 1ZD9A 3NH9A 5JJIA 2FPLA 1U8YA 4AKGA 1I4DD 2C96A 3A1SA 1E9EA 3OEHD 2C03A 3AUYA 1M1YE 4MRSA 1TQ4A 1NIJA 3GQBA 4RD6A 1OH5A 2W0MA 4Q4LA 3UPUA 2ZE7A 3FMOB 1U0HC 2BBWA 1DADA 4B3GA 3T1VA 4RVCA 4UXHA 2PEZA 1E2IA 1JJVA 4JT2A 1KSFX 3CM0A 1MO6A 4DCNA 3GEIA 3S1AA 3U4QA 2A5DA 2JLRA 2IUUA 4TLAA 5L3VA 5D3MB 5C2JB 2ANCA 1E2EA 2V6JA 2J45A 1UAAA 5AUOB 3FMIA 4QJ4A 3T5DA 1CU1A 2O8DB 2WOOA 2ZS9A 3AGPA 1DPFA 1SVOA 3UG7A 1HY3A 2IXEA 2BVNA 3NKVA 4FXPA 1UBFA 2GAOA 4IDOA 4MYTA 5E7JA 1Q3HA 2CVHA 2MSEB 4DLZA 1OH6A 1JR3D 3AV0B 3GLFB 3FHTA 3A4MA 1MKYA 1FP6A 1SXJC 2W6JD 1W7AA 3NDBB 5FUYA 1Z0IA 4JBWA 2X19A 1IN4A 1G8HA 2HYDA 4TLDA 2Q3MA 2OCYC 2ZSDA 5EP1A 4EJSA 2NO7A 4TL9A 4XD7D 1NG9A 3LA6A 1XZQA 2B92A 4P33A 2GNOA 1QF9A 5EE0A 2ZM5A 4H1UA 4I81A 1J99A 5DIFA 1QBKC 5JZVA 2Y8EA 3BERA 1GFIA 4ESHA 3U6BA 4B47A 2XTZA 2QSZA 3IUYA 4PQFA 3KUDA 1EXMA 2DWQA 4U5XA 1TF5A 3K09A 4HLUA 4V03A 1YRBA 5FBWB 2V6IA 3U7EB 3QPVA 1NLYA 5DI9A 2G1KA 1E32A 4KLZA 1QHSA 3CW2A 1N2CE 2GHIA 4MGKR 4NZYA 3TSZA 4KFRA 1AN0A 3E70C 1S1CA 3RRNA 1SVWA 1Z22A 5HZKA 1EGAA 4UXIA 1NMYA 4GOKA 3IKJA 5KSYA 2QE7A 1ZM3A 1Z63A 3L0OA 4M1OA 1ZM2A 2DFNA 3BAFA 3TJZA 4I1VA 4F4JA 2V55B 4U02A 3WXMA 1OFHA 2FE4A 5HKKD 2Z6VA 4RZ3A 3CR8A 2ZSAA 1KI6A 4DLUA 1UADA 4OJQA 1QG2A 4DEXA 2JLZA 1PLLA 2ZU6A 1XFAA 3N2IA 4QFMA 2O8FB 1N6KA 2HXSA 1JAIA 1KK1A 1BMFD 1E9DA 4IRUB 1AZTA 2ZJ2A 1GM5A 1CS4C 4LC1A 3ZZTA 4B71A 2WBLC 5CDFA 2V54A 2C8VA 2VEDA 1XZPA 2BCGY 4CW7A 3R9XA 4JLVA 1E96A 3B13B 3IIMA 3D3QA 4BLOA 3THYB 1WDTA 3KQUA 1GNQA 4C0QC 1NP6A 4OQXA 4BEBA 4XJXA 3MWJA 4MUAA 2XAUA 4Q01A 4M1KA 2ERXA 1KI1A 3CZPA 1W48A 5EE1A 3VHLB 2WJJA 3MUFA 1OW3B 1P62B 4O2RA 1OHHD 2REXB 1BS1A 1RJ9A 1X8KA 2W6ID 1AQYA 1PUIA 2BM1A 3P4XA 3CRMA 4HSEA 2PJRA 1T3HA 3QBVA 5HCNA 3AKDA 2IYRA 4FD2A 3EZ7A 4KITB 2VHCA 3QXJA 5JRZA 2R6DA 4IW3B 4FN5A 3ZZUA 4W7SA 3VU9A 2BOVA 2A5JA 2DCUA 1SXJE 2F9LA 2OXCA 2ZPTX 2V1XA 4TZ0A 4Q21A 1E2DA 3CX6A 2NPFA 4B48A 5TMPA 2HLDD 5CYOA 2BMFA 3AF4A 1Q21A 5KNDA 3SOPA 1F5NA 3B5JA 1DAIA 3FFBA 4I99A 4F4CA 2GF0A 3QG5A 4KV9A 5C4MA 2IYXA 2IYZA 1G19A 1AS0A 3KDSE 4Q4AB 3RWOA 2IXFA 2XJ4A 2H5EA 4ZCMA 3PITA 3U60B 2REOA 3QIAA 1II8A 1KMHB 3D31A 1ONBA 4WBSA 3NIBA 4JVNA 1KK0A 4EFLA 4YXWD 4ZI3A 3RS5A 1XD9A 3CX8A 4C30A 4B43A 5B30A 3AVUA 1NLZA 3BS4A 4LJAA 2O0KA 5A5GA 3RRMA 4PHTA 4TL8A 2R6FA 1NN5A 2KJQA 4W9MC 2FEMA 4D4MA 4C2UA 4HYYA 4M1TA 4DEYA 5K8TA 3C4JA 3ZS8A 2IEZA 2W2XA 1VYTA 4BZXA 2ONKA 1W36C 4ARZB 2WPDA 2WICA 3B1YA 3K70D 2ZJZA 4TL6A 4P31A 3GLHE 4PC3A 5AJXA 5D3MA 5FUXA 2JIZA 4G0NA 1K5GA 4HAYA 5EZ6B 1KI9A 3HWSA 1YR9A 5FPHA 4GDFA 3DKPA 5CITA 2O8DA 1GTVA 5FBRB 1A4RA 1YZNA 1T8UA 1Z06A 2QP3A 4GZMA 5EQTA 4TZ6A 1G7SA 1N0UA 1W2GA 3RRYA 4LJ9A 4AG6A 3GLFA 1E1RA 1DBSA 2ZE6A 4IVPA 1KO4A 2MSDB 4LRWA 3MWKA 4KSBA 3U7GA 4B3XA 1M2OB 5LD2B 4Q47A 1DAFA 2IYQA 1FTSA 2FX3A 3TUZC 3A4NA 1MH1A 3KJGA 3DZ8A 1TF7A 5F9HA 4L5BA 1NIPA 3A1TA 3JZAA 4QRHA 4G5QA 3K0CA 2JLVA 4FI3C 3FB4A 2P65A 1IY2A 3RRZA 2WWIA 3QY0A 1YR7A 1R5BA 2ATVA 1S0UA 3RS3A 4H9GA 5E4FA 2XNDA 1UFQA 2FNAA 3BWDD 1ZNWA 4Q18A 3TQFA 1XMSA 2ZUDA 