4EQ7A

Structure of atu4243-gaba receptor
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
320
structure length
320
Chain Sequence
b'NDLVFSSWGGTTQDAQKAAWAEKFMVETGINVLQDGPTDYGKLKAMVEANGVTWDVVDVEGDYAAQAGPKGLLEKLDFSVIDKTKLDPRFVTDYSVGSFYYSFVIGCNVDSVSACPKSWADLFDTAKFPGKRTFYKWSAPGVIEAALLADGVTADKLYPLDLDRAFKKLDTIKSDIIWWSGGAQSQQLIASAEAPFGSVWNGRMTALEQSGVKVETSWAQNITAADSLVVPKGTKNKDAAMKFIALATSAQAQADMATATGYAPVNIESAKLMDPKIAKSLPDQQTESQVNADMNYWAQHRDEIGERWYAWQAKHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter, substrate binding protein (Polyamine)
molecule tags Transport protein
source organism Agrobacterium tumefaciens
publication title Structural basis for selective GABA binding in bacterial pathogens.
pubmed doi rcsb
total genus 98
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4eq7A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4eq7A01
1FQFA 4G8MA 3N94A 2V25A 4F18A 4OENA 1FQAA 2QJEA 3A3UA 2Y7RA 4ZE8A 5TP9B 4HW8A 2QMWA 5AA2D 2XXXA 2HFBA 3ZKKA 2VP1A 2QPQA 3MZ9A 5LOMA 4PP0A 3V89B 3CFXA 4F2OA 5I2KB 3V8XB 4U2RA 4YB7A 2PT1A 1DOTA 2DOJA 3MUQA 2RCAA 2RF1A 3ECRA 3G3FA 3DP4A 3PD9A 1UTHA 4H5GA 4IO4A 4OQOA 4BDLA 1FW0A 4OMBA 3IX1A 3TQWA 2UVHA 5M2VA 3U93A 4OFOA 3RT8A 5CMBA 4M1VA 1Y3NA 3JZJA 4Q8RA 5DVJA 3TELA 1PB7A 3KOTA 3N6UA 3RN8A 1SD3A 1VFEA 2I48A 3CFZA 3EHTA 1MXVA 4G68C 3SEYA 3TQLA 3U92A 3VV5A 3V83A 4F1UA 1A8EA 2ZYKA 2F97A 4R2BA 1DTZA 5I56A 1FQCA 1LFIA 1VFDA 2DVZA 2ZNSA 3O29A 3OO7A 4FECA 4LZ5A 4H65A 1R6ZA 5J1DA 5ITPA 1PC3A 4JWYA 3PMXA 2NWJA 3C9HA 3IORA 4G8NA 2O7UA 1IXHA 1JEVA 1Y4TA 2DXYA 4NEDA 4YICA 2PT2A 1SI0A 3MPKA 1M5CA 4LZ8A 4R73A 3IOVA 1IEJA 1LCFA 1N76A 4FORA 1BIYA 4P0IA 5L9SA 1AIVA 2QS4A 1OLAA 1NL5A 4EXKA 1DPPA 3HO7A 3LSXA 3H7MA 4XKRA 5DEXA 1J1NA 4KHZE 4IGRA 1MM7A 1Q35A 3RGYA 3CRBA 3EPEA 3IO6A 2V84A 1D4NA 3PMWA 3PUWE 4GFRA 4JWOA 2NVUB 3S2VA 1N3WA 2DSFA 4PQJA 5JTYB 1MY2A 4NF4B 2V3UA 5ITOA 3MAMA 2XXPA 2F7BA 2F36A 4OYVA 3PV0E 4RXLA 4KCDA 1SDXA 5AA1A 1MQIA 2FNCA 2O6AA 2ZYMA 2XXIA 3H3GA 3TKDA 3W9VA 4KYEA 2HZKA 3U94A 3C31A 3LSWA 2ALUA 3Q28A 1JQFA 1B3EA 3H03A 3FASA 3MZ1A 2D21A 3SDFA 3THIA 3TTMA 1XHYA 3CG3A 1B2HA 2QL3A 3V5AA 4DCYA 1SBPA 3HHGA 3LBSA 4FJPA 4F39A 4WEDA 4NF4A 2X7PA 5DT6A 3DLNA 1S9TA 4IO7A 4RK2A 5I58A 1RYXA 3VE1B 1ANFA 3PPOA 2R6GE 1P1NA 4F1VA 3E4RA 3FVKA 3BFUA 3BKIB 3MP6A 3Q26A 3KSJA 4KR5A 4R6KA 2ZMBA 5KCJB 1O64A 5I57A 2Q2CA 2VD2A 4H0WA 2I58A 2Z23A 4Z0IA 2O1LA 4LA9A 1IXCA 3HSTA 2LAOA 5AA3A 1A54A 3GBBA 4NE4A 4ECFA 3PPQA 3HV1A 3TTRA 3FV2A 3IB0A 2P1SA 4LZ7A 1SW1A 4WEPA 4GLIA 3U8QA 3R6UA 4U22A 2O68A 5AA4B 1EU8A 2A5TA 3IAZA 1MXZA 5FTIA 5CRYA 4NMYA 1YPNA 4QFNA 2PMSA 5H8FB 3FXRA 3FXUA 5KZTA 3MC2A 1NNPA 2PVUA 1URSA 2GH9A 2HCAA 1MY1A 3Q25A 3KZGA 3K1PA 3ONMA 1US4A 4RYAA 4ND9A 4DXCA 5HBCA 1B4HA 3GZGA 2OBGA 4U1OA 1IUDA 1JNFA 1FTKA 1TXFA 4ELPA 3RLFE 2REJA 4KD5A 3PMVA 4DIGA 4OVJA 4IO3A 3UN6A 3FVNA 1GVCA 5H8FA 3K2DA 4BDQA 2V3TA 3TPAA 