4EQ6B

The crystal structure of psy3-csm2 complex from budding yeast
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
237
structure length
210
Chain Sequence
MEVLKNIRIYPLSNFITSTKNYINLPNELRNLISEEQESKLGFLHIIESDFKPSVALQKLVNCTTGDEKILIIDIVSIWSQQKQRQHGAIYMNSLSCINITGLIVFLELLYDSPMDALRRCQVNFNFQLRGIVIDNLSFLNNLSKFEKLFKILRKLREFLGCWIITKSFPTDFYNGIENTLVPTKLPDSYMKGMDLIIYREVGRPQYRRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromosome segregation in meiosis protein 2
publication title Structural and SAXS analysis of the budding yeast SHU-complex proteins
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 62
structure length 210
sequence length 237
ec nomenclature
pdb deposition date 2012-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16836 PSY3 Shu complex component Psy3, DNA-binding description
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4eq6B00
1Z8FA 2I4IA 4H1UA 1TADA 4WZBE 3X1YA 1HE8B 3PUVA 1SQ5A 4AI6A 2NZ8A 2AWNA 4C0SA 3KTAB 4B2PA 1TQ2A 3CPJB 4TTRA 5GVRA 2GJ8A 3RS0A 3A1WA 5IT5A 5L8VA 1Q12A 4H9GA 1QDEA 5BN4A 5TARA 3AF2A 4WBSA 3SE0A 1P2TA 5H8WA 3EIQA 4XVUA 1W4AA 5KNDA 1EG7A 5EP4A 4I1UA 1DOAA 3FE2A 1DG1G 2ODNA 4XSHA 4HLDA 1AKEA 1K6MA 4IDQA 1X8LA 3FHCB 1AS0A 4ITRC 4IJMA 1U0HC 3IDQA 1SXJB 3EC1A 3UMSA 3MGCA 4ZI2A 3QBVA 4QNMA 3I62A 1CU1A 3KZ1E 5KDOA 1FW6A 3ZIAA 3AP2A 1G41A 1V5WA 4DT1A 4DB2A 4NCKA 4PC3A 5B30A 4DRZA 2UZIR 1TU4A 1L7VC 1HT2E 3OAAA 1E2QA 3SJAA 4MH0R 4HDQB 2ZE8A 2WKPA 3FKSA 1Z28A 4TL7A 1XNJA 3V00A 4PQYA 4ACAA 2OFOA 4Q4JB 3AVQA 4R98A 1M74A 4EIWA 5GADl 2C9OA 1KGDA 1KK1A 1W2GA 4FMCB 1UBFA 3WBJA 4TT3D 1Q57A 3VKWA 4DIDA 1IHUA 3ASYA 4BRWA 2IUSA 4L9WA 1GIAA 2QAGB 4UNQA 1BOFA 4NPHA 3GFPA 2PZFA 1IN5A 1XEFA 1YZLA 4TSFD 1W2HA 3BOSA 2JJ1A 3GJ5A 2IYWA 3TKLA 3A8TA 1H8HA 1KO4A 3ND9A 2BM0A 4OQXA 1GKIA 1HE1C 2ZREA 4M1TA 4DCNA 3V4FA 1NVXQ 5JWHA 1VPLA 2X19A 4CW7A 1EK0A 1FMJA 4FMBB 1KHTA 3CPEA 4ZPXA 4TZ6A 3RC3A 4QBIA 1J2JA 4NYJR 1XTJA 1WA5A 3I3SR 5TB5A 1SZPA 4RZUA 2FZLA 2REXB 5B57C 3GLIE 3AVYA 3ICEA 3W6NA 3SU8A 1SGWA 2XNDA 3DO6A 2B7CA 1KAGA 3MJHA 4EAQA 4AYTA 2WM9B 3NBXX 4JS0A 3I61A 3R9IA 5KSZA 1Z6TA 6Q21A 3ZQJA 5CM9C 2WSSA 3HJNA 5JJKA 2O0KA 1GOTA 3DM9B 3NTUA 5CK5A 4G5GA 3CZPA 1NF3A 2OLJA 3A4NA 2CL7X 2HLDD 1E2LA 1LTQA 3A1TA 3BFVA 2J7PD 3T1TA 2XXAB 4KI0A 5KDDA 4M53A 1CJVC 1S1MA 2J59A 2CL0X 1HQCA 3GEIA 3P20A 4NCNA 5AJVB 1N5JA 5FOXA 4JLKA 5G3YA 4B6FA 4NKRA 2VSOA 4U5XA 2GKSA 1IONA 1TMKA 3NEJA 5JS8A 3KB2A 3QKSA 5K8IA 4ZI3A 1RJ9A 2BV3A 1P2SA 5FR2A 2IYTA 1ONBA 1YZQA 2CCGA 2ERYA 2Z0MA 3C14C 2IUTA 2P6UA 3BB1A 5AJXA 1GNRA 4MA4A 1II8B 1RIFA 1UM8A 3DM5A 3OE7A 5K8TA 3CKLA 4TQUS 4A82A 2G1JA 1XF9A 5SZJA 1DVRA 1F3OA 3LW7A 4EPTA 5FOTA 2ANCA 4X8OA 4E22A 3EPKA 1TQDA 4PHFA 4QKQA 4D81A 2AK3A 1XDBA 3QXXA 1U8YA 4M8NE 1XD2B 2GCOB 2QRZA 2B7BA 4P3YA 5AWFC 1Q22A 2Z6VA 3OEHD 4MKFA 2DB3A 5DNYB 4Q9LA 4L9SA 1X8JA 5L3RA 2JJ2D 2FGKA 3THXB 1CRQA 1KK2A 2QAJA 1TF7A 2OT3B 1Q3TA 1YZUA 4IKEA 3E5HA 4LCBA 3AKDA 2FEOA 2V7QA 1T3SA 1NVUQ 2N42A 4PPQA 3NBFA 3QENA 1KK3A 3AH8A 1XJ0A 3CRQA 1VTKA 1UBCA 3GJ0A 1G3MA 1FOEB 2ZRLA 3H1TA 3TE6A 3Q85A 4YQFA 2JLUA 5KSOA 1D8TA 1T6NA 4G5OA 2RKOA 1WE2A 4FIDA 4A2PA 5B58C 3S1AB 3BK7A 1E4VA 3SS8A 2G83A 4HAZA 2IK8A 3H84A 2CK3D 1GZSA 3L0PA 3EWAA 2FFAA 3AF1A 5EE1A 3K9HA 2BEJA 1VECA 5IF9A 5KSYA 2X1VA 3PIRA 1KYIA 3U60B 1IN7A 4A15A 2HV8A 3WMEA 2D2FA 4QM7A 4GPTA 5FBLB 2GCPA 2P6NA 3WNDA 4GOKA 1KY2A 1Q21A 2OE2A 1G9XA 4AKGA 4NONA 2ZPTX 1NL3A 2QEQA 1JR3E 5EUMA 5A5GA 3SHFA 2V55B 4HDOB 3HP1A 4Q7JB 4R2IA 3VR4A 5JWRA 4B74A 2BCGY 2V6JA 2BBWA 2Q9BA 4X8MA 4C0BA 4NYIR 1G5RA 4P4TA 4S35A 2GBLC 1E2MA 1CR2A 2B8WA 1B0UA 2J5XA 1P9RA 2IL1A 3M4YA 4RZ2A 3U7EB 1NLZA 5CB8A 3EIEA 3P27A 2R65A 4GI7A 1MABB 4AD8A 3QE0A 1Q44A 1M6NA 5JSZA 2BC9A 1OIVA 4AYWA 1VMAA 2F1HA 2XSZD 4NYJQ 3HU2A 4OKSA 2AXNA 4FI3C 2RH5A 3TR0A 5DI9A 1RC8A 4TZ0A 3B1YA 3WYAA 3FFAA 1QF9A 3P4XA 4MRSA 4UKDA 4EPWA 2AD1A 4DDUA 3K0AA 1YZNA 1N25A 4WW0A 4LHWA 4LYHA 4M1OA 2QMEA 4JLJA 2PJZA 3ADBA 5EE3A 1N5LA 3CR7A 4Q7KA 1VKJA 1SVSA 3TSWA 2V54A 1NBME 1GFIA 1S9HA 2QSYA 1Z47A 4EJSB 2JLSA 4Q01A 3TW8B 2Q21A 2CMKA 1Z0DA 4MRRA 1R0ZA 2OBNA 1TU3A 1RYHA 2WJIA 3K9GA 3PCRB 1OB5A 4CEJA 1AJEA 4KYIB 2IYQA 2EW1A 4JSTA 2JATA 1VHLA 3UANA 3W34A 1LVGA 1QRAA 3AF4A 1E98A 1ZU4A 3NBYC 1I4TD 2PH1A 2IYRA 2XZLA 3IEUA 3I32A 4KVAA 5JRJA 5AUOB 3OF5A 1VCOA 4Q4LA 2EYQA 3I73A 1FUKA 3MWLA 2QQ0A 3IPXA 1XD9A 2ZJYA 4AK9A 4S2EA 3VR5A 4PSAA 3VR3A 3BE4A 3P26A 1T3HA 5BN3A 5FPSA 1LNZA 2VHUA 3CZQA 4C0QC 4D4JA 2IF2A 3IIJA 1E9FA 1BKDR 2YWFA 2VBCA 1KI1A 2ZQ5A 1XPOA 2GXAA 1CJMA 2VF8A 1NI3A 3REGA 2ZSBA 3K0SA 4YDHB 1Q20A 3CRW1 3HYRA 1MH1A 3I8XA 3LVQE 4R71A 1SVMA 1YR8A 4PHTA 4AKEA 2VL7A 4NU0A 4V0ME 1OE0A 1W4CA 2A30A 2KWIA 2YYZA 1QHIA 1SHKA 4MRNA 1D2MA 1ZD9A 3K0FB 4ON9A 3IBYA 5BN5A 2OLKA 2VIIA 4A6XA 3B78A 1F2TB 1HURA 3U44B 3N2EA 2A5YB 1KI8A 4QHTA 4DLZA 3EZ7A 1FQJA 1LV7A 5BWMA 5JWOA 2EWVA 2EYUA 1DAKA 4OHZA 5DIFA 3SI7A 1XEXA 2F43A 2YOHA 3A37A 1ODFA 1OXTA 1X1RA 4B3GA 4IVQA 1A2BA 1FNMA 3FTQA 1RW4A 2ZSEA 4TSFA 2BMFA 1DAMA 3BXZA 1XD8A 2JLQA 1OIXA 4LZZA 5AJZA 4LHXA 2C95A 1WP9A 1XFAA 3U61B 5FOWA 4WOPA 1GKUB 3B6EA 4LBVA 