2GBLA 4EPXA 2EFEB 4TMVA 1J2JA 4TT3A 4V0KA 5GJCA 1XRJA 5BW8A 4L8GA 4WOPA 2ZJ5A 3H0KA 4IDHA 4QHYA 2ZSEA 2OSBA 3UMSA 1W5TA 5EUQB 1E6CA 3LW7A 4DIDA 3CPJB 1FW6A 2GDJA 2AWOA 1R2QA 2CL6X 2XTMA 1GZSA 4YDSA 1IJFA 1D9XA 1GITA 3WHKA 2VF7A 4PHHA 4BGDA 2AK3A 3LAWA 4C0BA 1Q57A 3U5ZB 2XXAB 3UKDA 5FH9A 2PT5A 2N42A 2DHRA 2ODWA 2NZJA 2RH5A 4IFEA 4DWJA 1XEXB 3GLGB 4FMDF 2YC2C 3KJEA 2QZ4A 4LYAA 4FMBB 1DOAA 1E9CA 1ESMA 2IHBA 2P3SA 4JSYA 2O8FA 4PFSA 4ZKDA 3CF0A 3QF4B 1E69A 2ORVA 5IK2A 1CF4A 3L43A 3DZDA 1GNPA 3GD7A 3G5UA 2VYFA 4WVFA 1UJ2A 1E9SA 3AP3A 3TAUA 4QGGA 5FL3A 2QM7A 3IDQA 1W2HA 1XD8A 2NG1A 4Q7KA 2JLSA 3THYA 1E1QD 4Q9JA 3CB4A 1Y63A 2WHXA 1F2UB 2RGXA 4IEEA 1ZNYA 2IX3A 2BCJQ 1G5TA 4HDQB 2N46A 2XOKA 3ZYCA 4KFSA 2A30A 2ZTSA 4YMVA 2YC4C 4CEJB 1VDZA 1V5WA 2H18A 2RGEA 2YZ2A 5EE5B 4QNMA 4EKDA 3B1XA 1VECA 2IWRA 2BMEA 4EPRA 1NMXA 4OK5A 2EVWX 2JJ1D 2IXGA 1XBTA 1Q22A 4Q7LA 2J7PD 3K0FB 3SS8A 2GXQA 3ECCA 3B9QA 4Q19A 4C0KA 1F3OA 3PUZA 1L7VC 4D0GA 3I32A 4GP6A 2V4ZA 3I72A 5BXQC 2UKDA 3VAAA 2G6BA 3THWB 3GMTA 4LYHA 3RS2A 5EP3A 2BJWA 5JEDA 3PEWA 3OFND 2IBMA 1SKYB 2R6CA 1T3LA 1VHTA 4LZZA 1HT2E 2GRJA 5TARA 3C14C 2BBOA 3PEVA 1NSFA 4BECA 1KK3A 4Q4AA 3AQ4A 1IOZA 2GKSA 2JIZD 3K9LA 2FOLA 3AVTA 2BWJA 4URVR 3LQQA 1KMHA 4DLYA 1DTSA 4QGFA 3CH5A 2NZ8A 2CLDX 3L2OB 3P32A 3SC3A 4ZV4A 2EFHB 2UVQA 4EUNA 1II9A 4PZLA 1R4AA 2HUPA 4ITRC 2ZRNA 4UJ3A 3TAHA 4R71A 2EW1A 1TQ2A 4D26A 2JDID 5AUNB 2ZETA 2ZRAA 3X1YA 4ARZA 2DYKA 2IUSA 5AR1A 1Z6YA 5KSPA 4H1VA 4CGZA 1VHLA 2GETA 1MABB 1DELA 2HDNB 3MJRA 5CJ2A 4JVMA 3EIQA 2GZDA 3B7GA 3AUXA 2BEJA 2Z43A 4FINA 1TMKA 2WVJA 1MT0A 1CULC 2ODEA 3KQKA 4A6XA 2QTHA 1XPRA 1LY1A 1DARA 2FGKA 3PFIA 3LX5A 5F9FA 1OKKA 2GJ9A 3CRVA 3EAQA 2CNWA 1E4YA 3FHOA 3IQXA 4CF7A 4RD0A 3QQ5A 3R8FA 2WAXA 3OE7A 1SULA 1XCMA 4PC6A 1HQYE 3NWJA 4Q1AA 1HQCA 5AUPB 1VCOA 2LWIA 5E7MA 5FPTA 4BFXA 4FCTA 3PUWA 2C77A 1TL7C 3DM5A 1O87A 4HB3A 2P6RA 1TEXA 2ZREA 1BOFA 3AKYA 5KPDA 5JEEA 1E0SA 2IEYA 1KI7A 4OHVA 1S4QA 3CF2A 3BB3A 2QL6A 1N0VC 3GLIB 1I2MA 2F3RA 1M8PA 3CZQA 1G64A 2HCBA 3WP0A 3HU1A 4BUJA 3KB2A 1GAJA 3VFDA 5DGXA 1RFLA 1I4TD 1ZU5A 2XSZA 4ZKEA 1UBGA 3TVTA 2N1BA 3BH7A 2MMGA 4DLVA 5TXGA 3VR5A 3B6EA 3F8TA 3BGWA 4NHOA 4GL2A 4OI1A 3TW4A 5SZHB 4CDGA 5JCPA 3BFVA 1RRCA 2RGAA 3U3MA 1MRSA 4I4LA 5IDVA 1GSIA 3KZ1E 4TMTA 3TSOA 1AJEA 3BD9A 1UKYA 1W44A 2XXAA 2JASA 3SHFA 4TQAA 1XJCA 3MFYA 1WCV1 1XEXA 4UKDA 1QHGA 3GLGA 1Z6GA 2CMKA 1JEEA 2KI5A 1ZAKA 2ZRBA 2J5XA 4MGZR 4N0DA 4KCGA 3QF4A 4M9XA 5FPSA 3S1AB 3L8ZA 3DO6A 3IQWA 3U3RA 1E2MA 4A2WA 3EG5A 2YOFA 1KDRA 3LWNA 3ASZA 2RGBA 3V4FA 1LV7A 3ZS9A 5F2EA 2OHFA 4HLUC 3K09C 4B3CA 4R98A 121PA 3QXHA 3R8CA 2X8AA 1U81A 5EUMA 1TPZA 3EZFA 4ZO4A 3THOA 3QKTA 3PEYA 3SJBA 1F2UA 2VH5R 4HZUB 4C0SA 5FFMA 1GKUB 3OEHA 4YMWA 1A7JA 4HB4A 4IOKA 5F98A 3RS7A 4CEJA 3M4YA 4IFBA 4WZ6A 4C0LA 1PUJA 3NXSA 2IWHA 2YWFA 4RSGA 1E3MA 2B8WA 2AWNA 1KYIA 1P7CA 4M0LA 3ND9A 2ZUBA 3K70B 3VTKA 1N6HA 3HJNA 1L4YA 2YWHA 4WZAE 2X77A 2W83A 2FG5A 2BM0A 1U94A 3W3AA 3UWOA 3H1TA 1LNZA 2VSFA 3NEJA 4XOIA 4BFVA 5BQ5A 2GXSA 4M9ZA 5H70A 