2FA7A 1PB8A 1MDP1 1NKXA 3QIMA 4H6DA 2B3FA 4QSDA 4EF2A 5IKBA 3FXQA 2P2AA 4R6YA 5DEXB 1JVXA 4HS7A 4TLLB 5CM6A 2YPNA 1MS7A 1QVSA 1A7LA 4OFLA 3KOSA 4F3SA 5BWJA 1CB6A 2F7CA 1NMUA 2Q9TA 4YB6A 4XKNA 3OELA 3OXNA 4YKKA 2OCUA 2B3BA 1BP5A 1XOCA 3T9XB 3IOTA 3KGCA 4MLQA 4R72A 4U4SA 5JEIA 3S9LC 1OLCA 4NF8B 3K01A 4POWA 1B1HA 5I57B 4YMAA 4HCYA 4N07A 5L9OA 4UA8A 3CG1A 3RUMA 3S9MC 3UIFA 1QW0A 3VXCA 4QFLA 1EZOA 4OZ9A 2Q8JA 4YKIA 4EF1A 1LAGE 3OO8A 1IITA 1DPEA 3N5LA 2I6EA 3K0VA 1MXXA 2QRYA 1URGA 2X26A 2Y7KA 5ISUA 1RYOA 1B9JA 1ZTYA 2XX9A 4QSEA 2XHDA 3KJTA 4IY5A 1LAXA 1LFHA 3G3JA 2XD3A 1JW1A 3GLBA 1MM6A 1TFDA 4LVQA 1SI1A 4U21A 2Y7PA 1B5HA 3M8UA 4EQ9A 1ZJLA 1Z7NE 4KFQA 1DMBA 1MH4A 1R1NA 5H8QB 2O84X 3T9UA 5AA2B 5JTYA 2DWAA 1B0LA 3SEVA 2F8DA 3VLWA 3OSQA 4GOTA 4EUOA 4ZECA 2CMOA 1B58A 2D5WA 3B6QA 5H8SA 3QAXA 4DZ1A 3CR9A 4RK9A 1JW5A 1ZBMA 3L6HA 3M3FA 4ZZAA 4H67A 2F34A 4YKJA 4DE8A 4FE8A 4GQOA 1UTBA 4TQUQ 1M5EA 2ONKE 1F9BA 2R71A 4G68A 5HPQA 3OO9A 3H6WA 3FGSA 4LONB 4RJZA 3MP1A 3MBPA 5FHOA 4XTCQ 2DP8A 1YCJA 4R6HA 1MY4A 1ATGA 4GF8A 2DXRA 2HAUA 4Q5TA 5CI5A 1N04A 4LQ5A 3FUZA 2OZZA 3E3KA 3H6TA 2Y7WA 1VR5A 1MPBA 1ZMGA 4DLDA 4ELRA 5I56B 3E13X 1VE4A 3IO4A 2DWHA 1OIBA 4I1DA 1LB8A 2A5SA 3FVGA 3MVXA 3EQ1A 4QF9A 4R9FA 3KEIA 1BKAA 1O63A 3IOUA 1B0HA 4PE5B 4LP2B 3PUZE 1GV8A 3RTFB 1FTJA 2O1MA 1H44A 5H8HA 2Y7IA 4H8JA 1POTA 3TCGA 3C34A 1SVXB 2XX7A 3UGWA 1LFGA 2RC8A 4EQBA 3PD8A 3OEMA 4KYSA 3PUXE 1OMPA 4MH5A 4XKPA 5DVIA 4QFPA 1Y3QA 4FIMA 1KWHA 2UVGA 5KCJA 3OD7A 1I6AA 1FQDA 2ONRA 2XXWA 4NF6A 4TLMB 2AL5A 3I6VA 3UP9A 4RA1A 4EXLA 3R7XA 3ZSFA 2RKMA 5B70A 1MRPA 4IO5A 2DWIA 1OVBA 1FQBA 1GTKA 2UYEA 1USYH 3RPWA 1P1QA 3SKPA 5I58B 2HAVA 4DCXA 1B7UA 1ELJA 4THIA 3R26A 4N6PA 1ZLQA 1NNKA 1SW2A 1URDA 1AMFA 2OWTA 1MXUA 1MG1A 2H9BA 1FTMA 2DE2A 2I0CA 2V93A 2YLNA 3P7IA 4U23A 3KSXA 3IB1A 4WKMA 1B5IA 4WXJA 2ONSA 1P1UA 2DVCA 2OWSA 1A99A 4K3FA 4OTEA 4XIGQ 1NNFA 5F1QA 1Y1MA 1LAFE 2AL4A 4GVOA 2ANJA 4YMBA 1B6HA 4JDFA 4F3BA 3MJNA 3IJOB 3K6WA 3M3KA 2M8CA 3DELB 2G29A 4JWXA 4G2ZA 1QULA 4LQ2A 5I2KA 1XVYA 1US5A 2ABHA 1YTVA 3EHUA 3FIRA 4F29A 2ZYOA 3O6HA 3HN0A 4P0GA 4KQPA 2GRVA 5TP9A 3ZKLA 4RY1A 4IY6A 4OETA 4TOZA 4Q30B 3RQTA 1QKBA 3PPPA 1JVYA 1LBBA 1MQGA 4G68B 1UTBB 1Y3PA 3T93B 3TDJA 4MBPA 5KDTB 2XXVA 2QS3A 1POY1 1MPCA 3G3GA 4Q0CA 4POXA 3VLUA 3Q27A 4GRKA 3FATA 1FTOA 4BDNA 1B7HA 2ESNA 5I2NA 1H45A 3C36A 1PBQA 3TTKA 2DWJA 4X1BA 1D3KA 3WAEA 2PYYA 2VOZA 3CIJA 1II5A 1Q1KA 1I69A 3VDFA 3K6XA 4GIZA 3W9WA 5JK4A 1MH3A 3QK6A 1MQDA 4NF8A 1Y4CA 5TPAA 4JBZA 2UVJA 3W15C 4FAJA 3AXFA 1EZ9A 3F11A 1IXGA 4RPNA 4I9DA 1B3LA 1Y20A 3TFLA 4AB5A 4F1YA 2O69A 1WVJA 2VHAA 3ODBA 4GD5A 5H8HB 4OEUA 2NOOA 1N0TA 3KN3A 4L17A 4R2FA 4JXIA 3LSLA 1MY3A 4YB5A 3D4CA 2Z8DA 4NF5B 3OMBA 1NH7A 1XT8A 4RNSA 2O51A 4IO6A 5TPAB 2UVIA 3OOAA 3PPRA 3PU5A 3IL1B 2I4CA 2F78A 3HCQA 2X7QA 3SEWA 3O66A 1LCTA 2GHAA 3TCHA 3CFLA 2XXRA 4X1DA 2OJTA 3TTNA 3L6GA 4P11A 1JEUA 