2W2VA 2JDID 3MUFA 1E9AA 2W0SA 3ZZTA 2F55A 2EFEB 5TDHA 1GP2A 5C2JB 3EX7C 2R6DA 1W47A 1DAIA 2X77A 4BRUA 2VRWA 2XTMA 3K70D 4QJ5A 3ADDA 2VP0A 1YJ5A 2AKAB 2ZE6A 1MV5A 3QXCA 2W00A 3LV8A 2OCAA 521PA 1WMSA 3IO5A 5DGXA 1OH6A 5JHHB 4MYHA 3W6PA 3UG7A 1KI6A 1F2UA 1NSTA 4OHXA 1ZCBA 2ATVA 4DLVA 3CPHA 1E2NA 1IJFA 4MITA 3Q5EA 4ARZB 1ZRHA 3TK1A 1XMIA 5FH9A 2H5EA 4QHYA 3AM1A 4Q18A 1VG0B 3KQHA 2HLDA 4X8HA 2IXFA 2OAQ1 1D2NA 2J7PA 2NO0A 3FKSD 4W5WA 3EASA 4FD2A 3T15A 4RD3A 5D3MB 2KJQA 4CVNA 2B21A 3HDTA 4AWXA 3NWJA 3QF4A 1MRSA 4P33A 5AK0A 5EP3A 2W2TA 2VP5A 3DEFA 3PUZA 2QORA 1XPUA 4A9AA 2QRNA 5E4FA 3U6BA 4XD7D 1GL9B 3QJYA 3DHWC 3LX5A 4XTRA 2BKEA 4PFSA 1PV4A 2OCYC 1P60A 3MMPA 4US1R 1G8HA 3IBGA 2ZI9A 4B44A 1OXSC 1KI2A 1R10A 3K9LA 4W7SA 3U3KA 2ZRFA 1J70A 3MWJA 3CF6R 4TYWA 4IEIA 3T35A 4QGAA 3X2SA 1Q1QA 4M1MA 1XZPA 1J8YF 1E4YA 2HT6A 2ZRHA 5CIQA 1H8HD 1Y63A 1GDDA 1GNQA 2QPAA 4XVRA 1G4AE 1WQ1R 5FUVA 4RFSB 3HR7A 1VCMA 3FB4A 3CBQA 3OEHA 4OQNA 2ZRKA 2IEYA 4ABYA 2ONJA 1MR3F 2JJ2A 3H86A 1IOZA 2P67A 1WBDA 4HAXA 2EFGA 1DELA 4OK3A 2VP6A 1S1CA 4LHZA 4RKEA 2ZIAA 3DKVA 2O8CB 3WP1B 2DFTA 3UATA 3GLGA 1ZD1A 2P5SA 1PJRA 2GDJA 4CRWB 2KB0A 4RD0A 3ZDQA 3K1JA 1P72A 4Q48A 2FSHA 4HAVA 4KFRA 1TTTA 4NL4H 2ZI3A 3NHBA 4PR0A 4IDNA 1PLKA 3LD9A 2CK3A 1G7SA 2IT1A 2XOKD 3GJ7A 4FMDF 5M04A 3I92A 1KDOA 4M9SA 2GVZC 4F4CA 4BZQA 2BJWA 1P9WA 2ECKA 3CM0A 3K09A 4M22A 3SN6A 5GJVC 4LX0A 1ZM4A 4H1VA 2QENA 2O8DB 1OKKD 2BOVA 1CJUC 1GL7A 2A3RA 3MD0A 3DVLA 4YXWD 1SVLA 3O47A 3LA6A 4D4MA 3A1SA 3CR8A 4LPKA 4D26A 3SC3A 1T4GA 4RD4A 821PA 1EFUA 3B1ZA 5LPNA 4JT2A 5EE9A 3T5DA 5KNCA 1HT1E 4OI1A 1G7TA 1YRBA 3BH6A 2ZUBA 4WAUA 1EFCA 4L16A 4PQFA 4BEBA 2CCJA 3VHLB 2FDCA 3WYGA 1BIFA 1CF4A 4Z8XA 5CDFA 4JVSB 1IJEA 2PMDA 4EPXA 2NIPA 4V0LA 2ZI6A 1R8QA 2Q6TA 4HDCA 5J4HA 1VYVA 1XPRA 3OHMA 4OJQA 5GJWC 3AKEA 3QEOA 4NCHA 3QBTA 1E94E 2C77A 2GILA 4TYPA 1E96A 2OESA 1OFTA 2XSZA 3EG5A 4M9ZA 1G6HA 2IX3A 1Z2CA 1OB2A 2GCNA 2UKDA 3BB3A 2QTFA 1P75A 2ATXA 2V7QD 3X1DA 1YVDA 4KJZA 4DEYA 5CYOA 3I5YA 3WP0A 3PJRA 1FP6A 1D6JA 2EWWA 4QFMA 2EQBA 2HXSA 4B32A 4HB4A 3KB1A 1SKYE 1XTQA 3TAUA 3NG1A 1OFIA 2JCSA 2NGRA 1CTQA 3BERA 3L82B 2DPXA 2AN9A 1NLFA 1KDRA 4HLQB 221PA 1UKZA 4BGDA 1W7AA 5FTKA 1PUIA 4PO9A 2ZS9A 3IHLA 5IK2D 3IEVA 1CULC 1IM2A 1F6BA 421PA 3ECCA 2J0UA 1U9IA 2BMEA 3LLUA 5J4KA 1ZVQA 1HEIA 3TRFA 2QTVB 4A8JC 1XP8A 4CEHA 2IHBA 4OL0A 2PCJA 3QVVA 2WZQA 1DAHA 5KYKA 2A9KA 1R4AA 4DDWA 4IXNA 2ZJ8A 5AUQA 5TXGA 1KSFX 1LB1B 2QY9A 1TEXA 4IOLA 2P0EA 3AGPA 1TPZA 4A92A 4HZUA 3MCAA 4D0NA 3CONA 4J0QA 1ZIOA 4FCVA 2PCLA 3AVTA 2ZSFA 5JJLA 4CIDA 1YZGA 5HZHA 1SVWA 3FPAA 1Z3IX 4LYFA 1X8KA 4PSKA 4P4SA 3I72A 3L43A 1R5OA 3ZZ0A 2ZUCA 3U3OA 5LB4A 2MMCA 4M1KA 4URVR 2GVDC 5F98A 3THWB 2P5TB 3C4JA 3WYFA 2W83A 2LWIA 1XEWY 4HZIA 3VR6A 3PUYA 4KFUA 3W5IA 1N6NA 4GSYA 5G41A 4A2WA 1K5DA 5EQTA 3L8ZA 4LV8B 2SHKA 1W48A 2QSZA 4POAA 5DYGA 1G21E 1NRJB 3NEYA 4FMDB 1JPJA 4BFUA 2LCFA 3BRWD 5AJWA 4ESHA 3ZD7A 5E7MA 2D7DA 4DEXA 3AEZA 2JDIA 4KITB 1KKLA 4RZXA 4DKXA 1G8YA 4B48A 2ORWA 3L0OA 4IXMA 2OFWA 1XTKA 4Q66C 3CNOA 1IY1A 1QHNA 2X2FA 1XX6A 1Z63A 3R9XA 5KSPA 4B76A 5CIWA 1U8ZA 5E7JA 4F38A 3U4QB 4HSEA 2BMJA 3B1WA 3QG1A 1LS1A 5DSZA 3GLHE 4EPVA 2CDNA 3GFOA 2ZROA 1E0SA 1I4DD 3B9QA 3RS7A 1A82A 4F91B 2C99A 3OFND 2CJWB 5FTNA 4OQLA 2D4HA 5EE0A 1MOZA 1JJVA 3ZD6A 1FMLA 4XWOA 1G7CA 2W6JD 4LUCA 4LJ8A 4D2IA 1JR6A 3GJ3A 1NN0A 1I4LD 4HUQB 1KJZA 1Z0IA 3QF7A 3THYB 5FL3A 4E03A 4MRVA 4EJSC 5JEEA 2GF0A 2A5GA 2LKCA 3EA0A 1YR6A 3CB4A 3GLIB 1AIPA 4DLSA 3CH5A 4WA7A 5FOSA 1NKSA 3TVDA 4GMDA 4URXR 1DS6A 1TEVA 2WMOB 4BPBA 4YONB 4BEJA 2IYUA 3UWKA 4HUTA 721PA 1AGPA 1NN1A 2ZI7A 4I99A 2PX0A 4KU4A 4XD7A 1U90A 4AG5A 5E7IA 2CHQA 5H70A 5FOVA 3RRYA 3LVRE 1BYIA 1TL7C 3KUCA 2A5DA 1UKEA 2BM1A 1JEEA 3X1WA 1UDXA 4OI4A 2R8RA 3TUJC 4US2R 1ZJ6A 2XJ4A 1R0WA 2QU8A 1E2KA 2FPLA 4FWIB 1WCV1 4M1SA 2GK7A 1KK0A 4EKDA 2WWXA 1GL6A 5P21A 4MRPA 3KDSE 3A1UA 2OHFA 5GJBA 1NIPA 4V03A 4DLTA 4M1WA 2FX3A 4Q9IA 3VU9A 2X2EA 4FW9A 4Q03A 3TIFA 5JHGB 4EPRA 4JVMA 4MQBA 4NH0A 1MO3A 4DT1B 5LDDC 2XNSA 2HCBA 2XXAA 1RYFA 4JMPA 1WB9A 4CZ2A 3Q8XB 2D7CA 5FI0B 3A6PC 4MGIR 4PAMA 5HR5A 1IY0A 2F1IA 4JVNA 2XZOA 5G3ZA 4LJ5A 4AY2A 2IS2A 1GILA 4BE7B 2QBYA 1DEKA 2I1QA 1ZYUA 3W8RA 2WAXA 2D62A 4DVGA 4LJYA 1OXXK 1T5IA 2PLFA 2QN6A 1ZM7A 2XOKA 5DYIA 5LB2A 2WHXA 1NY5A 3IQXA 2IYVA 3PEUA 4PPFA 4Q1EA 3GEEA 1KDPA 4HAYA 1GVNB 1M7HA 2QP3A 4DSUA 2VEDA 2FOLA 3AQ4A 4GOJA 1ZNXA 2YC4C 1OKKA 3GP8A 3AVPA 2GCOA 2HJGA 4W5HA 3V9PA 2IWRA 5DI3B 5JFGA 1Z22A 4YXWA 3TLXA 3BJIC 2ZVPX 1E2HA 1NY6A 2OXCA 3PQCA 3WHKA 1AQUA 5DHAA 3THXA 1XRJA 3PEVA 1KDTA 1G7RA 2ZSAA 1Z06A 3C41J 3RANA 4ASUD 4LYAA 1OPXA 3P4YA 4QJ4A 3HR8A 3SFZA 4PO8A 4EUNA 5JS7A 4QGHA 2FZ4A 4CF7A 1F60A 4Q4HA 2R6GA 4DUGD 2I1VB 3EAQA 5DE3A 5JEDA 1L8QA 2RHDA 2DHRA 1G6OA 4TMWA 3CRMA 1LF0A 2CE2X 4PANA 3T1QA 4B33A 4XJXA 2FE4A 3S1AA 1PLLA 2VP4A 2DFKB 1EGAA 4A8JB 4TL8A 2CLCX 3F5FA 3U7FB 4IVRA 1YR9A 4IW3B 4UNSA 1CS4C 1D9XA 3BH7A 3X1ZA 3U7HB 1AGRA 1T0JB 3IUYA 4MGYR 1DARA 3AVVA 2IXGA 2OO7A 2PT7A 4KFTA 1CJTC 1VYTA 1AKYA 1YQTA 1TF2A 2QI9C 5CLLA 3PXGA 1R0XA 3ZVRA 4QM6A 2GHIA 3FWYA 2ZRPA 1NG1A 1TX4B 1NIJA 