3K0FA 4P4TA 2D4HA 4QNRA 1TADA 3NH6A 1TTTA 1H8ED 1PLKA 2AK2A 3LH5A 1JR3A 4KI0A 4Y0AA 1MR3F 5G3YA 4OYHA 3GFPA 4FCWA 4W5JA 3CO5A 3EWAA 2DFKB 2W6JA 4HATA 3W6PA 2ZIAA 2BC9A 1G8GA 2HV8A 1CTQA 4LBZA 4LYJA 2IYTA 4MRPA 4R7ZA 3CBQA 3I5XA 3W34A 3KQNA 4NONA 5FR2A 4XD7A 1AQUA 2VHTA 5AJVB 3VHXA 3VKGA 4YMUA 5FOSA 2JLWA 3PG5A 5KSZA 2QGNA 1YZTA 3V4RA 5JHGB 3CF6R 4O2LA 1QZXA 2P6UA 1DG1G 4F4IA 1R7RA 2JJ2D 5AJZA 3GJ8A 3SDZA 1XMVA 2PZEA 4A92A 3W90A 4LPKA 4DSUA 1KI4A 4ESVA 1TAGA
chains in the Genus database with same CATH superfamily
3RRZA 1V1MB 1YJ5A 3IURA 3MQFA 3RTDA 4ALKA 1LLUA 1SN7A 3QVKA 2XD4A 4QBGB 3Q8MA 1NT4A 1NC1A 2ENWA 3GXBA 3VC1A 1PL8A 4CM9A 4G0WA 1U7WA 1RHKA 2IPMA 4JLWA 4G3XA 3T3PB 3WB9A 3NV7A 1IQ0A 4P0TA 5EJ6A 3NGLA 2J0EA 5TGZA 4MYCA 1OXBB 3U4CA 4AW9A 1Z6XA 1BMTA 4DBVO 4RADA 5FAKA 4XTRA 1BQEA 5LMZA 2D1TA 1VTKA 2DZDA 3FJOA 4BTEA 1B8UA 4N5HX 1OI2A 1EWTA 3BHNA 2L18A 1YAJA 3C39A 4I46A 5AICA 5AUQA 5K3FA 4GX5A 4X3OA 3MAAC 1MABA 5EHZA 2BZSA 3T5GA 4ZGWA 4DV1B 3KQSA 1SWVA 5BQFA 2IDZA 4D57A 1PJCA 1U0RA 2HRCA 1C9EA 1XSEA 2H1SA 1C1XB 3D0QA 3WK7A 4A4DA 2F64A 4XDZA 1SQ6A 3H3XA 5CEFA 4P8RA 1CJTC 2GCOA 1P9RA 5D2CA 5JJKA 3CEAA 2IX9A 2ZSFA 3RYCB 4XIGS 1UM9B 2ETVA 2WT4A 3D1JA 4NNJA 4B7CA 1IXYA 1U9CA 2CEKA 5LN1A 4AY6A 2OC9A 3IPYA 1NN3A 2X8LA 2HNKA 4II3A 3FWNA 4W1PA 2OB2A 1XAGA 2VAVA 4LJKA 4E46A 4ABTA 5CXSA 4B0OA 4NRDA 1WPQA 3MGBA 5AWFC 4TKMA 4BB9A 4RA9B 4QQKA 4TSKA 2IYEA 1FYFA 4YRZA 2Q1SA 2F2TA 1J07A 1FYWA 4MLPA 1NVGA 4PRLA 1TJ3A 2JJYA 4BPBA 3TLEA 1U0NA 2H4ZA 4G1CA 1MDFA 4CNQA 3SSOA 5TT1A 1KHHA 3ZHYA 4WX2B 4JT4A 2LKCA 2H2WA 2QTRA 4LY3A 1M2VA 4PLPA 3ZN2A 2LGJA 3NDRA 4HH0A 4NYJR 1OHHA 5A2GA 5H80A 4Q1CA 2PPLA 4K6OA 1CRWG 5B4VA 3BCRA 1E1CA 1JL3A 1DZ3A 2GEVA 2P0YA 2P7HA 1IRXA 4B6QA 3HVJA 4NBNA 1U1IA 4KGXA 1W8DA 4BO4A 1JALA 3JQ6A 1EG7A 4S35A 3NOVA 5FCDA 5GINE 1IK6A 1GA6A 4BWGA 4JL8A 1ORTA 1PZNA 2P77A 2P2LA 2IUTA 4I50B 4CE6A 3IB6A 2ZVQX 1XJQA 1ZAYA 2VFAA 3QW2A 5DBOA 3MCZA 2PX5A 4Q7MB 1HFKA 3G89A 3IO3A 3R7NA 1S8FA 3KDAA 4D46A 2Q2OA 5JS6A 2R5WA 5JPCA 1RZVA 2CHUA 2BELA 4ALJA 3FPBA 3LUHA 4UOQA 2ZKLA 5F33A 4B76A 5BSKA 1H66A 2CDRA 3DQQA 3S7ZA 2QTVB 4BKRA 1S9HA 3QPBA 2CJXA 1E6MA 1YDGA 5GADl 2H52A 3C6QA 3E9MA 4HTFB 5J63A 2WUFA 3DBOB 2GD6A 1FQJA 1I9CA 2XI4A 1JJAA 2HSWA 2Q1WA 3EGWA 4N5LA 1BHJA 4PCUA 4RZIA 4FX2A 2GPBA 3ZHQA 1Y3DE 3D1LA 3TECE 4UMEA 1UDRA 2Q5JA 1D0SA 4FT2A 4XPZA 3RSFA 4UCQA 1N0IA 3VX4A 4F5DA 1PS9A 4YRJA 1N2CB 4TSRA 1E3IA 2AIRA 5A71A 4DA6A 3JCZA 3MTEA 4JOQA 2LCFA 4NYJQ 1YCDA 2XVYA 3QSYA 3QYJA 1PJ2A 3OEED 3AJ9A 4JELA 1BXRA 1UPUA 1XL0A 4XJVA 1L5GB 1RM5A 2GEUA 4MEJA 4A82A 4B3SB 1BU8A 3RIGA 1SHUX 4QOSA 5KTYA 3KETA 3ZDAA 2QZZA 3GB9A 4QLBA 1T9GR 3L3BA 1ZM9A 1YE8A 1G2PA 2BEVA 5LJLA 4G0QA 2IJGX 3QF7A 2C92A 1JTFA 5FTKA 1ZNZA 3VZPA 2OL4A 4P0QB 3IAAA 1CX9B 1X0VA 1QOZA 2FF5A 2X14A 1ZN2A 3NBKA 3D6AA 4O3MA 5LB4A 4LF5B 5E3HA 5CDGA 4QODA 4US1R 1YTUA 4BJ1A 1PR2A 4RIGA 5EJMA 3T7CA 1U1GA 3V8EA 3EHDA 2A7XA 2WZQA 1KAHA 1IOLA 1P3JA 1MX3A 2Q50A 3EUAA 4ZT4A 1J21A 1GL9B 3RUDA 3WGTA 3WNZA 2QW1A 3KKZA 