3M3LA 1QJMA 4KCCA 5H8NA 1BTJA 3KJ7A 4OFJA 1SYHA 3B7DA 3KN8A 3VVEA 4BDMA 3T66A 1TT1A 5B7DA 5ICTA 3IK6B 2A5TB 3N26A 5DYHA 4F22A 4FATA 1T0KA 4QRZA 3TUSA 3VXBA 3FZVA 3E9XA 2H98A 3KFMA 1IIWA 1MY0A 1FTLA 1O7TA 2BJJX 1A8FA 3G3KA 3MQ9A 3H06B 3O28A 4MF3A 4O3AA 4ZEBA 1MPDA 4O3BA 5AA2A 1XC1A 4ZEIA 2ZNTA 2HZLA 2PX1A 2VGQA 1B3FA 3K00A 5F7VA 3WAFA 1D9YA 5I59B 3Q29A 1B46A 2DE3A 2OK2A 3FV1A 1B40A 1B32A 3MVYA 1IZ1A 1OQGA 1DSNA 2XXTA 4NTLA 3D4GA 4ZDMA 1BLFA 2HQ0A 4QFKA 5FTHA 4E0XA 2Q2AA 4OERA 1WODA 4EDPA 1NH8A 1RKMA 4NWDA 2QMXA 3O2AA 1LGBC 4IGTA 3T9HB 2OLBA 3MPLA 4HTGA 4F19A 3CSGA 4Z7EA 4I8CA 4OHNA 4M4GA 2IA4A 1B5JA 2RC9A 1IXIA 2D3IA 3BFTA 3ILTB 3SEXA 3T9VA 3RTWB 3IOWA 3VFJA 3OSRA 3K02A 5I2NB 1I6BA 1D9VA 3EN3A 3VLVA 1OQHA 1H76A 1S50A 3FJ7A 4H5FA 5I59A 1EH3A 5CMKA 1SW4A 1MXYA 4R74A 1A55A 2H5YA 3C35A 4FEDA 5K2XA 3QUJA 2F6GA 1B05A 4YKPA 3MVWA 3A09A 4PFYA 3LSFB 5ELVA 4DDDA 4QSCA 2I0BA 3QSLA 1XVXA 3CSBA 3SESA 3S9NC 1LSTA 4ESWA 4I62A 4PFUA 3RT6B 4IB2A 1MQJA 1LLSA 2XXHA 1FQEA 5FHMA 5KDTA 4GXAA 3OEKA 3QXMA 2P0SA 4G77A 3TCFA 1ZIUA 1B4ZA 2E1SA 1PEBA 2PBWA 3SETA 4N13A 4ZEKA 4PETA 1CE2A 1B3GA 2G93A 1P1WA 2I3VA 4R9GA 1L5TA 3S4UA 3SEUA 3K6VA 4ZEFA 4XXUA 1TFAA 3C32A 4IO2A 3T96B 5I84A 2QS1A 1LB9A 4ZS9A 4E0WA 1S7YA 1ZU0A 2DE4A 2E0SA 1HSLA 3C4MA 2AYSA 3JYRA 3LUYA 2Z8EA 3K4UA 3CI8A 2H99A 3JV9A 3MVZA 4O3CA 3TODA 5AA4A 3OO6A 1ZKBA 3IJXB 2HXWA 3UK4A 3I5OA 4QHQA 2GHBA 5A5XA 4NF6B 1YAEA 2I3WA 4DXBA 3VVDA 3LC8A 1GGGA 2XXQA 2ZYNA 2XD2A 3FVOA 3RY3A 1USYE 1P99A 2F5XA 3T22A 3UORA 4G4PA 5CBSA 3C33A 1Y1ZA 1MXWA 3B6TA 1QKAA 4X9TA 2REGA 4RPOA 2WKYA 2VD3A 3CVGA 3UA8A 1EZPA 1FCKA 3MWBA 5A5XB 3H4ZA 2F35A 1LAHE 3O9PA 1N3XA 1NFTA 1XS5A 2Q88A 2UYFA 3A3CA 3DP6A 1QUJA 3PGFA 4KI0E 4ONYA 4EQ7A 4U1ZA 1QUKA 4HCWA 3TTLA 1B7ZA 2H25A 3FJMA 1UIVA 3B6WA 1SW5A 2XXUA 2Y84A 3O97A 3QUFA 5H8NB 1PB9A 1R9QA 2W7YA 2Z22A 5AE4A 4C0RA 2I4BA 1TWYA 1MDQA 5EYFA 3K1NA 3HPIA 2V3QA 3RNNA 3EF7A 4AB6A 4ZE9A 2RINA 3U72A 1H43A 2IEEA 2R9JA 4GWOA 4KPTA 5DTBA 4BDRA 4C1TA 4UACA 3MZBA 2FYIA 2I49A 2ZNUA 4KYDA 1R9LA 5BUUA 5CBRA 3FD3A 3LR1A 4LUBA 4FEBA 4U4XA 3ZS6A 2ZXTA 4OXVA 1IQ7A 5H8QA 1QUIA 4C1UA 2QSXA 1HSJA 4ISUA 4GL0A 4YAHX 3ILUB 3VVFA 3G7WA 1GR2A 1H3DA 4JB7A 5L9MA 3K6UA 1B51A 3N6TA 4X48A 1P1OA 4ZZEA 5HM4B 1A40A 1N7WA 2UXAA 4JSDA 3KN7A 4NWCA 1UIUA 3TYHA 3EHSA 3PPNA 5K2YA 1VSOA 1AOVA 2CZLA 5ICQA 1DTGA 3G3HA 5TU0A 1B52A 1LBCA 3KBRA 4ELOA 1HSEA 4BLAA 3HHFA 2XXYA 4ZEDA 4AQ4A 2DYXA 4PFWA 1OVTA 2KLFA 3TMGA 2H4IA 3IR1A 3DM0A 3KG2A 5FHNA 3TZAA 4ESXA 4H1XA 4LATA 4BDOA 5CMCA 5DVFA 3SERA 2Z8FA 3TAJA 3TEPA 3USDA 1WDNA 4R75A 4NF5A 3BBRA 5L8DA 1N84A 4G8HA 3H6VA 1M5FA 3QYTA 4MFIA 3PUYE 2YJPA 4JSOA 2DQVA 3GXAA 1Y9UA 1PDAA 4F2QA 4DXUA 3G3IA 4F3GA 3GBAA 4OEVA 3H6UA 4PFTA 2DS9A 3O6GA 1UTHB 4QFOA 1B1XA 2AIXA 3U1OA 2O7IA 4XKQA 3PUVE 4H8IA 5CMMA 3K1MA 1JW4A 2Q89A 3DP8A 3S9EA 2NXOA 4OWDA 4ELQA 2GFEA 3MP8A 1SYIA 1SQYA 2RC7A 1M5BA 3I3VA 2NUVA 3OENA 5IAIA 2F7AA 1JETA 1M5DA 3IB2A 1MQHA 4YZZA 1AH5A 5EHSA 1PBPA 4F3PA 1B3HA 1AL3A 4OESA 5CC2A 2RCBA 3MW0A 3FJGA 4YU0A 2HEUA 4F31B 3O6IA 2THIA 2XX8A 2QS2A 1NNTA 5EHMA 4MLVA 4GXSB 1N7XA 1UQWA 1Z7ME 2F6PA 4GL8A 1I6QA 2B65A