3GD7A 1CLUA 4B47A 4KLZA 3T5GA 3ZGXA 1Z6AA 3GLFA 4C3ZA 1E69A 2AKYA 1W36D 2J0QA 1K8RA 2ZUDA 3KKQA 4ZV4A 2NTYC 2WPDD 2Z5FA 2XEXA 4QBGB 4DSNA 4PC6A 4AKHA 4LV5B 1E99A 2Q9CA 1DTSA 3I8SA 2E1RA 4F4IA 5CLQA 1XEWX 5IK2A 1CR1A 3NC1C 3BH0A 2IWHA 1E6CA 1SULA 1VIYA 1RJ9B 1EFRD 3ND8A 3DL0A 1OT3A 3RWOA 3OIUA 4Q4AB 3FKQA 3BC1A 3A4LA 8OHMA 1N6OA 1II9A 3LQRA 2NO7A 4PHHA 4NCJA 1P6XA 2QM7A 4RCZA 5EE5B 1Z29A 2YZ2A 4G3XA 3W3AA 4C7OB 2VP2A 1QBKC 2HCJB 1G18A 1NNEA 2FA9A 2KI5A 2VPPA 3UXMA 3SYLA 2DCUA 3GJ8A 1F48A 4LV6A 2BHRA 2YHSA 2V4ZA 1TAGA 3EZFA 2B92A 2GZDA 1LF5A 2ZJ2A 2IHYA 4KHZA 2DBYA 2ZS7A 3UMRA 2AK2A 2Q3MA 3HYTA 3N70A 4CEIB 3OIWA 1XMVA 2QG6A 5KUTA 1E9DA 4C2TA 1UPTA 2R6CA 3W8NA 3RLFA 5KO2A 2H17A 2E9SA 4PQRA 5KNBA 4KO8A 1KAOA 1CKEA 4V0KA 2DFLA 4CDGA 4HB3A 3A36A 3HWSA 4TYQA 2R44A 5EXPA 5L3QB 4E09A 4JLDA 2GAAA 5L3SB 1NG9A 5CITA 4BLSA 2FFQA 1J8MF 1S0UA 2YOGA 1Z2AA 4P4UA 1E79D 1XXHA 621PA 2PLRA 3TMKA 1GITA 2G1KA 4LRWA 4C4PA 1EFTA 4KCGA 3KUDA 4KFSA 1DADA 2FH5B 1RKBA 4B6EA 1COWD 2Z4RA 1J90A 2FU5C 2J87A 3BB4A 2OBMA 3CWQA 2ZYWX 1KKMA 3CX7A 4YMSA 2IUUA 4PZLA 4LDJA 1CR0A 4C0KA 1QVRA 1JQJC 3T06B 4EFNA 3DKPA 4KBGA 1P7CA 3GCGA 5HZKA 1AS3A 2NOAA 1B23P 4EFLA 1EX6A 4KSBA 2BDTA 3H0KA 2H18A 1X3SA 1Z08A 1N5IA 5EP2A 1BH2A 3ASZA 1BO6A 3GLFE 2ZJAA 1IN4A 3AKCA 1LFDB 3NC0C 1RRPA 3HU3A 4K46A 5JSZB 4QL3A 1I2DA 2FSFA 3OFNA 5DISB 1XTRA 3R7WA 1AA9A 3QY0A 1KJWA 2C5LA 4IRUB 4Q9KA 2RGBA 2W6JA 1DPFA 3WY9A 4E5UA 1AN0A 1YZKA 4I1OA 1R8SA 3K0AB 2OEPA 2XITA 3FHOA 5JBQA 5H68A 1LS6A 1CEEA 2GXQA 4GBMA 2ANBA 4WXPA 3QSYA 3AP3A 3TSZA 4B34A 5J4LA 1DO0A 2EU8A 4M4SA 4QNRA 4DB4A 4HB0A 4B3BA 3VKHA 3EC2A 2JJ8A 2VHTA 4XVQA 4A0FA 3NH9A 5JRZA 1DAGA 2YWGA 4TQ9A 4CEJB 1EX7A 1AS2A 2CLDX 3B82A 3ONWA 1OLOA 1Z6YA 5JECA 3KJIA 5HTKA 1G291 2REBA 1JXMA 4D0GA 2WJGA 3QKRA 2J45A 1D5CA 1XB2A 4MGZR 4RSGA 4RKFA 2E87A 4XOIA 1HA3A 2JA1A 2RGNC 1SXJD 4M9XA 4DCUA 5D3QA 2KSQA 2O8FA 3EW9A 2GZAA 1NVVR 1M7GA 3KXIA 3JVUA 1JQLB 2NO6A 5LBIA 4GRAA 2JLZA 1G8GA 1OV4A 4ILEA 4Q1AA 2PZEA 3LY5A 5FPYA 2GXUA 1YKSA 1FP7A 2F3TA 4Q47A 2B6HA 2ZVQX 3BBPA 4DSOA 1XJCA 2QM8A 4B43A 4WIAA 1DBSA 1L4UA 1XXHE 1UFQA 5AUPB 5J40A 3UIEA 2H8KA 1AZTA 4NYIQ 4TMXA 4EDHA 4A36A 1QG4A 3RAPR 1Z07A 5DLQC 5FBVB 1U9IC 2GA8A 2GF9A 2FPMA 5FUWA 3CO5A 2PJRA 2NO1A 3VNVA 5E3HA 1H8ED 1GTVA 2GWHA 1T8TA 4N0DA 1EESA 4JZKA 3NDPA 1II0A 1KJYA 3BD9A 4BQSA 1OH5A 1US8A 2V1UA 2JLXA 1U2RA 4LHVA 2WOOA 4KODA 1W49A 1ZNYA 3ADKA 4HEJA 1H65A 1XEXB 3TAHA 2F43B 3G5UA 4QBFA 4I4LA 2PMKA 3VMFA 1DE0A 2Z43A 3EZ6A 4ZO4A 1ELOA 5A4JA 1VIAA 2GK6A 1QHSA 2IS6A 4NDZA 5EZ6B 1C1YA 1FQKA 4URYR 4ASUA 4NHOA 3RS3A 4LYJA 3PG5A 4MUBA 4Z54A 1XTSA 4OJKA 3UWOA 4IOJA 1Q3HA 1KY3A 4G1UC 4DUGA 4RD1A 4JLAA 1ZM2A 2RHMA 4TYYA 4LC0A 1M7BA 2GBLA 1O3YA 1NJGA 2A7QA 5ELXA 1Y3AA 1Z6XA 2QP4A 4WZAE 3UMFA 4C0AC 2DWOA 4QRHA 4EQ6B 1SVOA 1OH7A 2FG5A 1M34E 2IYLD 4DDTA 3LH5A 4F7WA 2D74A 4U00A 3PV0A 3GFTA 1A2KC 2RCNA 5AUNB 1ZCAA 2QE7D 2QROA 4KV9A 4JL8A 3EWSA 5EP1A 5FI1B 1KI6B 1F2UB 1HUQA 2H57A 2ZE7A 4Q1FA 4QBHA 2ASEA 2WAYA 4CGZA 1QZXA 3KJGA 5HE8A 1GRNA 4B71A 4HLUA 2H16A 4JYCA 3K0CA 5SZIA 4MYCA 4FN5A 2NG1A 4L5BA 4XWAA 1D2EA 4V0OA 2GTPA 2J3EA 1KZ7B 4TMZA 5BYKA 3IPYA 2WPDA 1ZUHA 1JAIA 1KTVA 3QF4B 3KKMA 4KLNA 4LGMA 1QHYA 2CNWD 2G77B 3MWYW 2OFXA 1JAHA 1EFRA 2WWHA 2AHOA 3UKDA 1T91A 4B3FX 2Y8EA 4D82A 1U81A 4OK5A 2ZR9A 3SEAA 5SZHB 2P6RA 1VDZA 2DR3A 2CVHA 4AURA 1S9DA 1JI0A 1SKYB 2AL7A 2YWEA 2DFNA 4B2IA 3CUEF 1E2PA 1CR4A 2ZRMA 3AF3A 3A1VA 3MSXA 3IIKA 4PAQA 3ZS9A 4R9UC 4GOXA 1G8FA 1ANKA 2ZRGA 3O8BA 5FTLA 1OFHA 3CF0A 4WVFA 1T9HA 1G3RA 4JLBA 2ERXA 3DOEA 1GSIA 3Q3JB 3SYKA 4D80A 1W5TA 3C15C 1P5ZB 2HYDA 2V3CC 2J0SA 1Z0FA 3BFXA 3LQQA 1N0VC 2QGZA 4LJ4A 4JVLA 5FUXA 4A2QA 4IEEA 4YMTA 3GLGB 3B1XA 1RE0A 3QXSA 4HYYA 4ZIRA 1N6PA 2D2EA 2QMUA 5DN6D 1G3IA 2AD5A 2RAPA 2OBLA 1LY1A 4JBYA 4NYMR 5SZKB 3CW2A 4IFBA 4U7DA 2ZXUA 2IC5A 3CLVA 4DCSA 3MWKA 2IEZA 2VQSA 1UDWA 1G3QA 1W0KD 1ZNZA 2A5FA 2AXPA 4GT1A 3THOA 3UG6A 1E2GA 3VHXA 2PT5A 3LWNA 4ZDWA 4DZZA 5HPYB 2ZM5A 3CX8A 5FUYA 1NBMD 1E79A 2WJVA 4JLPA 2BWJA 1U99A 1ZW6A 2N46A 3OIVA 4ZKEA 2I3BA 2R62A 3RSLA 1GNPA 1NMYA 1R5NA 1C9KA 3MFYA 1KO5A 4MKIA 5EXTA 1COWA 5TMPA 3QG5A 4KBFA 4I81A 5FL7D 3QIAA 1Z0JA 5C1BA 1KSGA 2G9NA 3TSOA 4C0JA 5HCNA 3RSOA 1TUEA 4G01B 4M21A 2ZRCA 2ZI5A 3KFXA 3I1FA 2ZJ5A 2VO1A 2O8BA 5LD2C 3O8RA 1SKQA 3IHWA 3R20A 4LC1A 2V6IA 3GLGE 3LXRA 3SBEA 4DIEA 1E32A 3WNBA 3SDZA 1A7JA 5EXSA 4OHYA 2EFDB 2RB4A 1M2OB 1G64A 5BQ5A 1NP6A 1IXSB 3LBNA 2ZJOA 3B2EA 2V9PA 2AR7A 4TMTA 4FWTA 3FDIA 1BYUA 1ZMXA 1N6RA 3LRPA 3R8CA 1E2JA 4PAOA 3PR1A 3TQFA 4CT5A 1ZINA 2P65A 2LKDA 4JKIA 1RFLA 5TVKA 2YWHA 5KU1A 3LO5A 1PLJA 2GEUA 2IYXA 2V8OA 2RGEA 3Q9LA 2O5VA 4M1YA 5DH9A 3BAFA 2PEZA 2HEIA 2XTNA 5E95A 1KMHB 4M2LA 5KTYA 3LNCA 4D25A 1QHHB 1W0JD 2HUPA 3GLHB 4F93B 3VQTA 1T5LA 1TF5A 2F9MA 3KTAA 1MO6A 2CE7A 5G40A 3B60A 3L0SA 2O8EA 4HI0E 2WKQA 4OI0A 3MJRA 1RVDA 4P32A 5AJYA 2J0UB 2HYIC 1ZC4A 2PEYA 3QNUA 4HATA 4JL5A 2JAQA 1GAJA 3TUIC 4ZDIA 1P61B 4JYBA 2ZANA 5CDFE 2WV9A 1DAFA 5JMTA 1JEDA 4CEHB 1PVOA 1NSFA 1W5SA 2ZAOA 3IGFA 1SXJA 4I1VA 2JIZD 2J46A 2Q9AA 3BWDD 1QHGA 1CXZA 2AFIE 3GPLA 4US0R 1JXOA 