4HEJA 1IJBA 1L7NA 2KSQA 2GQ0A 2Z56A 3GNQA 2GZAA 4DILA 3RC8A 2PYDA 4UPEA 2VPPA 1KXJA 1O6FA 2D1SA 2R9VA 4AC9A 4EUFA 1JVBA 4CMIB 3HV0A 5E6RB 3RVOA 2FXVA 1U0BB 2PH5A 4ER5A 3GRPA 4N01A 3BF7A 2IP2A 3JWIA 2WSYB 5BYAA 3RSCA 2Q4EA 2VT6A 1YDWA 4NJEB 5CH8A 3TE6A 4AY2A 4IUCS 4MV3A 3S81A 1US8B 4ND8A 4QXRA 4I0WB 5JH7B 1LLFA 3AU8A 1VLMA 3PWKA 3LYUA 4QASA 5GAJA 1ZK1A 4IHQA 1YR6A 3NHKA 4L9AA 5L4LA 1QONA 4TX1A 5ERGB 2VK8A 1H4QA 1DXOA 3ONVA 4QJ5A 3RNOA 1V1MA 4XVRA 4AUEA 1XCGB 4E09A 1EVQA 4HDKB 1TK9A 5IJAA 1VPLA 1S5PA 2CLKB 3OE1A 3R0IA 5ALXA 3TQSA 1QO7A 2NXWA 4E2XA 2A6PA 1HLGA 3PGVA 1WCIB 2F1JA 3SIWA 3DL2A 4YV2A 5JQGA 3HR8A 3QFSA 1ZI6A 3MJHA 3PEEA 4IV5A 3HTXA 4CQLA 1T43A 4WBNB 7REQB 3O84A 4U6SA 1PQPA 2VQ3A 2WINI 3B9PA 3FOAA 1FRVA 2QXYA 2W6OA 3HJCA 2HK6A 3IR5A 4IYRA 5CB8A 5KJCA 2ECQA 2JCVA 4XYEA 4CI0B 1NF8A 1C1XA 3WADA 1R8SA 3WK4A 2RHCA 4QC2A 5G0UA 3UXHA 2CLOB 3WTBA 2XT6A 2G1JA 3KJIA 4L8FA 5AESA 2R8ZA 3FWPA 4MR7B 5CB0A 2OZEA 4Y9UA 1ZGGA 1P0QA 1YULA 3HYNA 4HLDA 4JFRA 5LZ7A 2J9FB 3D02A 3X2SA 3SQWA 2CE2X 1SHKA 2P9FA 3RYCA 1C7RA 1UM9A 1A8SA 1U3TA 2IEDA 2Y1CA 2YIVX 5CH5A 4AURA 3O8QB 4JZKA 2WJIA 1IVSA 4EY6A 4NV0A 1TKRA 1T5SA 2GJAA 1UKZA 2I4RA 3WLEA 4IKOA 1EP1B 4RA9A 2WG1A 1E79D 2WSIA 2Y1DA 1E6EA 3V4OA 5IJWA 1EQ2A 2ZUCA 3GLHB 4YRBA 1DEXA 1VMKA 3HL0A 1JHYA 1GADO 3WMFA 2G06A 4PHFA 4MITA 4R01A 4B40A 4G8CA 2QW0X 3AM4A 4BNXA 4F8YA 3K9GA 5E4JA 3QKIA 1GLVA 3M4JA 4IH1A 5AIAA 3VKWA 2NAFA 1WJGA 1DIBA 3A31A 3FROA 3OSUA 3FWKA 2A3RA 1A4UA 4Y30A 3LW8A 4BNNA 3W5UA 3MB8A 2ZW9A 4IJQA 2AW5A 2WJYA 4KRFA 1A5ZA 3QVVA 3R5HA 1T2EA 2NQTA 4CEHB 4BYMA 4QICA 5FAXA 4FCCA 3BDVA 3DAFA 2H3EA 3PSAA 1MRNA 1N5IA 4ESOA 2F9MA 2N3ZA 2OUKA 3O8NA 2J7PA 2LNDA 1TCUA 3E8SA 1GO2A 1ORVA 2LIVA 4UASA 2RC6A 1DC6A 1T5HX 2VF2A 3INRA 3DCJA 2WMOB 3AW9A 3WGQA 4EHBA 5AOBA 3CSUA 3HBLA 2HNAA 1YE5A 1SZPA 3TKLA 2J1LA 3PNMA 3Q3CA 1D8TA 2AFHE 1A2KC 1GGKA 3JQ8B 1AQNA 1VP9A 3VSCA 4JI8B 2R8PA 3I9OA 1EFCA 3KYDB 4C7VA 1RLIA 3G2KA 3RRJA 1L5WA 2QTVA 3QKWA 1G3MA 3SX2A 3VPXA 4F8EA 1M67A 2VHZA 2H1RA 1VSTA 4UHFA 5FLYA 3UFBA 4HTFA 3SHWA 5K0FA 1YZFA 1EUDB 3IBCA 2RC5A 3QEMB 3QLVC 4G0ZA 1BKSB 2PYIA 4PEVA 4QQ8A 4HUQB 5IUKC 2ZUTA 1BRTA 4D9EA 3I23A 3PT9A 3NV9A 3QU2A 4L7VA 1C9YA 1F4VA 1N2HA 2QTLA 2JGKA 3JXEA 3OZAA 2RHDA 1N2CA 1QQAA 5UKDA 4IS2A 1T8TA 5B4UA 1ANKA 4RVGA 1VYHA 2C3YA 4P93A 3RLFA 5EJ8A 3U5TA 1FLDA 1NVWQ 3WLQA 4KLCA 3OQ6A 4ARBA 1A2OA 3GA0A 1UOOA 4PQRA 3T7TA 1PLJA 2XVAA 4UDNA 5HXAA 1YFJA 1EP2B 1VCHA 5EWJB 2JI9A 2F3TA 3RS4A 3HYRA 2I34A 2DF8A 1W4BA 3DNPA 5I7HA 4JN6B 5L3RA 2JLAA 9LDBA 4ZIRB 3EQZA 1DEHA 2KHZA 3HU2A 1UMBA 1ES9A 4ZWNA 4XSVA 3O90A 1O89A 1P2SA 2PKRA 4JKYA 5BPHA 1KDPA 3HXPA 3VYRB 5CDSA 4L22A 1NXSA 2FLVA 1YAHA 1VJ0A 2R8BA 2G28A 3OC0A 4KXNA 4LOAA 3A6HA 1JA9A 1XYYA 2C9DA 2YXPX 4QGSA 3Q8LA 3H2GA 3O21A 3WYAA 2ZWOA 4RTKA 4EMSA 5FBHA 4RFLA 3ZJYA 2VDUE 5ED4A 1SOMA 2A0WA 3CNLA 3EPRA 1E2KA 1T2VA 2R4TA 2HREA 4BWYA 5SY4A 3CRQA 5B3KA 4P7BA 3AF6A 1R8XA 2FSPA 4JBHA 3O8CA 4JGIA 3ZEIA 3AHEA 1QPZA 2MINB 1ZSYA 3OTHA 4CMIA 3IBYA 2O3QA 5E6RA 3RS8A 5DIZA 