chains in the Genus database with same CATH superfamily
1YXIA 4F18A 4OENA 2Y7RA 4ZE8A 3E79A 2QMWA 3ZKKA 3MZ9A 2QPQA 3B8BA 3V89B 4U2RA 4YB7A 4N15A 2RCAA 3ECRA 4H5GA 4BDLA 4OMBA 3U93A 3JZJA 3N6UA 3RN8A 3CFZA 3EHTA 4G68C 3TQLA 3SEYA 4R2BA 2F97A 1FQCA 3OO7A 4FECA 5J1DA 5ITPA 4JWYA 2Y5LA 3IORA 3IFCA 2DXYA 3MPKA 3IOVA 1IEJA 4P0IA 4EXKA 4XKRA 1MM7A 1Q35A 2XWOA 3CRBA 3PUWE 4GFRA 1N3WA 2V3UA 2WX9A 3MAMA 5AA1A 4C0RA 4RXLA 3BIGA 1B3EA 3GYYA 2D21A 1B2HA 1Q9DA 1SBPA 4WEDA 4NF4A 5I58A 3FBPA 4GWSA 4PC9A 3E4RA 3FVKA 2XWVA 1XI6A 3Q26A 2ZMBA 5I57A 2Q2CA 2VD2A 3NOHA 2LAOA 4ECFA 3PPQA 3TTRA 3FV2A 5LDZA 4LZ7A 4GLIA 2O68A 5AA4B 5I3SA 5FTIA 4NMYA 1YPNA 2PMSA 1URSA 3Q25A 3K1PA 1US4A 4DXCA 3GZGA 2OBGA 1FTKA 4OVJA 2V3TA 1NKXA 4H6DA 2B3FA 4QSDA 5IKBA 4R6YA 1FPFA 4YB6A 4XKNA 3OXNA 4YKKA 2B3BA 3RPLB 3KGCA 4MLQA 4U4SA 5I57B 4N8YA 4UA8A 3CG1A 1QW0A 3VXCA 4QFLA 2Q8JA 4YKIA 1IITA 4OVQA 5ISUA 1ZTYA 2XX9A 1LAXA 2XD3A 3GLBA 4LVQA 1SI1A 2Y7PA 1ZJLA 3T9UA 5H8QB 1MH4A 5JTYA 2DWAA 3VLWA 2FVZA 2F8DA 3OSQA 4JVDA 2D5WA 1K9YA 5H8SA 5EYHA 4H45A 4N81A 4YKJA 4FE8A 1M5EA 3OO9A 3H6WA 4RJZA 1MY4A 1ATGA 4OA4A 2DXRA 4LQ5A 3FUZA 3E3KA 2Y7WA 1VR5A 5ET5A 3E13X 3IO4A 2A5SA 3FVGA 4R9FA 1BKAA 1H44A 3TCGA 4DI3D 4GX4A 4MIJA 3OD7A 2AL5A 4RA1A 4IO5A 1GTKA 2HAVA 4DCXA 2DE2A 2V93A 4N6KA 4WXJA 3IB1A 1B5IA 2ONSA 2DVCA 4OTEA 4N17A 1Y1MA 2AL4A 4GVOA 4XF5A 4JDFA 3KC1A 3IJOB 3K6WA 3MJNA 1FBHA 1QULA 4MMPA 1XVYA 3FIRA 3O6HA 4TOZA 1QKBA 3PPPA 1LBBA 5ET6A 1LBWA 1LBVA 4POXA 3Q27A 4GRKA 1EYKA 1B7HA 2ESNA 3C36A 4X1BA 1II5A 3VDFA 3QK6A 4NF8A 1MQDA 4NX1A 1Y4CA 5TPAA 1EZ9A 4RPNA 1IXGA 2KR0A 1NV0A 4AB5A 4F1YA 2VHAA 4OEUA 1N0TA 3LSLA 2FHYA 4HE0A 4PAIA 3OMBA 1NH7A 4RNSA 2I4CA 3HCQA 2X7QA 1LCTA 2XXRA 1JP4A 4X1DA 3L6GA 4P11A 5H8NA 1BTJA 3KJ7A 1SYHA 3KN8A 5B7DA 4QRZA 1IIWA 1MY0A 2HHMA 2BJJX 3MQ9A 1A8FA 4O3AA 3H06B 2HZLA 2PX1A 3K00A 1D9YA 3Q29A 2DE3A 3FV1A 1B40A 1OQGA 4NTLA 1BLFA 4QFKA 5FTHA 4NWDA 1FJ6A 2OLBA 4HTGA 4Z7EA 2QVUA 2IA4A 2RC9A 1IXIA 3RTWB 5A5LA 2OWZA 1I6BA 1EH3A 4XFEA 5I7IA 4FEDA 3QUJA 4YKPA 3A09A 4PFYA 1NV3A 2I0BA 3S9NC 4I62A 4PFUA 1LLSA 5FHMA 1ZIUA 2PBWA 1FBCA 4ZEKA 1CE2A 1P1WA 1NV6A 3ISPA 1S7YA 3LUYA 2Z8EA 3CI8A 2H99A 3MVZA 3UK4A 5A5XA 1YAEA 1GGGA 4F3SA 2F5XA 1MXWA 4RPOA 3O9PA 1N3XA 1NFTA 3PGFA 4EQ7A 1QUJA 4U1ZA 1QUKA 2Y84A 1PB9A 3RNNA 3TUSA 4ZE9A 3EF7A 2RINA 4C1TA 2FYIA 2I49A 5CBRA 5F24A 1G0IA 4NAPA 3LR1A 3ZS6A 1AIVA 4IR8A 5H8QA 4GL0A 3ILUB 1GR2A 1H3DA 3K6UA 3D1RA 3N6TA 4ZZEA 3KN7A 4NF0A 4N8GA 3PPNA 1DTGA 1LBCA 4ELOA 1HSEA 2DYXA 2H4IA 3KG2A 2V4CA 5FHNA 4N6DA 4PBHA 3RPLA 4NF5A 3H6VA 1FBPA 3GXAA 1G0HA 3H6UA 2R8TA 4PFTA 4QFOA 3ROJA 1CNQA 4XKQA 3K1MA 4OWDA 2GFEA 4GBWA 1SQYA 2RC7A 1M5BA 