3K9NA 4LSGA 4G0NA 2PX3A 3NXSA 4UJ5A 2BEKA 4MYUA 1P3JA 2YC2C 4OHVA 1ZU5A 4GDFA 1CBUA 5KDLA 4M9QA 3SOPA 1P2UA 4C9BA 2QT0A 1C4OA 1FX0B 1M8PA 3C5CA 2OUKA 3TVTA 2RGXA 2R6FA 3CWZA 4Q9HA 3GLIA 2ZU0C 3H2YA 4QXAA 4Q4JA 4HAUA 1EXMA 4R2HA 3REFA 1Q0UA 1IBRA 3ZZUA 3F8TA 3PEWA 4ESVA 2R2AA 1MO5A 3D8BA 2FWRA 3VTKA 1MKYA 4XIGS 4OQMA 4IVPA 2QUZA 2RMKA 2A5JA 1JJ7A 2J41A 4P4SB 3EPHA 4JKYA 4C0HA 1TQ4A 2OM2A 1H8EA 4BUJA 1KSJA 2QAGA 3QOFA 4UXHA 2J1LA 4TLBA 1OFUX 4A4DA 1T3LA 2VH5R 2W6ID 1ZUIA 1KNQA 4NYMQ 3AP1A 2XTZA 1Z0AA 1N6IA 5C18A 4JJZA 1KO7A 2FEMA 2DYKA 3TUZC 1XCGB 1WXQA 3E1SA 3LBHA 1W4RA 1S3GA 2QGNA 4LBYA 3HPQA 1R5BA 2ZU6A 4IDHA 3BORA 3DPUA 5H1YA 1S4QA 4TLCA 1YHNA 4BLQA 3U5ZB 2BBTA 2ZAMA 3RWMB 4JLVA 5EUQB 3W90A 2NMVA 1NJFA 4XH9B 3ZLJA 2N1BA 5IRCD 2TMKA 5CJ2A 2IS4A 4RZ3A 3ZJYA 1BMFD 2IA5A 1RZ3A 1AZSC 2JLVA 3E70C 2CL6X 1YE8A 2QL6A 3E2IA 4X8LA 1Q1BA 1VG9B 1XTIA 2EFCB 4JIMA 3AVOA 4JLOA 4PTLA 5J4YA 3K70B 3WNCA 3TJZA 4A6PA 4Q7MB 3Q7QA 5C4MA 1KZGB 4UXIA 1E1RD 4OK6A 5JI3E 4NTZA 2QE7A 3P1JA 3ZVMA 1FFHA 3AB3A 2IYYA 3T61A 4BLPA 1BS1A 1VCIA 1R2QA 3O8CA 4P0TA 1OIWA 1UEIA 3HPRA 4K8OA 2GJ9A 2D06A 2P3SA 5DI3A 1NLYA 3R8FA 3L2OB 4NZYA 1PUJA 2GEDA 2AFHE 4URWR 3ZQ6A 3W5JA 2XX3A 4MYTA 3RNLA 1GRQA 4Z51A 1SXJE 4URZR 2B8TA 1GKYA 1UEJA 1Z5ZA 1W46A 4BASA 2XAUA 2ORIA 4O25A 3UK6A 3B1VA 4TMKA 5FPHA 1II8A 1XCMA 3FYHA 1OXVA 2CLSA 2EFHB 2CNWA 2QQEA 2JLYA 1UJ2A 2WWIA 2GRJA 3LDAA 3ICQB 3GEHA 2VSXA 3NVAA 4LOAA 4WZ6A 2GZHA 1GWNA 3KKNA 5KOYA 3G0HA 4A8JA 4PZYA 2C9CA 2W58A 1WDTA 3A58B 1G4UR 1XD2A 1X1SA 1E9BA 1ETUA 1HY3A 2NQ2C 4Q19A 4BECA 4GL2A 2C78A 1KOFA 1NN3A 4Q9JA 1F5NA 4HLCA 1JR3A 2OXRA 4GZLA 4YDSA 1CIPA 1UADA 3C5HA 1WF3A 1WRBA 3F0TA 3M6AA 3KL4A 4QG7A 2BBSA 1IY2A 5ANRB 2CHGA 1U98A 4AG6A 1FUUA 4AC9A 5J47A 2BJVA 3WRYC 4AIIA 1QG2A 2WBLC 4PC7A 1IQPA 4RJLA 1T0HB 3SJCA 1N5KA 2AWOA 3VU9B 1VG8A 4JBXA 3L8YA 2FN4A 2ZRNA 4CYMA 4TMVA 1N2CE 5DN6A 1G8PA 2ZRDA 2QNRA 1ZNWA 2VHCA 1KO8A 4G5SA 2FFBA 2ZRAA 1A5TA 2DWQA 5EXXA 5HKKD 5LD2B 2G6BA 3NHAA 4LBZA 3SQXA 4ZDJA 3D6TB 3Q5DA 4LWZA 4BLTA 2QBYB 1ZM3A 2D3WA 5TV2A 1MO4A 1V43A 2C96A 2GESA 2Q3HA 2ZTSA 4Q4AA 4DHEA 1W0KA 3H4MA 1A1VA 1W44A 4L4UA 4U02A 3LBIA 4AYXA 3SFVA 2O0HA 4D4KA 5HE9A 1NBMA 2YINC 4BLRA 4PX9A 2NPFA 3DMDA 1FTSA 1E2IA 4C7OA 121PA 1AM4D 3CF2A 2X8AA 4JLNA 5F9HA 4Q02A 3T12A 3QEJA 4QJ3A 3AGQA 3K8YA 4D4LA 3OESA 3IO3A 3KXKA 4HB2A 1ZBDA 2QP9X 4XTCS 5FL7A 3D31A 4ZCMA 2VLIA 3N5CA 3O8DA 4MDEA 3QKSB 4Q21A 4CEIA 1SHZA 4DLYA 1N6KA 2F6RA 1XMJA 2MMGA 3PUWA 4Q4HB 3JVVA 1HH4A 1MABA 2A78A 3ZYCA 1CJKC 3LW8A 2VHJA 3SNHA 2C8VA 1TUIA 4D6PA 2ZSDA 1E0JA 3V4RA 2WIBA 1HV8A 1E9RA 1Z0KA 5L3QA 2WMNB 1E2DA 5L3SA 2O0JA 4II7A 3EPLA 3DDCA 3WBKA 1KNXA 1U94A 4LY6A 3WRXC 4TYNA 4TLAA 3B13B 2ZYVX 1E0AA 3RS5A 1WBBA 1ZUNB 3U3RA 2O8EB 2PZGA 4JBWA 2NZJA 2OZEA 3KXLA 4V0MA 1U0JA 4EJSA 3I5XA 5F9FA 2OG2A 3C7KA 1OJLA 3M0EA 1OH8A 3D3QA 2FV8A 4PXAA 1PZNA 1XWIA 2REOA 3GLFB 1NMXA 1W0JA 2ZR7A 3EXAA 5A0FA 2FSIA 4TL9A 4BZXA 3ZVNA 1OHHD 2QTHA 3EPJA 1N3BA 2WJYA 3PFIA 2OAP1 2WWFA 5CK4A 3NDBB 1IN6A 3MAAC 1ZM9A 2PL3A 3IQWA 1FTNA 2R9VA 5J4VA 4JL6A 2J0VA 1U8AA 3CRVA 1G16A 2FJUA 1I2MA 3MLEA 4ERNA 5C4GB 3QI2A 3B8HA 2OCPA 2ZYUX 2VP9A 5KPDA 3AVWA 2ONKA 1A4RA 4OI2A 2JIZA 2PBRA 3KFVA 2C2HA 4TN1A 1IXRC 1ZP6A 4W9MC 4BZPA 3DZDA 3QUSA 4RCYA 4ZCLA 3AUXA 4K81B 3RABA 3KQUA 4O3MA 1VCNA 2Z4SA 1E1QA 2YOFA 5JI2E 3UPUA 1UF9A 5JLJA 1G5PA 3RS2A 3NIBA 1ZD8A 1YRAA 4HLUC 1RRFA 3K0CC 2HDNB 4LK2A 5IHPA 2FFHA 2WWGA 1IXZA 1W36C 1S8FA 2J9RA 3QKTA 3DOFA 3K0FA 3VNUA 2GETA 4CT4B 1JB1A 1F2TA 3U44A 1X86B 3OEED 1XU4A 4O2LA 5DHFA 3SZRA 1G19A 4TQAA 4UQOA 5FOUA 4Z1MD 4G5RA 1OYYA 1FNNA 4Q1CA 3HU1A 3TBKA 3VKGA 5AR1A 3W6OA 2WVJA 3K09C 4XWKA 2HF9A 1KO1A 4IOMA 4R7ZA 4GZMA 4B73A 2FPKA 2W6IA 1HTWA 4KXFB 2G0TA 2FGJA 4PPGA 2WSMA 2WTUA 3RYTC 1P4SA 3P32A 2VSFA 4XSGA 4FCWA 4YMWA 4LBWA 3FOZA 4AKIA 1XXHB 3NH6A 1S2MA 3QXHA 4OQFA 2HT1A 1XZQA 3LX8A 1NN5A 1G20E 4E07A 2RGCA 4ZCIA 4F92B 2AX4A 2F3RA 4D0LB 2IBMA 5K8LA 5JJIA 3VR2A 4ACBA 1IAQA 3MRSA 5CJPA 3JZAA 4MKGA 5EZ5A 1UKVY 4QGFA 2ZRBA 4BFVA 2CEAA 3PVSA 5C46F 1L4YA 1MT0A 3FGNA 1BMFA 3RDPA 1T8UA 2XZPA 4IDPA 2ZEJA 4O2RA 1RRGA 3KQNA 4ZKDA 3IIMA 2RGAA 4Q00A 2JASA 2A2ZA 2NO9A 4N1AA 4PHGA 4BLOA 4YMUA 3PEYA 2QMHA 1P62B 4JLMA 2G88A 1E1RA 1JECA 4BFYA 4TL6A 4JSYA 3EZ9A 1XCPA 5FBRB 2G3YA 2HJVA 4ARZA 2NPIA 4KAXA 1LW7A 2V1XA 4TT3A 5K8UA 1S3SA 4LJAA 4TTPA 3R7WB 1N6HA 4TLDA 2MSEB 4BFXA 2RGDA 3LXXA 1Z6GA 3MG9A 2OCBA 3AF0A 2QT1A 3ZVLA 5D3MA 4URUR 4FINA 3TQCA 1M1YE 4C2UA 1ESNA 4Y0VA 4JT4A 2F9LA 1MRNA 1DO2A 3ZH9B 4RD2A 4DLWA 1KI7A 2H7VA 3Q72A 2XB2A 2RGGA 5TY0A 3B85A 4RFVA 2F1RA 5BW8A 3CNLA 4DC9A 1KI9A 2OSBA 3WXMA 1JBKA 2IF0A 1OXUA 1XJQA 3K0EA 2ORVA 2GJSA 5BYJA 2ZETA 2ZR0A 1NVWQ 1JNYA 3JZMA 2QZ4A 5GVSA 3WMFA 4EQ6A 2BMDA 4NP6A 4EPYA 1YZTA 2GNOA 4N3NA 4DCTA 4BFWA 3QKRB 5FBQB 1GRRA 3QQ5A 4RFSA 4C30A 3F3YA 4UNRA 2JLRA 1JALA 2VHQA 2QA5A 1Q1EA 2W2XA 4UXJA 1TNDA 1CP2A 1IN8A 3GMTA 4BWYA 2VTKA 3FHTA 2O8FB 4LPSA 4N0EA 2IYZA 2O8CA 1HQYE 3ZIAD 1FL9A 1R7RA 5B2ZA 2W0MA 1E2EA 3OAAD 1YR7A 2WWWA 4PPNA 2VA8A 3T34A 2XGJA 3B5JA 5FR1A 1E9EA 3QKUA 4Y0AA 3CRRA 4KYUA 3TH5A 1SVKA 3NBZC 3RVBA 