4RAOA 5JCOC 1JG1A 3ZCPA 4CIYA 1YBMA 2G9QA 2JAPA 2YXLA 1XD2B 3N53A 5HTOA 4C06A 5IWAB 1ZM4A 1W0KD 4AJLA 4NJEA 4B87A 4EFDA 4LV5B 1AY0A 4QVGA 4RNCA 3H42B 1U4NA 4B6FA 5FOUA 1TF2A 1UK8A 1US8A 3GJ4A 4M9SA 4AYWA 2IE0A 3A2LA 4KE8A 5F9MA 3ORQA 5FOXA 5JH7A 1CQPA 4OMUA 3I52A 2IH4A 2Z6QA 2QYSA 2EJTA 5KCZA 3E2PA 1YA6A 2HPVA 3LT0A 2ENUA 1O95D 1H2WA 5KVSA 3G6KA 4DR5B 1NW9B 3AYXB 3HY6A 2FFRA 2I6SA 1CQJB 1T4BA 2VKQA 4HDKA 1DQSA 1E8DA 2JEZA 3DLAA 4G89A 2PEYA 2H7CA 4GVPA 1W4CA 4TQ9A 3L8GA 2DKNA 1NBAA 1QIDA 1SBTA 3GT0A 1WCIA 1JX6A 1ETHA 1RXUA 4JYCA 1THZA 4KO3S 4NY1A 1B6GA 4DT1B 5AXDA 4HVTA 1KQOA 4KXQA 4QO7A 4L4SA 1JB9A 4WBNA 3GK3A 1R50A 7REQA 3NTQA 4HI0E 5HUHA 3FWYA 4DB4A 1AV6A 5C8XA 4NL4H 3FUUA 3BTVA 5BSUA 2P2DA 1Q44A 2YFHA 3I53A 3LG2A 4FJ0A 4G41A 3WRYA 3QEJA 5KOHB 3BL6A 4MV7A 5HZHA 2J3MA 2Q3FA 3E27A 4GBJA 4W6ZA 621PA 5JWOA 4EYKA 4O1IA 1HO3A 1BHO1 1DAPA 1G17A 2EL9A 4TQUS 4MR7A 1NNEA 3BK7A 4RZHA 5DHTA 3NG1A 2FFAA 2J9FA 1ZINA 2V5AA 2HMTA 4HS9A 4KQIA 4ZYUA 4QTZA 3S2EA 3NDPA 3U81A 4RL4A 2O8BA 2AYXA 3O8QA 5F2KA 3MIIA 2GBCA 2WT8A 3RUAA 3T3DA 4Z54A 3KSDO 2IOHA 3L4EA 5LQRA 2XR1A 1H2ZA 2A35A 2OP1A 3L0SA 5TGTA 3W2IA 5BWNA 1UWLA 1XAHA 3TAXA 5EZSA 4UUNA 5B7GA 1KMQA 3TWOA 1KAOA 3K9HA 3GLHA 3QXSA 3IO5A 2ARKA 2FLKA 3O83A 1OUMA 4OFZA 4OFWA 4NQZA 4W9RA 1XTIA 2B4AA 4RKWA 1MDBA 1U2PA 1UKCA 1NW7A 2QU8A 3HB9A 4I3GA 2VP0A 4S2EA 5DGHA 4K9KA 4PYRA 1RLTA 1ULZA 3Q3HA 4DQVA 3NIDB 5JATA 4DSNA 2E48A 3A6KA 1VPWA 4YUVA 1G4AE 1ZL0A 5JZMA 2G70A 4FC7A 4FGJA 1TKAA 4CEHA 2R79A 2FYTA 3CR3C 4Q15A 3NKLA 2ECKA 1LDGA 1SC4A 4JP3A 2OXIA 4Z51A 2CK3A 1I7QB 1JHDA 1S3IA 4FYHA 1ISSA 3PDHA 2HIMA 3H9JA 1LPPA 3JD2A 1KAQA 3O3MB 2ONCA 4GT1A 3KLMX 5CM9C 1I01A 4AMYA 4R8MA 1GRQA 1NURA 3EVZA 4LBYA 3H0CA 5B3AA 3VNQA 2AD5A 3KOXA 2QLMA 1BE0A 1RQ7A 2EERA 3JQ8A 2I6TA 4CV3A 4B2LA 2NN3C 2R8EA 4QULA 1NG1A 3G5MA 4IKEA 5DLYA 4PX2A 5EHQA 1G16A 3HCWA 3KYDA 4L28A 3WFJA 2XYVA 4JNCA 4LJ8A 3DEKA 2WKQA 5IC6A 4QPDA 2QMUA 1CQXA 4CKYA 1RWKA 3RUIA 1CR2A 1LVHA 4A0QA 1YB5A 4QZVA 4C7OB 4HNRA 2ZE8A 4AWXA 1EUDA 1TCVA 2C1ZA 3QEMA 5IZCA 3D2CA 1WDLA 4G6ZA 3JVVA 2POQX 4AKIA 4R51A 3P0JA 1D6MA 3CE6A 3MRTA 4HUQA 4BVKA 3MTDA 4DBZA 1KVRA 2CFRA 1NBME 2HMVA 3H7AA 4DC0A 1M34E 3CLTC 3PQ7A 3ND5A 1QGAA 4ID3A 1V71A 1BAPA 5LU8A 3FKQA 2PDAA 4ZI2A 4TN1A 4ARSA 1MIHA 3L05A 2M9MA 2VF8A 3GRYA 4PRYA 4XLLA 3U62A 2VXOA 4IEFB 1L5RA 1TGYA 3VYSB 2QG6A 2GPTA 4LBVA 1UBCA 5DSZA 1ODCA 3AJEA 3EXAA 1FSPA 1ENZA 1N8SA 1GRRA 4QYXA 3RTEA 2CCKA 3S0JA 5IMBA 4G4SP 4BNYA 5EWJA 5HW0A 3O8OA 1NYRA 1JFTA 1G2IA 2EXXA 2ZB2A 1XTKA 1BWSA 3FMPB 3H8SA 1EVJA 3AEXA 4ZIRA 4PZ0A 2UYCA 2VBCA 3BJRA 3HADA 3E22B 1HFJA 2ZBFA 4ZEOA 2AF4C 1RKUA 2WV7A 3A3OA 1NY6A 2GEKA 3H97A 3I92A 4H2DA 4URUR 1GIAA 3E9QA 4Y2JA 3PC3A 4GR9A 1O97D 1PF7E 2P41A 2Z2JA 3CF4G 4CMEA 5KWVA 4LZJA 2EYQA 4O4JF 1JIKA 1TJNA 1WXIA 3ACCA 5LLTA 2KYRA 4C2AA 3LHSA 3JD4A 3IE1A 2GJKA 2EZUA 3OICA 1XTJA 5JARA 3KIPA 1SXJD 1T5LA 4G5GA 2Q4OA 1N5JA 3PDCA 1WEKA 2JZNA 2IHVA 2QMOA 4KZKA 3U4IA 2QTGA 3BM5A 3L0IB 5E38A 4BC0A 2BJVA 2MINA 3DOEA 1JU3A 4C0JA 1ADBA 