3OENA 4YZZA 1B3HA 4OESA 2HEUA 2THIA 1NNTA 4MLVA 2F6PA 1FQFA 4G8MA 5TP9B 2HFBA 4PP0A 4F2OA 5I2KB 3V8XB 3MUQA 3PD9A 1NV4A 2RF1A 3G3FA 3T1BA 1UTHA 3TQWA 3IX1A 2UVHA 5M2VA 5CMBA 4M1VA 1Y3NA 4Q8RA 4O8MA 3TELA 1FRPA 1SD3A 3U92A 4F1UA 1DTZA 1LFIA 1VFDA 4I3YA 1R6ZA 1IXHA 1IMDA 4NEDA 4LZ8A 1LCFA 5L9SA 3CHGA 3LSXA 3PMWA 2Q8MA 2DSFA 1MY2A 4NF4B 3PV0E 4KCDA 1SDXA 2O6AA 3H3GA 3FXBA 4X04A 3U94A 3THIA 3SDFA 1XHYA 4F39A 1IMAA 2X7PA 3DLNA 4PGPA 3VE1B 1ANFA 2R6GE 4F1VA 1FPIA 3BFUA 4KR5A 4H0WA 4Z0IA 5AA3A 2JJKA 2P1SA 2L5VA 4U22A 1NNPA 3KZGA 2B4MA 4RYAA 2REJA 4KD5A 3PMVA 4IO3A 3FVNA 1GVCA 4BDQA 3TPAA 4EF2A 2HPGA 3QIMA 3FXQA 4TLLB 1QVSA 1CB6A 2F7CA 1NMUA 3T9XB 1BP5A 1XOCA 3IOTA 4GX3A 5JEIA 1B1HA 4YMAA 5L9OA 4MCOA 1LAGE 3N5LA 2I6EA 1URGA 4QSEA 4GWWA 4NQ8A 1INPA 4U21A 1B5HA 5AA2B 1DMBA 1R1NA 1B0LA 4GOTA 2CMOA 3QAXA 3KC0A 3CR9A 1JW5A 3M3FA 4H67A 4LONB 3FGSA 1FBGA 5CI5A 1N04A 2GQ1A 4DLDA 1NUWA 4QF9A 5IZZA 4LP2B 3PUZE 4P1EA 1GV8A 3RTFB 1FTJA 2O1MA 5H8HA 4I40A 5IZ3B 4KYSA 3PUXE 4MH5A 2KQZA 4MEVA 1Y3QA 4FIMA 1KWHA 4NF6A 3UP9A 3I6VA 4O7IA 3R7XA 4EXLA 5EQ8A 1BK4A 1OVBA 2DWIA 4P1LA 4THIA 4N6PA 1ZLQA 1URDA 4U4XA 2OWTA 1MXUA 1IMCA 1MG1A 2I0CA 3KSXA 1P1UA 1A99A 4YMBA 1B6HA 2M8CA 3DELB 1LBXA 4F29A 4PAFA 3ZKLA 4IY6A 2Q74A 4G68B 3TDJA 1JVYA 5KDTB 1UTBB 3G3GA 3LV0A 1H45A 3TTKA 2DWJA 3CIJA 4I9DA 3TFLA 3ODBA 4MNCA 3KN3A 4L17A 1MY3A 3D4CA 4NF5B 2O51A 4IO6A 5TPAB 3PPRA 3IL1B 1EYIA 3CFLA 5DW8A 2QFLA 1JEUA 4NHBA 4OFJA 3B7DA 4BDMA 3T66A 4FATA 3VXBA 2H98A 1DCUA 4FBPA 3G3KA 3O28A 5F7VA 3WAFA 1B32A 3MVYA 1DSNA 4ZDMA 4HW8A 2HQ0A 4OERA 4MNIA 1WODA 2QMXA 4IGTA 3MPLA 3BFTA 1B5JA 3OSRA 3VLVA 1H76A 2F6GA 1DBZA 4PFRA 5ELVA 2P3VA 4DDDA 2ZZXA 3QSLA 3CSBA 3SESA 1LSTA 5ET8A 3RT6B 1MQJA 1FQEA 5KDTA 2P0SA 4G77A 3SETA 1PEBA 4PETA 4AS5A 4R9GA 1L5TA 3S4UA 3SEUA 3T96B 4ZS9A 1ZU0A 2DE4A 2E0SA 2AYSA 5AA4A 1ZKBA 2B4LA 2XXQA 2XD2A 3RY3A 3UORA 1Y1ZA 4X9TA 2REGA 1NUZA 3CVGA 3UA8A 4AS4A 1FCKA 2Y5KA 3MWBA 3H4ZA 3A3CA 4P47A 2UYFA 2CEYA 2H25A 3FJMA 3O97A 1SW5A 5AE4A 1MDQA 1FPBA 3U72A 1H43A 2IEEA 2VPOA 3MZBA 4LUBA 4FEBA 1FTAA 1HSJA 3VVFA 3G7WA 4JB7A 2FIXA 1B51A 1P1OA 1N7WA 4JSDA 2WBBA 3G3HA 1FPLA 3KBRA 4AQ4A 1OVTA 2KLFA 2MKZA 3E78A 5DVFA 3SERA 1IMBA 1D9QA 1FBDA 1WDNA 4R75A 3BBRA 4G8HA 2YJPA 4JVIA 1Y9UA 1FPGA 2QVVA 2O7IA 3U1OA 5ESYA 4H8IA 1IMFA 4NN3A 3MYUA 2NUVA 1JETA 5EHSA 5CMKA 1AL3A 2RCBA 4YU0A 1VDWA 2QS2A 5EHMA 1RDYA 2B65A 1FQAA 2QJEA 3A3UA 5AA2D 5LOMA 2VP1A 4HE1A 1YYZA 2PT1A 1DOTA 2DOJA 4OQOA 1FW0A 3RT8A 2FIEA 1PB7A 3V83A 1A8EA 2ZYKA 3O29A 2ZNSA 4LZ5A 4H65A 1PC3A 3PMXA 2NWJA 2O7UA 1LBYA 1JEVA 4YICA 2PT2A 4R73A 4FORA 1BIYA 2XWIA 1OLAA 1NL5A 1DPPA 3HO7A 5DEXA 4PE3A 2HXRA 2V84A 3S2VA 5JTYB 2F7BA 2F36A 1MQIA 4NG7A 4KYEA 2HZKA 5IGAA 1JQFA 3H03A 3MZ1A 4I3EA 3CG3A 2QL3A 3V5AA 3LBSA 4FJPA 5DT6A 4IO7A 1RYXA 3PPOA 1P1NA 3BIHA 4R6KA 5KCJB 1O64A 2I58A 2Z23A 1IXCA 4GWZA 1FJ9A 3R6UA 3IAZA 5CRYA 5KZTA 3FXUA 