2BBOA 4QC2A 4W5JA 5GJCA 1E2FA 5HKKA 1G17A 1N0WA 2QPTA 4OHWA 4QHSA 3EA5A 1KI3A 3RRZA 4B3CA 4F4JA 3B7GA 3U6KA 2ODBA 2P2LA 1K5GA 4WXRA 3U3JA 2Q3FA 2WJHA 3AVUA 2L0XA 2CHVA 4TWZA 3VX3A 5J5CA 2YVUA 1SVIA 1OF1A 5FTMA 4IOKA 3TR5A 1EWQA 2O8DA 4YC7A 3RRNA 3KQKA 2O52A 3C8UA 2YV5A 1US8B 2IXEA 1SXJC 4GFDA 4BFSA 2JJ1D 4DWJA 2JLWA 1G1MA 3FMPB 1E9SA 1ZAKA 3VAAA 5KHOC 1GUAA 3KX2A 3SYNA 4QGGA 2DWPA 3TGPA 2IS1A 2OV2A 4C0LA 4B75A 3QXJA 1KI4A 4DLXA 3U2QA 3ZS8A 1E3MA 5F2EA 4M0LA 3OZXA 3WHLA 1VG1A 4UJ3A 1E9CA 1XBTA 2ZYTX 4FXPA 4LJ9A 2C98A 4UNNA 1G5TA 2UZ3A 1W4BA 3PUXA 1HYQA 1EWRA 1VYUA 5HCIA 4DSTA 3B9PA 3KJEA 5UKDA 3KQLA 1N6LA 2J7KA 2K5UA 3LFUA 4DJTA 3K70C 3RS4A 1TQ6A 3DMNA 2XNDD 3GJ4A 2GXSA 4B2LA 4PC1A 1G3UA 4KSCA 1UBGA 4PO1A 3ADCA 4MDFA 1JR3D 3KJHA 4Q1DA 2FMXA 2DY1A 5FPTA 1E0KA 1U0LA 3QPWA 2BKUA 2VYFA 4G5QA 3U3MA 4EFMA 2ZJZA 1P2VA 3RHFA 2QAGC 1OW3B 3VFDA 2WSSD 2C03A 5CYPA 3ETLA 4RD6A 3LAWA 3T1VA 4GMXA 1UAAA 2Z83A 3NKVA 4L15A 2GEVA 1NVVQ 3K53A 1OYWA 4V0NA 3EARA 3R9WA 3TW4A 3CX6A 2GJAA 3U7GA 3RC8A 2G0NA 2CVFA 2CCKA 3AKYA 5G53C 3SJBA 3C16C 2F1JA 4DDVA 2HXYA 5FBWB 3WMGA 4A1FA 2QPOA 1W36B 1UKYA 4V02A 1N0UA 3RRMA 1OHHA 4LHYA 3FMOB 4DXAA 1QHXA 4OBEA 4DBLC 4JJKA 1J99A 4ZDKA 3VR1A 5CM8B 2ODEA 3OE7D 2EVWX 3FMFA 5FPKA 3TNFA 2KE5A 3D7MA 2C9YA 2GJKA 1NKTA 2IW3A 3L0IB 1D9ZA 4FCTA 1FPMA 2JEOA 2RGNA 3FVQA 5DO9A 3SJZA 4YMVA 1ZC3A 2R6AA 3FMIA 3PENA 2CXXA 2WIAA 1NMZA 3PITA 1R0YA 2C04A 3GQBA 3I4LA 2FNAA 3GJXC 4NBSA 1Q1ZA 1GG2A 3EZ2A 4PC2A 4QOSA 2UVQA 2ZRIA 3SHWA 4IHQA 2H92A 1AK2A 2OILA 1DAEA 4B35A 5KPJA 3CH4B 1Z83A 2WOJA 4NE2A 2BVNA 4PZZA 4MKHA 3KKOA 1X6VA 4FMCF 1KMHA 3J81k 3LLMA 1QHHA 3GLHA 4TTQA 4B3XA 1FZQA 2ZITA 4ZIRB 5FTJA 3KKPA 4TLEA 3OEEA 3SQWA 4LJ6A 5EJEA 3THWA 1P73A 3FFBA 1YU9A 4OYHA 2HF8A 4Z1MA 4DLUA 2YJTD 3IILA 2WKRA 4GNKA 3OIYA 3X1XA 4PSVA 1R6BX 3GJ6A 4Q1BA 2YKGA 2ZJBA 4A0RA 2XJ9A 1OSNA 5JCZA 5BXQC 3SBDA 2WICA 3M1IA 3QVUA 1ZIPA 2F7SA 5JZVA 4MGKR 4NMMA 4LJ7A 3EIHA 2BCJQ 3AV0B 3BS4A 1L2TA 1KSHA 2MSDB 3N2IA 4IDOA 2Q0HA 2ZRJA 4A0HA 1FX0A 4HAWA 2CBZA 1JPNA 5CB6A 4BFZA 2FF7A 4YLGA 2KBFA 2FSGA 2XB4A 4Q5IA 3W9YA 4L8GA 1DG3A 1QVAA 4O0MA 4DCVA 2BIFA 3QPVA 3U4QA 4P31A 2MSCB 4Q7LA 1RPZA 2GAOA 4LI0A 2WWYA 2KBEA 4MUAA 4NCIA 2ZS8A 5B64A 1RRCA 2ODWA 2O8BB 1O87A 4RVCA 4I1SA 1AQYA 2ZI4A 4A0GA 4Z8YA 3G82C 2H1LA 2VF7A 2WJJA 3BFKA 2CJWA 1GM5A 3BIFA 1J7KA 2YNMA 5IDVA 1UBEA 3CNNA 5L3VA 2ZE5A 4RY2A 4BFTA 4HUQA 4KVGA 5F3WB 1ESMA 2JGNA 1KMQA 5FFMA 3THYA 1S96A 3BGWA 1E1QD 3SR0A 1CRPA 3DZ8A 3AUYA 1P9NA 4GP6A 1W1WA 4HZUB 1VHTA 3W3ZB 4GP7A 1XMSA 4IFEA 3Q7PA 3IKJA 2QMOA 3VX4A 5JCPA 3A4MA 3T1OA 3AVXA 4B3DA 4DLRA 4UNPA 1KIMA 3CIOA 3QPUA 2IYSA 1EFHA
chains in the Genus database with same CATH superfamily
4RHYA 4H1UA 4YCCA 4AMYA 4E14A 2C7PA 2AQ8A 1GL3A 1MPTA 1SQ5A 1UKCA 3PP8A 4XARA 1QHFA 5DBIA 1K4MA 5E0KB 2FWNA 1JH8A 5AVTA 1TQ2A 5AJHA 4LRSB 2HA6A 3HCEA 5F76A 2PFKA 5GVRA 3LDFA 2GJ8A 5REQA 2QWXA 2HWUA 2LIVA 1BJTA 1Q12A 3SS7X 4H9GA 4AWAA 3JQAD 3N8NA 4G67A 4YRIA 3KEOA 5KB3A 1IOVA 1P2TA 1FPQA 2FCRA 2Z1NA 1UJ4A 1WUIS 2ZQZA 3FTCA 3OP4A 4IUCS 4NZ9A 4RV9A 5IBPA 4I1UA 4ZEVA 2C2BA 3FE2A 3IP6A 1IPHA 1DG1G 2CHEA 2H59A 1BHJA 1XLVA 2JGJA 3VR3D 1I2ZA 4IDQA 4R9RA 4ITRC 1JEQB 1RRVA 4Q3DA 3I01A 2R8XA 4F96A 5ICSA 4AQDA 2UZAA 5LZ8A 3L01A 2CXRA 3AJDA 4FGUA 5DTEA 3MGCA 2BUBA 2PGAA 1XQWA 4UOQA 3ZTTA 3QBVA 3I62A 3HCCA 4IXDA 5BXYA 1FW6A 2R1VB 3ZIAA 5JSHA 3AP2A 3D3WB 3VZPA 4DT1A 2H2FA 4KFCA 3AUAA 2BPOA 2QLFA 4DRZA 2VBIA 3SJ7A 3VH3A 3VSEA 3W6UA 2OL4A 2IZ6A 5B12A 4DR6B 3D59A 4M54A 3SJAA 2P4EA 1FEZA 3TQQA 1YS2X 1H5UA 1HGXA 2PX4A 2YS6A 3OVMA 2YS7A 1WDMA 1Y9EA 2RBKA 1JIIA 3G2LA 4TL7A 1XNJA 1NC3A 3DUFA 5EC8A 1C7IA 5JFOA 3HCBA 5AKXA 1L5OA 4IX9A 1X2BA 1QUFA 2V4MA 3T3EA 2EW2A 3G8DA 1S6YA 4Z9FA 5GADl 4YASA 4OX9Y 3B3FA 3U4MA 2P2ZA 2HCRA 2PL5A 3K6SA 3S5UA 3C24A 3BSYA 5AI0A 1J8FA 5CFLA 2Z2YA 3ZD8A 2X0EA 4B0OA 3WBJA 5ICFA 3N7AA 4A0QA 4DIDA 1V6CA 2XADA 4C6SA 1FB5A 4FDAA 4A23A 5F2NA 4TWBA 4NPHA 4EY3A 1V5EA 2OHVA 4TSFD 1U2TA 2SICE 3W4IA 1NPDA 2JJ1A 3GJ5A 2IYWA 1Y5RA 1N2CB 3SQOA 3FIUA 5EHGA 4LF8B 1KO4A 4O4LF 1FVOA 1ATIA 2VDVE 3I1YA 1HE1C 3DEIA 1JQEA 1XQYA 2QL7A 2ODQA 2ZREA 3MQ4A 4WZZA 5A4IS 1JVSA 3V4FA 1A2QA 3NONA 1YC5A 4W1RA 3WZ2A 3JQRA 4YCLA 5AK5A 1GTL1 3EH2A 2V65A 4CW7A 2J6BA 2HADA 3M83A 3UICA 1SURA 3H2HA 1KHTA 4TZ6A 3LBAA 3RC3A 4V38A 5EEHA 5GY7A 3AI3A 3WGLA 1XTJA 1Z73A 1USIA 4WOCA 3I3SR 5TB5A 1SZPA 1H2FA 4RZUA 2FZLA 2REXB 4D4IA 4DWOA 4YCAA 5EJ5A 3GLIE 3NGMA 2QN2A 1SGWA 5H59A 2WV7A 5F35A 3PJFA 3S2YA 1KAGA 4EAQA 3UAZA 4DRYA 2PIAA 5I9NA 2R7LA 4OM7A 4FW8A 3QX3A 3CG0A 1KU0A 1J42A 1TJ3A 3SGLA 1EZ1A 4JS0A 3I61A 3WK6A 3MBOA 5KSZA 4K28A 3DZGA 3HWX1 4KLAA 1A9ZA 2I1LA 4PYJA 4K1XA 3I64A 4WNIA 2CLFB 2X1HA 5KU7A 2WSSA 3ZY3A 2AG0A 4UCWA 3QVMA 4JJGA 1FRVA 1ISFA 4TS1A 1EDDA 3ZQ4A 1ZJJA 3DM9B 2TMYA 3AOEC 5INTA 4J2HA 1SCBA 5HP4A 5F4BA 1NF3A 3INNA 3OECA 5L40A 4O1MA 2X3FA 4PCVA 1LTQA 3A1TA 5C37A 2J7PD 3T1TA 1IRIA 3HSYA 4Z9XA 5KDDA 4INZA 4JYZA 2AZMA 4K05A 3KYJB 2FW1A 2I9PA 3LWBA 3P19A 2YQ4A 4AN4A 2Q29A 5AJVB 4CFSA 4JLKA 4ZEXA 5F2OA 1BXGA 1JS1X 4NKRA 4U5XA 2GKSA 3NEJA 1JXAA 2J9GA 5K8IA 2OZPA 1SD5A 