3MYYA 1CDEA 1EWKA 1TQHA 1FPMA 3VGPA 1G3QA 5THXA 3W9UA 1HTWA 1QDUA 1UP4A 1XD2A 1WUYA 4KH1A 4N54A 4P4GA 5A62A 1KMMA 3F96A 4KL8S 1GFSA 3QGMA 3MM4A 3EXHB 2HSGA 3C3KA 1TU0A 5JQGB 4WZBE 1T9HA 3O4FA 2GNPA 4AJOA 3WZMA 1YS1X 2HYIC 3P0IA 3SC2B 3A1CA 4ZT3A 1N2IA 1I7LA 1LS1A 2BHLA 2VA9A 1CQJA 1R5OA 4PYNA 1EK1A 2BCEA 4DNFA 1T6ZA 3C0KA 1ECFA 1DS6A 4Z8XA 1ZG3A 2AEFA 3O95A 4NBLA 3GWGA 4DT1A 2IHKA 3QUQA 1K63A 1K9SA 1TYCA 4XLZA 1PJBA 1P9OA 1BX3A 3W04A 4BTVA 1MB0A 2ID9A 3N8NA 5AVJA 4E14A 3OE5A 3SBEA 2LRHA 3VNAA 4ML3A 3BREA 2CT8A 3COPA 1K98A 4Y0NA 5KDLA 3OQVA 3P1JA 3PENA 4H7DA 3RFXA 3BT7A 1S96A 3E9CA 3QW4B 1YS2X 3JQRA 5KOHA 4EKIA 1PSWA 3TQHA 4BBJA 2BE9A 2GZSA 1BJRE 3O1IC 4M53A 3QX7A 4X84A 1DLJA 1JKXA 2AOWA 3UV6A 2SHKA 3SJ7A 1ZVVA 1U8AA 4WLNA 1UBRS 3G23A 1E63A 1Z9BA 3HO1A 1F14A 3H83A 3GGGA 4I8IA 3R7DA 1A0OA 1K89A 3RHSA 2CVOA 1TAHA 1WRBA 3OIVA 4KIGA 2G82A 3EIEA 4QGAA 5K8IA 1PE0A 2AG8A 1U2DA 2PFSA 4V0ME 1YVEI 4LISA 1EJ2A 5E0KB 3TIXB 4HAIA 3H4MA 4U5QA 1F06A 2UUPA 4XIFA 1LH0A 5GJWC 4II7A 4Q7QA 3RBVA 5KTKA 5HSGA 1ECJA 3M6FA 4TZTA 2YIJA 3LDUA 1DUVG 3P94A 4GKAA 1U7DA 4RETA 2CK3D 2AC4A 3AVVA 5H68A 4AQDA 3NEYA 1OVGA 3OJEA 3QOWA 3F4BA 4QPCA 4EOGA 3DLCA 3I8SA 4R05A 4E7OA 1RE1A 5IJXA 3PHIA 4B34A 2UZIR 1SKQA 3BQ9A 3GJ5A 1K27A 2RGCA 4Z7OB 1NV9A 1Z4NA 1J5PA 4AJJA 2WF9A 5BXYA 4LFBB 3USES 3WNBA 1XP8A 1EQAA 3VI4B 1DHRA 3HS3A 3TQCA 3V4SA 3LK7A 3D4IA 4TRJA 4U7GA 5PNTA 3R8CA 4I1SA 3K0HA 2CFIA 3E3MA 1XRLA 4QOGA 2WWHA 2GAFA 3HWWA 4Z86A 4RANA 2JCSA 3BX1A 2FZEA 4MB6A 4JHXA 2B98A 2DUNA 4KN8A 3RKUA 2H0QA 3NANA 4XPIA 3KR1A 4UMVA 5JMTA 1B4DA 4BRSA 1DXHA 3LT5A 3GA5A 4BPRA 3F67A 1M6EX 4IWNA 5EZYF 5AIBA 3BRWD 2Q27A 2BI4A 4IUBS 2Z4RA 3DWGA 3FFXA 4RDHA 3GX1A 2KLBA 4LTDA 2V6GA 1QHHB 3BXGA 4M0UA 1IJEA 2VJMB 5CFQA 3GYGA 1W0JA 1QIKA 4AL4A 1ZEMA 4X6UA 4C7OA 2ISQA 3W2FA 3K6JA 2EFGA 3LOQA 2CBZA 3ZGOA 3HBNA 1DI0A 2RGUA 1ZOLA 3CLSD 3FIUA 1G1MA 1PFQA 3LLMA 3LUKA 3GFVA 4PWZA 1CJVC 3O6VA 4IXDA 4W5HA 4XYBA 4YBRA 1FX1A 3RK4A 3VTAA 2AD1A 4F12A 2GM9A 4PLFA 4DLLA 3OM9A 4FB4A 2MOKA 1F38A 3FDZB 5EIWA 1B1AA 1SUWA 3DNFA 4ZZ3A 2QY6A 3U6KA 4Y1FA 5FL7A 4BLSA 2TRSB 5GZ6A 3ROEA 4BEWA 3PYXA 1T1RA 1JXMA 3M8KA 2Q0QA 2XRZA 2C4KA 2F67A 3EH2A 3TX6A 1Z8NA 1NLMA 3OCXA 4ZTZB 1PWHA 1NPDA 1VMAA 2G5TA 4D4IA 1V96A 2VNJA 5I9TA 2O07A 2FFHA 1JHZA 4C0HA 1M6HA 3QELB 1WMDA 4EGFA 3PFCA 1FDRA 2VP3A 3E22A 1QYIA 3UYKA 1EUQA 4X7PA 5KQGA 4H1WA 4OI0A 3N8HA 3NNNA 2CHVA 3M2TA 3NX4A 3QYAA 1LTKA 2EFDB 1PCXA 1KO5A 2XQIA 4GKKB 5D86A 3C3JA 3AB3A 1R6VA 4XTCS 2OV8A 1SXHA 3NHPA 4FBLA 5DE3A 2GD0A 2R62A 1G6KA 1LXCA 4RTNA 2GM3A 4MQLA 1ZCFA 4BLWA 3DP7A 4R9RA 2BFAA 3C5CA 2CEAA 3WK9A 1NXTA 1AH2A 2YQ5A 2Q0HA 3WBBA 1L2TA 5KQSA 1QU2A 3G8CA 1WV1A 2HSJA 8GPBA 2P69A 4XRRA 4IOLA 3RRXA 4JEUA 3OX4A 4DQUA 4M8SA 1Y33E 2AMFA 3TOCA 4EKGA 1LBEA 3A3KA 3S2UA 3EXHA 4X94A 1R16A 1L4BA 5L6MB 1XK7A 5JNRA 5CCXA 4E3ZA 1M1UA 4O5OA 5C52B 2QYHA 3SC2A 2QM0A 4JBYA 1TM5E 3Q5DA 1YJCA 4LJ5A 2ZRQA 3PJRA 1A1SA 1DFGA 2ERCA 4BFZA 4GU5A 4BKMA 4HRAA 3FHLA 1FXWF 1SWWA 2CJYA 4S1WA 4HWGA 2YYZA 2W2QA 