1MY1A 3ONMA 5EQ9A 5HBCA 4U1OA 1TXFA 4ELPA 2WBDA 3K2DA 2FA7A 1MDP1 2P2AA 5DEXB 1JVXA 4P56A 1MS7A 4OANA 2Q9TA 2OCUA 1OLCA 4NF8B 3U65A 3K01A 2XXKA 3UIFA 4OZ9A 4H46A 1NV1A 1MXXA 2QRYA 2Y7KA 3EKIA 1RYOA 1LFHA 3G3JA 1JW1A 1MM6A 2F3BA 3SEVA 1RDZA 1B58A 4DZ1A 4PTKA 4RK9A 1FSAA 4ZZAA 4GQOA 4TQUQ 5HPQA 1F9BA 1KA0A 3MBPA 5FHOA 2DP8A 1YCJA 4R6HA 4GF8A 4LN5A 2OZZA 3H6TA 1MPBA 1ZMGA 4ELRA 1VE4A 4I1DA 3EQ1A 3KEIA 4PE5B 1POTA 3C34A 4GWUA 1LFGA 4EQBA 3PD8A 3OEMA 4XKPA 4QFPA 1FPJA 1NI9A 2UVGA 1I6AA 1FQDA 2XXWA 2RKMA 1MRPA 1P1QA 2YLNA 2H9BA 1FTMA 4WKMA 2OWSA 4XIGQ 5F1QA 1LAFE 2ANJA 2G29A 4G2ZA 2ABHA 2ZYOA 4P0GA 4KQPA 2GRVA 4RY1A 4OETA 4Q30B 1MQGA 1Y3PA 4MBPA 3FATA 4BDNA 5I2NA 1PBQA 1D3KA 2PYYA 2VOZA 1I69A 4GIZA 3W9WA 5JK4A 1MH3A 4JBZA 1B3LA 1Y20A 1FPKA 1WVJA 4R2FA 4JXIA 4YB5A 1EYJA 1XT8A 3PU5A 4OVRA 2ZZVA 3SEWA 3O66A 3TCHA 2OJTA 3M3LA 1QJMA 3VVEA 1TT1A 3IK6B 3N26A 1T0KA 3E9XA 3KFMA 4HXVA 1O7TA 4MF3A 1FPEA 2CZKA 5AA2A 4O3BA 2VGQA 1LBZA 3PTYA 1IZ1A 2WYPA 2XXTA 4EDPA 1NH8A 1RKMA 3O2AA 1LGBC 4F19A 3CSGA 4I8CA 1K9ZA 5EQ7A 2D3IA 3ILTB 3T9VA 1KA1A 5I2NB 3EN3A 1OQHA 3FJ7A 4PFBA 1MXYA 2H5YA 3C35A 3MVWA 4QSCA 1XVXA 1KZ8A 4ESWA 4IB2A 2XXHA 4GXAA 3OEKA 1B3GA 4ZEFA 4XXUA 5IM2A 3C32A 1YZ0A 3JYRA 1HSLA 3C4MA 3K4UA 4O3CA 3JV9A 4PF8A 2BJIA 5IZ1A 3T22A 1USYE 1P99A 4G4PA 5EQAA 2CEXA 3C33A 4PDDA 2VD3A 5A5XB 2F35A 1LAHE 4KI0E 1NV7A 3DP6A 4ONYA 4HCWA 3TTLA 1IMEA 1FBEA 1FPDA 1UIVA 3QUFA 1DK4A 2OX3A 2W7YA 5EYFA 3K1NA 3KBZA 4BDRA 4EUOA 4GWOA 3IFAA 4KPTA 4OXVA 4C1UA 4N4UA 4YAHX 5L9MA 2FBPA 4X48A 5HM4B 1A40A 2UXAA 3TYHA 1UIUA 5ET7A 3EHSA 1VSOA 5ICQA 4BLAA 3HHFA 4ZEDA 4DI4B 4PFWA 3TMGA 1QGXA 4LATA 5CMCA 1LEVA 2Z8FA 1FBFA 5L8DA 1N84A 3QYTA 1M5FA 4JSOA 3G3IA 4OEVA 4O94A 4XEQA 1UTHB 2AIXA 1JW4A 3DP8A 3S9EA 1AWBA 4O7MA 5IAIA 2F7AA 1M5DA 3IB2A 1MQHA 1PBPA 4F3PA 3FJGA 1NV2A 3O6IA 2XX8A 4GL8A 1I6QA 3N94A 2V25A 2XXXA 3CFXA 3DP4A 4IO4A 4OFOA 5DVJA 3KOTA 1VFEA 2I48A 2CZHA 1MXVA 3VV5A 5I56A 2DVZA 2ZZWA 3C9HA 4G8NA 1Y4TA 1SI0A 1M5CA 5IZ3A 1N76A 2QS4A 2CZIA 3H7MA 1J1NA 5T3JA 2XWKA 4KHZE 4IGRA 3RGYA 3EPEA 3IO6A 2NVUB 1D4NA 4JVCA 4JWOA 4PQJA 5ITOA 2XXPA 4OYVA 4F3GA 4P3LA 3TKDA 2FNCA 3W9VA 2ZYMA 2XXIA 3C31A 3LSWA 2ALUA 3Q28A 3TTMA 3FASA 4QBAA 4DCYA 3HHGA 1S9TA 2P3NA 4RK2A 3T0JA 3BKIB 3MP6A 3KSJA 2O1LA 4LA9A 3HSTA 3A29A 1A54A 5J16A 3GBBA 4NE4A 3HV1A 4MJOA 3IB0A 1SW1A 4WEPA 3U8QA 1EU8A 2A5TA 1MXZA 2DDKA 4QFNA 5H8FB 3FXRA 3MC2A 4OVTA 2PVUA 2GH9A 2HCAA 4P8BA 2WEFA 4ND9A 1B4HA 4UABA 1IUDA 1JNFA 3RLFE 4DIGA 5H8FA 3UN6A 3LUZA 1PB8A 4HS7A 5CM6A 2QVRA 2YPNA 4GX6A 4OFLA 1A7LA 3KOSA 5BWJA 3OELA 3S9LC 4R72A 4NGUA 4POWA 4HCYA 4N07A 3RUMA 1EZOA 4EF1A 3OO8A 1RDXA 1DPEA 3K0VA 2X26A 1B9JA 2XHDA 3KJTA 4IY5A 4X8RA 1TFDA 1NV5A 3M8UA 3B50A 4EQ9A 1Z7NE 4KFQA 2O84X 4ZECA 3B6QA 3RYDA 1ZBMA 3L6HA 4GWYA 4PBQA 2F34A 4DE8A 1UTBA 2ONKE 2R71A 4G68A 3MSTA 3MP1A 4XTCQ 2HAUA 4Q5TA 5I56B 2DWHA 1OIBA 1LB8A 3MVXA 1O63A 3IOUA 