5BWBA 2H4HA 2H1WA 1GPLA 3BWYA 2Z0MA 5FWXA 1JKMA 5JAIA 1RIFA 1UM8A 1KP2A 1U65A 3OE7A 3CKLA 1PD1A 2LCIA 5B3AA 3EHDA 5AKZA 3EPKA 4X8OA 1K6EA 1SC4A 1G2IA 1TQDA 4D9GA 4QKQA 4WCFC 4ENSA 4D81A 2AOXA 3PKIA 5CMLA 2AK3A 3N58A 3OQ6A 5JAPA 2Q4DA 3H04A 2OYRA 2TECE 3OLVA 2IHZA 4UMFA 3UAXA 1B26A 5GONF 4HVLA 4ETWA 1EVQA 1QCDA 4IKEA 1N7GA 5IUJC 2HK8A 1Z33A 1T3SA 1LRLA 2QG9A 2HA3A 2BHNA 3QENA 4AJJA 3PD7A 5DTRA 5KTPA 1XJ0A 2WFLA 1BRTA 2OZLA 3B3AA 1FOEB 2GN8A 3GJ0A 4I50A 4FVTA 3Q85A 4RPCA 3TE6A 3WL8A 4E15A 3EGXA 1TIPA 3OX3A 4E13A 1WE2A 6YASA 3SKVA 3OUZA 4J4TA 4W1SA 5K9ZA 3BT7A 4D8VA 3HKBA 3N86A 1V7PC 1ZHOA 3SS8A 1QK3A 2AR0A 2G83A 2N75A 1SIBE 1U8TA 3LLCA 5AIAA 3LI2A 4DWVA 1JIKA 1CC1S 3P2EA 2CMDA 2QVBA 4X7RA 3HYCA 3O4HA 3RG2A 1SBYA 3N7TA 4BV3A 16PKA 1X7WA 4H7IA 5IW8A 2P4SA 1QH0A 2OCLA 2P1ZA 1Y1RA 2VT6A 3AW8A 3G9QA 4PQEA 5EE1A 2SBTA 5A9SB 3ZH2A 3EC7A 5LQKA 4IG4A 2XUFA 3OOSA 1KYIA 3PIRA 1IN7A 2YV4A 4A15A 3WMEA 1L4MA 3EGOA 4GPTA 4MLPA 2H2WA 4OAQA 1IZ7A 2YXLA 3AR4A 3G13A 4GOKA 2W2LD 5JNLA 1G9XA 1URPA 3CGWA 5CLIA 4AKGA 1PUXA 5JRDS 1UH5A 2H2AA 5FNVA 3PPVA 4P35A 5FV4A 1JJAA 1NL3A 3WK4A 5E3JA 3REQB 5KVCA 4OG2A 3GMSA 3EEOA 3SHFA 1GPH1 1YL7A 2V55B 2II6A 1L5FA 4YRDA 4EG7A 3ZNQA 4R2IA 4QO8A 2Q62A 1CCWA 4WXYB 1Y8QB 3TLMA 4B6PA 2V6JA 3I12A 1B3RA 2PO7A 3MQFA 4RS4A 4X8MA 2Y6VA 1K8ZB 3Q0IA 4S35A 3VBEA 2Y1KA 5EYPB 1DQSA 1RABA 1B0UA 3M81A 2E37A 2XMGA 3ORQA 2DH6A 2XZTA 4EG6A 1VYHA 4II2A 2P78A 3IAUA 1U1CA 3CEAA 3V1UA 4Y18A 2J08A 2R65A 1NATA 4GI7A 2QUBA 1Q44A 3PGXA 1YOBA 1OVGA 4H7JA 3ILXA 3DD1A 2EERA 4HX9A 5JSZA 4X1IB 5HUQA 4GR9A 4AYWA 3BF7A 2F1HA 4LKOA 4OKSA 1IBMB 2AXNA 1SUCA 1P5JA 4HGZA 4RVSA 1YQQA 3WK5A 4A8HA 4B45A 4UBIA 2QYOA 3BCUA 3B6ZA 4FOOA 3WYAA 4MRSA 1QGUB 3ICWA 1BXRA 3IXLA 1YZNA 3Q7SA 5ENVA 4LHWA 4M1OA 2QMEA 5DVZA 1V11B 3M82A 2PJZA 3FSGA 3PPYA 3WRVA 2J30A 4MWGA 4CKCA 4Q7KA 2GPBA 3AL2A 4RA9A 5IBRA 2Q28A 2V54A 1EP3B 3GFGA 2XRMA 4KW7A 4B3HA 2JLSA 2Z56A 2Q21A 1Z0DA 1ZOLA 4WN9B 2AMYA 3MIZA 4YBZA 5CG1A 4IRXA 2WJIA 1TU3A 3K9GA 1XCJA 4PG7A 5K99A 1FSGA 2MYUA 1Y8RB 3LOUA 4MW5A 1HZZC 4W63A 4JOSA 5TNXA 3JAWB 3V32A 2WU0A 4G2TA 1QRAA 3T4EA 4BO0A 1EM8A 5LYJA 1ZU4A 3OFVA 4Y6GB 1JLMA 3ZX4A 5HKBA 2PH1A 5HQ3B 5G0SA 4AZWA 4F85A 1I7PA 3I32A 4UM9B 5AUOB 4Q4LA 1ZGBA 2E89A 1EG2A 1LK0A 4WV3A 4YCBA 1B0AA 2EJVA 2QQ0A 2E49A 3IPXA 4XVHA 4EMBA 1SXQA 1L8AA 2AV6A 3HVRA 1MC4A 2B9VA 3RV3A 3VR5A 1Z8NA 5LZ4A 3DCJA 2HI0A 2UZ1A 3F7OA 4U4AA 3SSOA 1LNZA 4MCJA 1O6FA 3WWPA 3IIJA 3AR9A 1YJ8A 3F9IA 1HQKA 1BKDR 1PVDA 2HA0A 5JROA 1KI1A 1MO2A 3TLEA 4F8JA 3DXYA 3OIGA 2Z57A 2AKEA 2JFGA 2IEIA 3H0EA 2BEUA 4KQIA 4MP6A 1QF6A 4ZCSA 4DCOA 4DBVO 1WCIA 3ADPA 2I2XB 3DBOB 3HYRA 4G25A 1N9GB 2JH3A 1RKVA 1WABA 3I8XA 1JUDA 3Q40A 4EH1A 1TMOA 3ZV6A 1JBQA 3FETA 1IM8A 2J3HA 4L9RA 3ZHBA 2VNHA 2VL7A 3R7AA 4FI3F 3J7AC 5DM4A 3P2YA 5GONB 2KWIA 4Q82A 2YYZA 1SHKA 4FFMA 2RFLA 3EXEA 3BXOA 4OCZA 1O0BA 2QM3A 3BJEA 4CLRB 3GUYA 1TZKA 5DU2A 4ZRNA 3HABA 5F4ZA 4MR8B 4D46A 1Q1NA 2EATA 1BAPA 3LBFA 1S7GA 3T3IA 4A6XA 1HURA 5BT8A 3NGXA 2IELA 3PFNA 4Z4GA 4QHTA 1EP2B 3EZ7A 1IXYA 1E1LA 1FQJA 3CF4G 3D43A 4XIJA 2QDKA 4YACA 3I2IA 4PLYA 3U3DA 3W6ZA 2FVXA 3IVGA 5BWLA 2GZSA 4OHZA 2VHZA 3C3JA 4KGZA 3VRHA 4H7EA 4HSGA 3VR6D 4BMVA 5K7SA 2FRXA 1T0IA 1U3GA 2F43A 3W7VA 1TFUA 5LZ7A 2J31A 2AT1A 3A28A 4EG5A 4L8WB 2LPMA 5KREA 1WW3A 1LLUA 1RW4A 4GLFA 5LIPA 3WO1A 3CHYA 1IUNA 3L05A 3ZCRA 3AI7A 1DAMA 3ILVA 4J0EA 4MNTA 5F52A 2JLQA 4PYMA 1MJHA 4K6GA 4HBGA 1XHFA 2JANA 4AJNA 4WOPA 4BRZA 3B6EA 3H9CA 1SBQA 4LXGA 4N49A 1UWCA 5CTJA 3GN2A 2G8LA 5I7FA 1XRNA 2JDID 1JZTA 5ALSA 1P7YA 1P4GA 3EGIA 3G79A 1EFVA 3MUFA 3QPCA 5TDHA 4HEQA 2MR6A 2W71A 2YYSA 3D7SA 2R6DA 3GG2A 3I2YX 1B16A 3PKZA 2FPGA 4L8LA 4YNBA 1T13A 4YUVA 2DWUA 1I3LA 4YJ3F 3ZK8A 1BS9A 5JVDF 1ABFA 3D4BA 3F6RA 4LE0A 5DSXA 2X77A 4TTIA 1K7EB 2VRWA 4KQWA 2XTMA 2HDHA 1WU8A 2M1ZA 3BIOA 3DOCA 3LKVA 2VP0A 4GC5A 2CC2A 3VVLA 3HCDA 2NVUB 1BNCA 4IFTA 2B25A 2ZE6A 3P9QA 3QXCA 2XIQA 2IZ7A 3IO5A 1OH6A 4EYKA 3JD1A 4GX0A 4MYHA 4BYMA 5JHHB 3RE1A 4BNVA 1IC6A 3W6PA 1G42A 1NSTA 1J22A 1GPAA 1ZCBA 4DLVA 4QVIA 1IUOA 1BKYA 4H27A 4HWTA 5B58T 1U2QA 1ZRHA 1WHTA 1XMIA 3UEOA 2WT8A 3AM1A 3EULA 4B6GA 1VG0B 2XKAA 2DUMA 4CN9A 1DQRA 2HLDA 4X8HA 3VPDA 2OAQ1 5KAMA 2XWBF 3T15A 1PJAA 4FD2A 3IDZA 3GVIA 1LA2A 1S5PA 1ZS9A 3PRYA 4YGXB 4IGAA 5D3MB 3UN1A 4C7JA 4YPOA 5AD1A 3OLWA 1MRSA 5AK0A 5EP3A 4OFWA 5L51A 2HC9A 3H9JA 2BFOA 3PUZA 3VJLA 4Z49A 1W52X 2QORA 1D6NA 1VKHA 1JEAA 1KAEA 2YBDA 2Z2IA 4A9AA 3QJYA 1Q7CA 4XTRA 3U6BA 3HN2A 2BKEA 2WW8A 4CKXA 5GIPE 4GAEA 1XYVA 8GPBA 1JIQA 3IBGA 2ZI9A 1OXSC 1R10A 3IVXA 3K9LA 4W7SA 5IKPA 2K7ZA 3MGBA 1J70A 1ZWKA 1C7JA 2Q49A 3MWJA 2NZXA 3TKYA 4U2FA 3WFJA 4A0SA 4AZSA 4RKYA 2I7XA 3WLEA 3WLPA 2IY7A 1E4YA 3D3KA 2ZRHA 2HT6A 2QPAA 5CHYA 3PNYA 3QYPA 1GPNA 3BXPA 1J9EA 3NVMB 1K9SA 3GCDA 1D2GA 3WJ2A 1L7XA 3OU7A 2C5GA 5EIAA 4YX9A 1MR3F 1AHPA 3A4TA 4O8CA 2Z08A 4KWEA 1WBDA 1CS0B 1DELA 1OTYA 1GZVA 1S1CA 2NSYA 3O7WA 2GI4A 3DKVA 4BTLA 4CV3A 4V1CA 5ALXA 2B78A 4ZVUA 2IFTA 2J6IA 1L4BA 2QUAA 3GLGA 4WBNF 3OH8A 3GRYA 3O4FA 4G4SO 2KB0A 1O6CA 4U2KA 2YWXA 2GSWA 3NEAA 3GBPA 1P72A 4H4CA 3AR2A 4IDFA 3HMKA 4JY7A 