3T9BA 1MBZA 3V3TA 1NJ5A 2DR3A 3GEHA 3QVLA 4TVOA 2G7ZA 3II6X 5A4IS 3RCBA 1WXQA 3AR5A 3T34A 2ZBPA 5CLIA 4LY9A 4U7DA 3FF4A 1C0LA 2OZKA 1EJ0A 2B1RA 2WVAA 3Q3JB 1K4KA 3FNIA 4LWOA 4MUKA 4XQ0A 3EY9A 3G2MA 2OT3B 1SBIA 1L5QA 1UK7A 3L8YA 1ZUD1 2ZJ7A 3NTOA 3L0CA 5FPPA 1IXRC 1O54A 4YT5A 2NVWA 1ZMTA 2EAUA 5AFSA 4QNNA 3LKDA 3ZDXB 4FS3A 1H8HD 1RCUA 5FV7A 3CYFA 1KL7A 4D3XA 5JNVA 5KYKA 1RW4A 4JJ4A 4UW9A 2PZBA 4UNSA 4Q48A 1WWKA 4JLKA 1FNMA 3JWEA 1X7HA 1S8OA 3QOXA 5TDHA 3KKNA 3VJMA 1TQDA 2ZS8A 1CQZA 3IGFA 4L15A 4B5LA 1AF7A 4QQNA 3MWFA 1HPLA 4XM1A 2GCEA 2PX2A 2ZLBA 3TPCA 4XDGA 1C7QA 3SYLA 2PAAA 1BZYA 4BJ5A 4ZDKA 1LK5A 3VU1A 2R6R1 5B64A 4R40A 3BIOA 1OAOC 3CWZA 4CBVA 1RPTA 4IH9A 4XB2A 3GN2A 2ONYA 3FVRA 4Y6OA 5KDOA 2W42A 1V16B 1GUYA 4K6GA 4LC9A 3MD0A 1R5JA 4UNIA 2OUIA 4HCJA 4MV1A 1TD9A 4QYTA 3ZX5A 3M6UA 2VT7A 3KOWA 4QXAA 3OIDA 4MQEB 3U48A 3URKA 3VR4H 1VKZA 5BW6B 3EFOB 2C4VA 3EBOA 4JLNA 3DFMA 4TSFA 1NP3A 1X7DA 1PNVA 1RACA 3WRYC 1RTKA 4HFNA 4Y2GA 3TE7A 1L1FA 2P5UA 4GLJA 4RESA 1KIFA 3AY3A 1X1SA 1XRPA 2UYYA 4BRWA 2PUWA 1J39A 3BZUA 2YBDA 5BNIA 1M6YA 2ZKIA 2QTWB 2PXHA 3OWXA 1OXUA 2ZIEA 2XUKA 4OXQA 5LXTF 4X7RA 1J0BA 4YXFA 1IM2A 5KTOA 2EG9A 2C5HA 1Z0ZA 4OK6A 5GV7A 1DKQA 4UM9B 3LKVA 1ECLA 3BG5A 4RABA 2NUTB 3R75A 5BYKA 2XGMA 3GUHA 3B38A 4RORA 3CRW1 5JE8A 1QHHA 3WWZA 1PW5A 4R2MA 4R8SA 4BNJA 4WSOA 5KYVA 1FIUA 1QLJA 4OQNA 4MIKA 2WWRA 1A5TA 2V4MA 1RYNA 2HU7A 3IDZA 4YCLA 3J81k 3SJAA 3RIMA 2YYAA 3ZNOA 4IIJB 3M1IA 1FTYA 4MYSA 1Q17A 4C4TA 1J0AA 1XZMA 2NZUG 1VI2A 5D6NA 4AQ7A 4XFJA 1S2MA 4RXMA 5DISB 2A92A 1S8AA 4HH1A 3BXHA 1E77A 3ILXA 1XLWA 3HGTA 1E66A 5K05A 2HWYA 3FDZA 3JD1A 2XIJA 4A15A 3DCNA 3LQFA 4KYUA 3FZYA 4OSOA 2I03A 4HZIA 2D2IA 3BIJA 4R9NA 4RQAA 2RKOA 5T41A 4DUGA 5KNCD 4PS0A 1GT6A 3KJXA 1XDSA 4MV8A 4NG5A 3WNDA 2AFHB 2AFIE 1VE3A 3M33A 4Z1MA 1GNLA 4ABYA 4OLJA 5DRTA 1PTKA 5I45A 1NL3A 1FDWA 2REQB 5A05A 1Q95A 3UGJA 5BR1A 4JMPA 4PPQA 2V7EA 4JS0A 5F1KA 3VC2A 1IN8A 4O1HA 2QAJA 1JAHA 3QELA 3RJMA 1RAFA 1TKCA 2RHMA 3I2GA 5K2OA 5CIQA 5CLHA 1GKLA 2VAWA 2L2QA 4G5YA 5EP2A 4QOFA 5KTNA 5J47A 1UDWA 2BFOA 5C5EA 1WB9A 4A2QA 1J5XA 3E5MA 2VYVD 3MGGA 4BWVA 1QB8A 2XT9A 1H9BA 1WHSB 3E18A 4G5OA 1ZWLA 2BPOA 3GEMA 1A95A 1BYUA 1WG8A 2AG5A 5GOTA 5IZCC 4KVGA 2ON6A 1MB3A 3DF7A 2Q5OA 1RE0A 3ESYA 1QM5A 3TMYA 3PNKA 1V4VA 2ZRKA 1U2SA 2QJRA 5I6DA 4Z4CA 3H1GA 2E7ZA 3EEFA 3VDNB 5G2OA 4BLTA 4DHWA 4Z2YA 3WA7A 3RADC 4W7IA 3AVXA 2H4XA 3NBXX 2DBVO 4WNCA 3W5CA 2BEWB 1IEVA 2JH8A 3VKFA 3GGOA 3T1TA 3MGAA 3VR0A 1QIGA 3IIKA 3KT3A 1I51A 1OREA 2ZWVA 2D06A 3D64A 4JP1A 1DU4A 1YZUA 4WADA 4JI6B 1Z33A 2Z2XA 3ZNNA 1RXVA 1TJPB 1V6SA 1P7YA 1A9RA 3QWIA 4MPJA 4FZ3A 3H5WA 3W8FA 4DJAA 5AKGA 5JSQA 2BLLA 1D6SA 4IXTA 5AKYA 4J6FA 2I9KA 1K5HA 4XJSA 4EJFA 2ET6A 3C5HA 2XMGA 2ZT8A 1L5MA 5FTJA 2JLXA 3BICA 3SYTA 1HDRA 1HNNA 1YS4A 2BKXA 1FMJA 1MB9A 1EAMA 2H0RA 3E6AA 2UZ3A 4TWJA 2N1MA 2QPOA 4IOJA 3A6JA 3UCEA 5EXPA 2PGXA 5L3SB 5IM4F 1YVPA 2A2ZA 2ZEJA 3L46A 2CLFB 2Q3LA 2VDQB 3MUNA 3T7RA 5AP9A 2PAFA 4XEHA 3GDOA 1MUUA 4B32A 2AW3A 2O8VA 2ZJ3A 4L51A 5DRYA 3BXOA 