1B0HA 4QXDA 2Y7IA 4H8JA 2PFYA 1SVXB 2XX7A 3UGWA 2RC8A 5DVIA 3HFUA 1OMPA 4P9KA 5KCJA 2ONRA 4TLMB 3ZSFA 5B70A 2UYEA 1FQBA 1USYH 3RPWA 3SKPA 3QMFA 5I58B 1B7UA 1ELJA 3R26A 1NNKA 1SW2A 1AMFA 4U23A 3P7IA 3SEXA 4K3FA 1NNFA 4F3BA 3M3KA 4JWXA 4KXPA 4LQ2A 5I2KA 1US5A 3EHUA 1YTVA 3HN0A 4GWXA 5TP9A 3RQTA 3T93B 2XXVA 2QS3A 1POY1 1MPCA 4Q0CA 3VLUA 1FTOA 4MHFA 3WAEA 4PGNA 1Q1KA 3K6XA 2UVJA 3W15C 4FAJA 3AXFA 3F11A 2O69A 5H8HB 4GD5A 2NOOA 2Z8DA 2UVIA 3OOAA 2F78A 2GHAA 4GBVA 3TTNA 4KCCA 5ICTA 2A5TB 5DYHA 4F22A 2WYKA 3FZVA 1FTLA 4ZEBA 1MPDA 1XC1A 4ZEIA 2ZNTA 1B3FA 5I59B 1B46A 2OK2A 4OVPA 4E0XA 3D4GA 2Q2AA 5EYGA 2VPNA 3T9HB 4OHNA 4M4GA 4N91A 3S9MC 3VFJA 3IOWA 1SPIA 3K02A 4G61A 1D9VA 4MAGA 1S50A 4H5FA 5I59A 1SW4A 4R74A 1A55A 5K2XA 1B05A 3LSFB 5LTCA 3QXMA 3TCFA 1B4ZA 2E1SA 4N13A 2G93A 2I3VA 3K6VA 2VT5A 1TFAA 4IO2A 4PAKA 5I84A 5FBPA 2QS1A 1LB9A 4E0WA 4PDHA 3TODA 3OO6A 3IJXB 2HXWA 3I5OA 4QHQA 2GHBA 4NF6B 2I3WA 4PF6A 4DXBA 4PFIA 3LC8A 3VVDA 2ZYNA 3SZPA 3FVOA 5CBSA 2F3DA 3B6TA 1QKAA 2WKYA 2PFZA 1EZPA 1NUYA 1XS5A 2Q88A 4OVSA 4MNPA 1B7ZA 4PCDA 3B6WA 2XXUA 4HE2A 5H8NB 1R9QA 2Z22A 5I5PA 2I4BA 1TWYA 3HPIA 2V3QA 4AB6A 4F31B 5DTBA 2R9JA 4UACA 5BUUA 2ZNUA 4KYDA 1R9LA 3FD3A 2ZXTA 1IQ7A 1QUIA 2QSXA 4ISUA 4NWCA 5K2YA 1AOVA 2CZLA 5TU0A 1B52A 2XXYA 2XA5A 3IR1A 3DM0A 3TZAA 4ESXA 4H1XA 4BDOA 3TAJA 3TEPA 3USDA 4MX6A 1NUXA 4MFIA 3PUYE 2DQVA 4F2QA 1PDAA 4DXUA 3GBAA 2DS9A 3O6GA 1B1XA 3PUVE 5CMMA 2Q89A 2NXOA 4ELQA 3MP8A 1SYIA 3I3VA 1AH5A 5CC2A 3MW0A 4GXSB 1N7XA 1UQWA 1Z7ME 2PCRA
chains in the Genus database with same CATH topology
1FQFA 4G8MA 3N94A 2V25A 4F18A 4OENA 1FQAA 2QJEA 3A3UA 2Y7RA 4ZE8A 5TP9B 4HW8A 2QMWA 5AA2D 2XXXA 2HFBA 3ZKKA 2VP1A 2QPQA 3MZ9A 5LOMA 4PP0A 3V89B 3CFXA 4F2OA 5I2KB 3V8XB 4U2RA 4YB7A 2PT1A 1DOTA 2DOJA 3MUQA 2RCAA 2RF1A 3ECRA 3G3FA 3DP4A 3PD9A 1UTHA 4H5GA 4IO4A 4OQOA 4BDLA 1FW0A 4OMBA 3IX1A 3TQWA 2UVHA 5M2VA 3U93A 4OFOA 3RT8A 5CMBA 4M1VA 1Y3NA 3JZJA 4Q8RA 5DVJA 3TELA 1PB7A 3KOTA 3N6UA 3RN8A 1SD3A 1VFEA 2I48A 3CFZA 3EHTA 1MXVA 4G68C 3SEYA 3TQLA 3U92A 3VV5A 3V83A 4F1UA 1A8EA 2ZYKA 2F97A 4R2BA 1DTZA 5I56A 1FQCA 1LFIA 1VFDA 2DVZA 2ZNSA 3O29A 3OO7A 4FECA 4LZ5A 4H65A 1R6ZA 5J1DA 5ITPA 1PC3A 4JWYA 3PMXA 2NWJA 3C9HA 3IORA 4G8NA 2O7UA 1IXHA 1JEVA 1Y4TA 2DXYA 4NEDA 4YICA 2PT2A 1SI0A 3MPKA 1M5CA 4LZ8A 4R73A 3IOVA 1IEJA 1LCFA 1N76A 4FORA 1BIYA 4P0IA 5L9SA 1AIVA 2QS4A 1OLAA 1NL5A 4EXKA 1DPPA 3HO7A 3LSXA 3H7MA 4XKRA 5DEXA 1J1NA 4KHZE 4IGRA 1MM7A 1Q35A 3RGYA 3CRBA 3EPEA 3IO6A 2V84A 1D4NA 3PMWA 3PUWE 4GFRA 4JWOA 2NVUB 3S2VA 1N3WA 2DSFA 4PQJA 5JTYB 1MY2A 4NF4B 2V3UA 5ITOA 3MAMA 2XXPA 2F7BA 2F36A 4OYVA 3PV0E 4RXLA 4KCDA 1SDXA 5AA1A 1MQIA 2FNCA 2O6AA 2ZYMA 2XXIA 3H3GA 3TKDA 3W9VA 4KYEA 2HZKA 3U94A 3C31A 3LSWA 2ALUA 3Q28A 1JQFA 1B3EA 3H03A 3FASA 3MZ1A 2D21A 3SDFA 3THIA 3TTMA 1XHYA 3CG3A 1B2HA 2QL3A 3V5AA 4DCYA 1SBPA 3HHGA 3LBSA 4FJPA 4F39A 4WEDA 4NF4A 2X7PA 5DT6A 3DLNA 