5A05A 1N9ZA 2H1RA 4MUYA 4TVSA 5MN4A 4CM8B 2Q2QA 4BMXA 4G81A 1QIMA 3N53A 3ICPA 3GA5A 4IDNA 1T6BY 5JISA 2HSDA 4PIPA 2IT1A 2XOKD 4KV7A 4FGKA 1SQSA 3RRBA 2R79A 1IHPA 2P7IA 1VHJA 4C07A 3WE7A 1SKAA 2WIDA 3EZXA 1JHQA 3CFYA 2DQKA 4M22A 4V2IA 4W99A 1KXZA 1LCIA 5EIWA 5GJVC 1ZM4A 2QRHA 1TGVA 2AFVA 2OORA 4IIJA 3HK2A 2WLTA 3WYBA 1D6SA 5G4KB 2X86A 2BFCA 3COPA 4YXWD 4G9GA 1PGPA 4DNXA 1DKPA 2GEJA 3VDRA 1S89A 2HMAA 4D26A 1ZUD1 3OFKA 2FG6C 3SC3A 3L4BC 4WY2A 1E3WB 3B1ZA 4JT2A 2AH5A 3BZWA 2XQKA 3JQBC 1HT1E 5EE9A 1K4YA 3EGCA 1D07A 1NRXA 1G7TA 3A6DA 3FUUA 4X1KA 3WMRA 3ITDA 5DNCA 4QPPA 4LDQA 2G9RA 2ZUBA 4Z7JA 5EJIA 1EFCA 3D5QA 4F3TA 3OQBA 4QVKA 2ILTA 3JYNA 3VHLB 2BT4A 1YS7A 4X90A 5CDFA 4JVSB 3P9NA 3KAQA 1IJEA 3K16A 1M1XB 2Z5LA 1R9MA 2VZ0A 2ZI6A 3EXFB 4HDCA 4RJKA 2ZT7A 1VYVA 2I8AA 1XLTA 4BNGA 5J4HA 4W6QA 4B3MB 4UREA 1NBEA 4HN9A 2A1UA 5EI5A 1DDGA 2C94A 1JMYA 2GILA 5AYVA 1E96A 4MWEA 5T3UA 5BVGA 4BIIA 1OFTA 4YH1A 4OVKA 2XB9A 4DR4B 3AESA 1HE2A 2P9QA 3QPBA 3QUBA 4B2YA 1Z2CA 3PDUA 4YJ3B 4KXMA 3BB3A 2X6QA 5JVDB 3FWZA 5T8KC 1VP9A 2QTFA 1Z0SA 3I5MA 3OPXA 1NXXA 2BMWA 5B1IA 1D1QA 2V7QD 3EQ2A 1ZCZA 4KJZA 3KEQA 4LY3A 5CYOA 3BM5A 4MR7A 3HGTA 4BB9A 1CYEA 1FP6A 4PCAA 4QFMA 4B32A 4I9HA 1FFBA 4ZI7F 4YFVA 5CFZA 2NGRA 1CTQA 3L82B 2DPXA 1SWWA 1U4SA 5JIBA 4HP8A 3H9BA 1FXWA 1NLFA 4LZAA 2ZPUA 4DV1B 2J5KA 4CMEC 4MCHA 5CBPB 5FTKA 4PO9A 3LMKA 1ZOIA 4H6PA 5IK2D 3IEVA 1ORDA 4R1QA 1CULC 2F48A 3P2OA 5I7SA 421PA 2P79A 1HEIA 2ZXEA 4D6XA 1DTWB 3O8OA 1BJRE 2HJ9A 3UWSA 3PEFA 3I9OA 2QTVB 3WLIA 1OQAA 2ES4A 1L7OA 3QEMA 4JEUA 2PCJA 4DMGA 3QVVA 3UWPA 4EY4A 2WZQA 4WCVA 5KYKA 3JD3A 1TEZA 4RK7A 4Y2GA 4FGLA 2HSGA 1R4AA 3FFXA 3VH4A 3BIWA 1XJ5A 3U48A 3HJUA 4LQCA 4EFDA 3W3AD 2ZJ8A 2C83A 5TQ0B 2D0DA 3M9XA 1PZMA 4FB4A 3LUJA 4YJGB 2ASVA 2GBGA 4JP2A 4IH9A 5AI9A 3QYFA 1KSFX 5IASA 1FRQA 1R0LA 1UWKA 2QY9A 3AGPA 2C3UA 3GOHA 4RIIA 3UO8B 3VYUB 3MCAA 4I9FA 4A92A 1GUBA 4RWZA 2L2QA 2ZWPA 5BV1A 5DGCA 2ZWAA 4UHFA 3IAS1 1YZGA 1XRRA 1JLLA 2OP0A 3FPAA 3IMEA 1QCCA 4MW4A 4LF4B 1T8SA 3I2JA 1Z3IX 4MZDA 1X8KA 2UVDA 2WAOA 5CVEA 2VH1A 1W8IA 5DXFA 1VJCA 2HK7A 1VIVA 2NNWB 5C9ZA 3I72A 4WINA 4C20A 4LNUA 3K72B 1R5OA 2XYVA 3FYUA 3O3MB 3S1LA 3ZZ0A 2OXIA 5AKHA 2ZUCA 4WBNB 1EVEA 2GVDC 4R8MA 2GN6A 3I3OA 4QOFA 1GYRA 2W83A 3JQFC 4LMBA 1SZCA 3ZDXB 1ZD2P 2GN4A 4TV9F 2I4OA 3PUYA 1PWYE 1SPBS 1VJGA 4ABTA 3MCVA 3L84A 1FCJA 3AUUA 3I28A 2A8YA 3MTBA 2O7NA 1NRJB 2VRCA 3NAZA 3PFCA 4S1OA 4LE1A 1O08A 1M5UA 1CZKA 2F8MA 1ZJYA 4ESHA 5JS1A 5CJJA 2R1VA 3AEZA 2CFRA 4YMLA 5M3BA 3GGJA 4PAWA 4D9CA 1UJMA 4KITB 1NYQA 4R81A 2Q0XA 5AQEA 2ORWA 1DZ3A 5HRUA 5AVYA 1M1NA 5L7WA 1WDWB 1JG6A 1QONA 1XQ9A 2K2WA 3OX1A 4I0WB 5CH5A 2JGRA 4BO9A 3AEXA 1QHNA 4YAFA 1YQXA 4EA9A 3H8SA 1T43A 2WD8A 3PPWA 3U40A 2HKIA 2GYUA 5KQPA 5KSPA 4B76A 4MVCA 5CIWA 3P2KA 5E7JA 1BFUA 3RHTA 3B1WA 3DZKA 3QG1A 1KYQA 3B9BA 1IG3A 3OE5A 4LG1A 3RQSA 2VKTA 5T5QA 3V8MA 2CDNA 1CIJA 4I4NA 4EPVA 1O95D 2OZVA 4KLRA 1I4DD 2F4NA 3B9QA 3K9FC 1EUYA 4V0SA 3TLCA 1N33B 3LYHA 2VZLA 1J6UA 5CA0A 2R48A 2OD2A 3B6KA 5B1YA 2R25B 4NCAA 4U63A 4IGKA 4UVGA 4NE9A 4EX7A 2YHIB 3AHIA 5KJEA 2A7XA 4N3BA 3TB6A 1YE3A 4X92A 3ZX5A 1Y4ZA 1KJZA 1UXIA 1Z0IA 3QF7A 3B7WA 4ZV7A 3WNVA 5CXSA 3KQYA 1N2CA 1Y34E 2A5GA 1XTUA 5JS2A 4YCSA 3CB4A 4BNWA 3GLIB 2C0QA 4ZCQA 3EEBA 5FOSA 2VRBA 1SWVA 4YQEA 3RSHA 3TVDA 2VCEA 4CG3A 1MW9X 5A04A 1ZX1A 3TDKA 1DS6A 2WMOB 1GGNA 1QKKA 4BPBA 5AI4A 4KQXA 3UWKA 4HUTA 1QYRA 1T3GA 3TE7A 4CLEA 3PX7A 4OKIA 5EIBD 2EX4A 3IQDB 1U90A 4LECA 3HJFA 2WC1A 1XR3A 5FOVA 4F2WA 4ZI7B 1E3SA 1IEWA 2FG7C 5IVPA 1IXKA 1GCIA 4RA6B 3AL0C 1TL7C 3BGOS 3KUCA 3JYHA 4FZ3A 2BM1A 1JEEA 3LY9A 4BAUA 4DJEC 4LGCA 5D8DA 4Q7QA 2EBFX 2H3HA 2M1XA 4HMPA 5BN4B 3H13A 1R0WA 2CD7A 2QU8A 2WP8J 5DHRA 4CKWB 3ZGZA 1QQ5A 3D6MA 4HLNA 4J2OA 4M1SA 4A8PA 3W2TA 2GK7A 4YMHA 4EKDA 1TU0A 1ONOA 3LZ6A 3LVFO 1BDBA 3DBVO 1E63A 1GL6A 1H4TA 3HA5A 4EB6B 2O54A 5D00A 1R9JA 3VM6A 1ZD4A 4XX0B 5AFSA 2OHFA 4EHNA 1NIPA 4DLTA 2CNBA 1T2DA 1U0RA 4Z86A 2VXCA 2BF4A 2XYHA 3GJZA 3S55A 2FX3A 3J80A 4KXVA 4CKEB 3PE6A 3BXHA 3TIFA 1BE0A 3LHDA 4XB2A 3OKCA 4A91A 5DN6D 5LDDC 1IY8A 2QKYA 2XNSA 1SBHA 2VXOA 3N2LA 1RYFA 3NBUA 2AC7A 4HDKA 2NUAB 3Q8XB 3IVCA 3KFLA 2RHJA 1IY0A 1DBRA 4CR7A 1F2DA 3BL6A 2JAPA 3OY2A 4O4JF 3KG2A 5FTWA 1DEKA 2I1QA 1ZYUA 4FN4A 4KXQA 4LOHA 3UMBA 3W8RA 1BHQ1 1NU8A 3RS9A 4BVEA 4YV7A 1ZK4A 4KRFA 1Y33E 2MTBA 1CZOA 1ZN8A 5D1HA 3R24A 2QRUA 2VSQA 5LUBA 1I5RA 1ZZGA 1E5XA 2O7QA 1AHHA 2HJSA 2KMLA 4BEVA 4G0OA 1KS2A 3VJKA 1YJQA 2W43A 4GWLA 2Y0PA 2G7ZA 2IYVA 2RIPA 4FR0A 4LY0A 3GEEA 1KDPA 3LGAA 3T1HB 1AK9A 2Z8YA 2Q41A 2PRSA 2VEDA 4M1ZA 4X95A 4RACA 4DCCA 3ED1A 1Y4AE 2YC4C 1OKKA 2PLNA 1OTHA 3AVPA 4W5HA 2HJGA 3V9PA 4R0NA 1KE1A 2X0JA 5ALYA 1Z22A 3MIIA 3GFRA 3KALA 4OJYA 1LLCA 5CH3A 1VCHA 1R4NB 3TLXA 2C4HA 1E2HA 4K5QA 2OXCA 1DC7A 3IV7A 4ONEA 4ZVMA 1AQUA 1MH9A 1LKZA 1G7RA 2Y0BA 1Z06A 2ZSAA 1WO8A 3AK4A 1UAGA 4TTAA 5LP6C 3PQDA 3HLKA 3LF2A 4QJ4A 3HR8A 4TV9B 1TCAA 2F90A 3WAGA 1MDBA 2FZ4A 4QGHA 1L5GB 1F60A 1PNTA 3IUNA 4DUGD 3OETA 1YHZA 2P5YA 3MCUA 2DLDA 2EKPA 3EAQA 2NW6A 3MSCA 1L8QA 4CN8A 2R0QC 1MJGM 2DHRA 1C9YA 1LF0A 1VE5A 2CE2X 4PANA 4B33A 3MEQA 3UAVA 5IJZA 