2Q29A 3ICQB 4BE7B 1B8VA 4JOBA 4MUMA 1JHVA 3AERB 2BBTA 4D8VA 4AXXA 1U8XX 4RS4A 5U1PA 1T0BA 1TFRA 1GGFA 2AUNA 1JZSA 5BW5A 4X97A 1R37A 4MQ5A 1HDGO 4V02A 3U7RA 5DJ5A 2A88A 1H0RA 4KR3A 2JAOA 2I6QA 3MLBA 4ZXFA 3TVDA 1CUDA 2FR0A 3WKBA 5A4KA 1Q84A 3KAJA 3QE9Y 2JS7A 4MUGA 4Z0HO 3ZV4A 1P4AA 3I37X 1G8JA 5JIBA 3BKXA 4IV0A 2BJHA 2FZWA 2YXNA 2DB3A 2FPRA 3EIUA 2PKXA 5DYYA 1RP7A 2BV3A 2QN3A 4JCOA 4RX1A 5FNZA 1U2RA 1N8NA 3C6KA 1JYEA 3F46A 4LDJA 4GO1A 4E33A 1TM2A 4PSAA 1L7XA 1ZMRA 3AM5A 2G7MC 4Z7QB 2JBAB 3UPDA 4FFWA 3MMSA 4DLWA 5DO9A 2PWAA 3K0BA 1LU9A 2MYTA 1BMDA 4OJYA 4DMCA 5J5AA 5JDCA 4BEVA 4E08A 2VA8A 1V16A 1Y8ZA 1AHPA 4CRWB 4COKA 5KJ6A 4HJXA 5IDXA 5SY6A 3CG4A 1N2ZA 1M1XB 4D5GA 1T25A 2AF3C 2RGWA 1ZA1A 4W8GA 3DP9A 2JGIA 4NE7A 4MQEA 1KFJB 2V5UA 3B6JA 3EFOA 4QFCA 3BB4A 3K2IA 2JAXA 3D2BA 3K4QA 1ZD4A 2ATCA 4NNPA 3RDPA 3WLNA 2JEOA 2FPXA 3IPRA 5HG0A 3LWZA 1ODFA 3S4YA 4DIUA 3UUGA 5EHNA 2NTNA 3OOYA 3NC1C 4N48A 1RI3A 4CU2A 4C03A 1GSOA 1L4HA 2IPOA 2Q5EA 2ZT6A 1GPKA 1XRRA 2H0AA 4TKUB 2NUTA 1FRFS 4YH1A 4F0JA 1NWCA 4W5TA 3E0QA 4J7UA 1H2XA 5U4QA 3SF0A 1XMPA 2R6ZA 4XQCA 4B6EA 4ZCIA 2VQSA 1VL8A 3HYTA 4OQEA 3QWBA 4XSHA 1JKMA 3GFRA 4OHZA 1G8SA 3AGQA 3NVDA 1E9FA 2W2VA 3P96A 4J2OA 5M2QA 1VE5A 5FBKA 4V3BA 5GV8A 4DV6B 1NP7A 3E3LA 4IIJA 3RBAA 1Z28A 1NLFA 2CNLA 1CUXA 5AKJA 1ORDA 2O8FA 1Q1QA 2AG6A 5AVYA 4CLOB 4GKVA 2GEJA 3SNHA 3G9XA 4WLVA 3FJ1A 1XMOB 1LF5A 5D7BA 1QVRA 1HH4A 2A33A 3U0BA 1MEEA 2W2TA 3AH8A 5A3QA 3O74A 3UEOA 1RWVA 1M66A 4NH0A 4RPJA 5DLQC 2CXRA 1KFBB 3HDQA 4KLAA 3D8RA 2AFHA 4IRMA 4U9IS 3UTCA 1PZEA 3RVSA 3MWLA 2REQA 2YIMA 1L4GA 4OMDA 4ENTA 3FB1A 3M34A 4Q3DA 1Z08A 5KC8A 2J7KA 5DNDA 5L7WA 3ILSA 4HXEB 2HF8A 1G42A 5JPIA 3FI9A 1GDDA 2OV2A 3E7DA 3M81A 1C8BA 1AA9A 1TVKB 2A57A 2DX7A 3B6ZA 3D5QA 3GO4A 3FNRA 5I9BA 4V1CI 5K8LA 4DXHA 3CCBA 3VR6A 1JXOA 1M34B 1I4EB 2ZBEA 1WB5A 4WE3A 1WHSA 2BMWA 5NLLA 3T9AA 1NUUA 1KPHA 1WQ1R 3OTGA 5D87A 5IJ9B 5GJBA 3L5OA 2QX7A 4W82A 5JT1A 2RONA 3ADBA 4J1NA 1DHTA 1CD5A 4JJEA 1L7RA 2W6NA 1JIUA 2C2GA 2BDTA 2NO6A 3GLGE 4EZBA 4KQGA 3D7KA 1VPVA 3V4PB 4L4YA 5ELXA 1V8FA 1Z45A 2BEWA 1YHYA 1PEKE 5ITVA 2E4VA 2C31A 1R64A 1VRWA 3DBVO 2W58A 2OCIA 2ASEA 1WCYA 2PZ8A 3GT7A 3QXGA 5DBHX 3U4GA 3H2HA 3JWGA 3H6GA 5CCBA 1SM4A 1GUZA 2P1DA 1U02A 1XTSA 2EQAA 2HGZA 3WL3A 1ATZA 4DMMA 1QCZA 3E23A 3ET5A 5THQA 4RVSA 1KVSA 4PSKA 1DQPA 4IMIB 2X9LA 3AEYA 5REQB 1EE1A 1H2HA 2AL7A 3S1LA 2VCEA 2O1SA 4MMZB 1XGKA 1ZXXA 2ZI4A 3PD0A 3SGLA 4KUHA 2QUJA 3H16A 1G8AA 2CLCX 4MI9A 4PFJA 4PS1A 3BOSA 5L3SA 2C58A 2OO7A 5ALLA 5B55A 3D6JA 1G2OA 2CLLB 2V3VA 1FUIA 1RVDA 5FEMA 3TFWA 5L8VA 2ISSD 1DX9A 1GKIA 1N0WA 1Y1KE 2QVLA 5DN6A 3RF6A 4BEJA 2DKFA 5FTMA 3TSYA 3UAYA 4GRAA 5LVAA 4K3VA 2VHUA 3KKMA 1Q16A 2YHSA 3IDOA 4E07A 1RLMA 3AERA 1PNQA 2DFDA 4CV0A 1JECA 3U80A 4WZBB 2EF1A 1DX6A 2QWXA 4HGPA 3TLXA 5IN4A 3GVIA 2XRFA 4Q16A 3M5PA 3HACA 2JLUA 3EGOA 4HPJB 3FAKA 3G5TA 3CEJA 5JJ5A 4A8HA 1Z2DA 4LDQA 3EB9A 2HU2A 4JB8A 1D1PA 3AI7A 1PFYA 3EXHC 1IHXA 1PL7A 1Y1SA 2EX0A 3LL7A 1JLKA 3NB0A 2WB4A 3T1HB 4RK7A 1DJOA 2COUA 3UHPA 4YT8A