2E0IA 2FE4A 2ZBEA 5H4GA 1EGAA 4A8JB 2Y1FA 3BUSA 3G9TA 2JFXA 1E7YA 2NZ2A 3NM4A 1KP9A 4IW3B 4U7GA 4UNSA 3BH7A 3O75A 4GX1A 3GDOA 1T0JB 3IUYA 1ECCA 1DARA 1TO1E 2PU5A 3LX6A 4NVRA 5A9SA 3AVVA 1TIBA 4JI4B 2QRPA 3UJPA 1ZSYA 2NN3C 2OO7A 3S2GA 4GKKB 1YBHA 1VYTA 1AKYA 3FG9A 1TF2A 1R0XA 4NENA 1FY2A 2GHIA 3VKFA 2IEGA 4E46A 2ZRPA 4QQNA 3C4VA 2I2BA 1TX4B 3SD7A 5JJ5A 2BKAA 3KR2A 5KJCA 1W9MA 4C3ZA 4F86A 3FOBA 1KS9A 4UHJA 3BMXA 2Z5FA 4DSNA 1GU0A 1I0ZA 4LF5B 1F7UA 4PC6A 3AI2A 1CEQA 4ARAA 4AKHA 1N75A 1DTSA 2GZ1A 2PNJA 4J1QA 5CLQA 1XEWX 4DEVA 4OXIA 2E55A 4KRXA 4F1KA 4R31A 5EYPA 4IIDA 5AIBA 1PV2A 3PC4A 1B14A 4O4LA 5ALNA 5L6LB 1ZWLA 4I2NA 3ND8A 3FYDA 2OV6A 4MUFA 4YJFA 1PQWA 3JD2A 1OT3A 3LF1A 2AGVA 2HLNA 3OIUA 3VC7A 5MHTA 4MWOA 5HKLA 1HLFA 2Q5OA 4CE6A 2E7ZA 2QM7A 3H99A 3CVJA 4MK4A 5KWEA 2AJTA 2HBZA 3QWAA 1XDZA 1G20A 2YIMA 3FLBA 2CLOB 3GCZA 4N7RA 4PFJA 3GNTA 4I66A 5EE5B 5FHRA 2HCJB 2RC5A 2MOKA 4C1BA 3NYWA 2YHSA 3MC1A 1B00A 1XO1A 1U9JA 2CN1A 2HDWA 2EIHA 1M75A 3KYDB 4AULA 4U7TB 3LUBA 5EWJB 5H81A 3RK0A 1FDIA 3T7JA 3UMRA 3PYMA 4OOFA 2H65A 4NOMA 4KP7A 2PUFA 2R6HA 3LY7A 5LKRA 1WX1A 1Z2NX 1YI1A 3FTFA 4LXUA 4KNVA 5COBA 2IOQA 4C2TA 2R6CA 2ZTHA 2EAUA 4OOEA 2IPMA 2DFLA 1O6BA 1KAQA 3KWLA 2BGMA 4I5DA 1C4KA 1IUPA 3IP3A 3AHCA 2GN9A 4TYQA 1F3LA 4Q6WA 4Z0TA 2FRDC 4GX2A 1LWOA 1DIAA 3E58A 1X7ZB 1RM4A 2J9YB 4FYJA 1NG9A 2FFQA 3G8AA 2O48X 1Z2AA 2R1TB 4P4UA 4ZK2A 4O4JB 1L7MA 1E79D 1H1LB 1KRHA 4KR2A 2PLRA 2BKXA 3OHPA 1GA4A 3JARB 1GITA 2XUPA 3N0VA 4LRWA 4QEKA 3NT4A 2WI8A 4O29A 4ATNA 1R00A 1S8NA 1W76A 1M8GA 1TAUA 2HQRA 2FUKA 2XGMA 1TECE 3G6WA 3LUHA 4B6EA 5F1YA 1XC7A 2NSHA 2FU5C 1P5FA 3UOWA 3C0KA 5H9WA 1ZOPA 2B8NA 2OBMA 3GLQA 2JPDA 4K88A 1WHSB 2WABA 2ZYWX 3WV4A 3MS2A 2DPMA 2VAVA 4PZLA 4KWIA 2H1IA 1PZEA 1N9GA 4BQQA 1QVRA 1GFZA 4MVWA 4EFNA 4IIHA 1C3XA 1OYOA 3GCGA 4GM0A 3M1LA 5HZKA 1B23P 3EOBI 2NU8B 2X9QA 4KSBA 2R60A 1E6EA 2BDTA 1PRYA 4TXHA 2M9MA 1S4MA 4XQGA 4XYEA 2DUWA 1Z08A 1MC1A 3OOJA 4V24A 1OJ7A 2HRCA 3DZJA 1QK4A 5I7RA 1JDVA 4L6IA 1TYCA 1VSUA 3IT1A 1PYDA 2GZMA 3E1GA 4LY9A 5ESXA 4HNVA 3NC0C 4RMIA 3H8VA 2XOEA 1ECLA 3SR4A 4AG3A 3ZZ1A 2IY9A 2I87A 4QL3A 3QEAZ 2FSFA 3Q3VA 1JBEA 3CZ9A 1AA9A 4BJ6A 2YICA 4OKNA 3ZEAA 2C5LA 1KQ3A 2XQIA 4Q9KA 2H3EA 3JALA 4PZAA 3I0NA 2Y4OA 3TINA 3WOVA 1X0XA 1UBJS 3R0VA 2BP7A 3M49A 5K3DA 4MCAA 3A9TA 3QEBZ 4UHHA 2OEPA 1R88A 3MMSA 2PZMA 4QDXA 5KYYA 4FGWA 2ANBA 4FLMA 1YMQA 3OQPA 3AP3A 4FYIA 3RRXA 1NOJA 3JWPA 1AQNA 1X1EA 3IL2A 1PK9A 3A04A 4RTQA 4ZI5A 2B98A 3OZVA 3ROKA 1N2ZA 3NNSA 2VWHA 2EP8A 2G9UA 4NECA 5JRZA 3MXOA 1P2FA 3SR3A 1EINA 5C51B 3LPMA 3TXAA 1EGHA 4IZ6A 1GZ5A 1ULHA 4HH3C 1NF2A 3VGJA 2REBA 4ND6A 1O89A 3QKRA 5EMNA 4KI7A 2J45A 4OY3A 1D5CA 3AHEA 1CUZA 4QT4A 5LM3A 4MGZR 3C70A 1YI0A 4RKFA 4F2PA 1QLJA 4XOIA 4IYJA 5D3QA 1UKAA 2TMGA 1EUQA 2NXJA 2PS0A 5C8DA 4FGZA 3TFWA 1BH6A 4ZN6A 2O8FA 2PN1A 4IP0A 2J8ZA 1OTXA 2EIXA 4Q93A 3WHIA 4PYIA 4UQLA 3BYZA 3E23A 1UJ6A 1G8GA 3L6EA 1QB8A 3NUGA 3HB1A 2FEAA 4B6OA 4F3CA 2DWCA 3ETHA 4K87A 3SDSA 4N7JA 3FPSA 2D00A 2AMFA 4DSOA 1PKEA 1O58A 2PKQP 2FZWA 1XJCA 5A4DA 3ZBQA 1RI4A 4KWTA 1L4UA 3FM9A 2WP0A 3I8OA 4CETA 2P1DA 4R40A 2PRYA 3EG9B 5J40A 2HHHB 5E1MA 4MVJM 2H8KA 4GOMD 4BP1A 4A36A 3CV3A 2AJ8A 1QG4A 3L93A 3VA7A 2IPXA 3OLQA 4FEAA 4QU0A 3V55A 2PUJA 5K0ZA 5ISMA 4DYDA 1U9IC 4OMUA 4WGFA 4P80A 5KNCH 2Q5FA 1EDBA 1SKUA 2NO1A 2VZ9A 4M6WB 1GYPA 2WHYA 2W42A 2GMWA 1L1EA 3ZWNA 3II6X 5I5GA 1KJYA 2PLAA 1TYAE 4R16A 1OH5A 4F8EA 2H06A 3GC6A 2JLXA 4ENTA 1U2RA 1M6VB 2O5CA 2MYPA 4RAOA 2VTDA 1ZNYA 5IYZF 3WLLA 5ALIA 1H65A 4KR6A 4YROA 4ZREA 3TAHA 4BJ1A 2PMKA 3FOAA 3IT0A 1DE0A 4YRGA 4B5KA 1FYDA 3PLNA 4UUQA 1X1CA 3Q2IA 4LZPA 3ZGVA 1MHTA 5GOTA 4FILA 6ADHA 3JRWA 7ADHA 5K45A 1GG5A 1TUBB 1QGDA 2VJBA 1H2YA 4IOJA 2YCLA 2QV7A 3QQPA 3RT7A 4ZYWA 2RHMA 1M10A 3BPSA 3HN7A 4QFCA 4LC0A 2CD9A 4QPZA 2ZDHA 3U3XA 1WU7A 2RHBA 5ICMA 3E2MA 2QP4A 4WZAE 3W77A 2QRKA 2YHAA 1WS6A 3QJ5A 4YRCA 3SM3A 3COVA 3RVSA 3HFSA 2FG5A 1M34E 4GXRA 4L75A 3H11B 5KI6A 3VI3B 5J23A 2ORED 1B2LA 1HDZA 4IS3A 3RK4A 4G07A 4DDTA 4RK0A 2O4UX 3PV0A 2YNMC 1BXKA 3GFTA 3W5AA 3TRJA 1ZCAA 4ARSA 4YJHA 3QWHA 3B2QA 1EGMB 1GPMA 1K75A 4KV9A 3U0BA 2A9JA 3IPLA 4GOOD 3EWSA 3FPBA 4LA4A 5EP1A 3S44A 4RANA 5C8XA 3V8PA 2H57A 1WUKS 1HUQA 1VL0A 3D4PA 3WDMA 3QU5A 2PRJA 5BOSA 2ASEA 2WB4A 4RVFA 4HNRA 2YCBA 2H16A 2RONA 2XE8A 2W8BB 4L5BA 3TCNA 1D2EA 7YASA 3AZPA 1E3WA 1L8LA 5TQ2B 5E9QA 2FEPA 2XA1A 3OZFA 4ZYVA 2WPDA 1SCUB 1ZUHA 4PFKA 1ND6A 2HMVA 4R54A 2HU7A 1DXHA 3QBJA 3ZJVA 2NYAA 3PHJA 4D3SA 3M9WA 3BZUA 3F71A 4KLNA 5TQVA 4JB0A 3DLAA 1HK7A 2OFXA 1EFKA 3OQJA 3TI7A 3RBVA 2ZK7A 1T91A 4BO3A 4B3FX 3S2IA 2Y8EA 2AZTA 4DPMA 2BFEB 3MUNA 3OJWA 1U81A 5J5VA 2WFMA 2ZT8A 5HVNA 2F67A 5SZHB 1AKWA 1VDZA 2B4RO 3SVTA 2CVHA 1M2VB 5TT1A 4DDUA 2YWEA 2C29D 1O9GA 5EJ9A 1E2PA 1YGPA 1IAVA 3G9UA 3KT0A 1XTTA 4LWQA 3RUIA 3RTEA 2R4UA 3AF3A 3A1VA 3FMVA 5CG2A 2QF7A 3IIKA 4G86A 4PAQA 4AZTA 3OTIA 4Y2RA 4GOXA 1G8FA 3DD5A 3BTSA 2C4VA 3O8BA 2RH8A 3LHFA 3CF0A 3T4UA 3DKKA 1Q0LA 4ZHQF 1G3RA 2VJKA 3DWEX 2P69A 1STOA 3IUSA 4D43A 4KXLA 3DOEA 3GJRA 3RG8A 2YIDA 3C15C 4FUQA 4JR0A 4ZU1X 4FKZA 4LXIA 1N0VC 2R66A 3LUCA 1PFKA 1K6XA