1S9TA 4IO7A 4RK2A 5I58A 1RYXA 3VE1B 1ANFA 3PPOA 2R6GE 1P1NA 4F1VA 3E4RA 3FVKA 3BFUA 3BKIB 3MP6A 3Q26A 3KSJA 4KR5A 4R6KA 2ZMBA 5KCJB 1O64A 5I57A 2Q2CA 2VD2A 4H0WA 2I58A 2Z23A 4Z0IA 2O1LA 4LA9A 1IXCA 3HSTA 2LAOA 5AA3A 1A54A 3GBBA 4NE4A 4ECFA 3PPQA 3HV1A 3TTRA 3FV2A 3IB0A 2P1SA 4LZ7A 1SW1A 4WEPA 4GLIA 3U8QA 3R6UA 4U22A 2O68A 5AA4B 1EU8A 2A5TA 3IAZA 1MXZA 5FTIA 5CRYA 4NMYA 1YPNA 4QFNA 2PMSA 5H8FB 3FXRA 3FXUA 5KZTA 3MC2A 1NNPA 2PVUA 1URSA 2GH9A 2HCAA 1MY1A 3Q25A 3KZGA 3K1PA 3ONMA 1US4A 4RYAA 4ND9A 4DXCA 5HBCA 1B4HA 3GZGA 2OBGA 4U1OA 1IUDA 1JNFA 1FTKA 1TXFA 4ELPA 3RLFE 2REJA 4KD5A 3PMVA 4DIGA 4OVJA 4IO3A 3UN6A 3FVNA 1GVCA 5H8FA 3K2DA 4BDQA 2V3TA 3TPAA 2FA7A 1PB8A 1MDP1 1NKXA 3QIMA 4H6DA 2B3FA 4QSDA 4EF2A 5IKBA 3FXQA 2P2AA 4R6YA 5DEXB 1JVXA 4HS7A 4TLLB 5CM6A 2YPNA 1MS7A 1QVSA 1A7LA 4OFLA 3KOSA 4F3SA 5BWJA 1CB6A 2F7CA 1NMUA 2Q9TA 4YB6A 4XKNA 3OELA 3OXNA 4YKKA 2OCUA 2B3BA 1BP5A 1XOCA 3T9XB 3IOTA 3KGCA 4MLQA 4R72A 4U4SA 5JEIA 3S9LC 1OLCA 4NF8B 3K01A 4POWA 1B1HA 5I57B 4YMAA 4HCYA 4N07A 5L9OA 4UA8A 3CG1A 3RUMA 3S9MC 3UIFA 1QW0A 3VXCA 4QFLA 1EZOA 4OZ9A 2Q8JA 4YKIA 4EF1A 1LAGE 3OO8A 1IITA 1DPEA 3N5LA 2I6EA 3K0VA 1MXXA 2QRYA 1URGA 2X26A 2Y7KA 5ISUA 1RYOA 1B9JA 1ZTYA 2XX9A 4QSEA 2XHDA 3KJTA 4IY5A 1LAXA 1LFHA 3G3JA 2XD3A 1JW1A 3GLBA 1MM6A 1TFDA 4LVQA 1SI1A 4U21A 2Y7PA 1B5HA 3M8UA 4EQ9A 1ZJLA 1Z7NE 4KFQA 1DMBA 1MH4A 1R1NA 5H8QB 2O84X 3T9UA 5AA2B 5JTYA 2DWAA 1B0LA 3SEVA 2F8DA 3VLWA 3OSQA 4GOTA 4EUOA 4ZECA 2CMOA 1B58A 2D5WA 3B6QA 5H8SA 3QAXA 4DZ1A 3CR9A 4RK9A 1JW5A 1ZBMA 3L6HA 3M3FA 4ZZAA 4H67A 2F34A 4YKJA 4DE8A 4FE8A 4GQOA 1UTBA 4TQUQ 1M5EA 2ONKE 1F9BA 2R71A 4G68A 5HPQA 3OO9A 3H6WA 3FGSA 4LONB 4RJZA 3MP1A 3MBPA 5FHOA 4XTCQ 2DP8A 1YCJA 4R6HA 1MY4A 1ATGA 4GF8A 2DXRA 2HAUA 4Q5TA 5CI5A 1N04A 4LQ5A 3FUZA 2OZZA 3E3KA 3H6TA 2Y7WA 1VR5A 1MPBA 1ZMGA 4DLDA 4ELRA 5I56B 3E13X 1VE4A 3IO4A 2DWHA 1OIBA 4I1DA 1LB8A 2A5SA 3FVGA 3MVXA 3EQ1A 4QF9A 4R9FA 3KEIA 1BKAA 1O63A 3IOUA 1B0HA 4PE5B 4LP2B 3PUZE 1GV8A 3RTFB 1FTJA 2O1MA 1H44A 5H8HA 2Y7IA 4H8JA 1POTA 3TCGA 3C34A 1SVXB 2XX7A 3UGWA 1LFGA 2RC8A 4EQBA 3PD8A 3OEMA 4KYSA 3PUXE 1OMPA 4MH5A 4XKPA 5DVIA 4QFPA 1Y3QA 4FIMA 1KWHA 2UVGA 5KCJA 3OD7A 1I6AA 1FQDA 2ONRA 2XXWA 4NF6A 4TLMB 2AL5A 3I6VA 3UP9A 4RA1A 4EXLA 3R7XA 3ZSFA 2RKMA 5B70A 1MRPA 4IO5A 2DWIA 1OVBA 1FQBA 1GTKA 2UYEA 1USYH 3RPWA 1P1QA 3SKPA 5I58B 2HAVA 4DCXA 1B7UA 1ELJA 4THIA 3R26A 4N6PA 1ZLQA 1NNKA 1SW2A 1URDA 1AMFA 2OWTA 1MXUA 1MG1A 2H9BA 1FTMA 2DE2A 2I0CA 2V93A 2YLNA 3P7IA 4U23A 3KSXA 3IB1A 4WKMA 1B5IA 4WXJA 2ONSA 1P1UA 2DVCA 2OWSA 1A99A 4K3FA 4OTEA 4XIGQ 1NNFA 5F1QA 1Y1MA 1LAFE 2AL4A 4GVOA 2ANJA 4YMBA 1B6HA 4JDFA 4F3BA 3MJNA 3IJOB 3K6WA 3M3KA 2M8CA 3DELB 2G29A 4JWXA 4G2ZA 1QULA 4LQ2A 5I2KA 1XVYA 1US5A 2ABHA 1YTVA 3EHUA 3FIRA 4F29A 2ZYOA 3O6HA 3HN0A 4P0GA 4KQPA 2GRVA 5TP9A 3ZKLA 4RY1A 4IY6A 4OETA 4TOZA 4Q30B 3RQTA 1QKBA 3PPPA 1JVYA 1LBBA 1MQGA 4G68B 1UTBB 1Y3PA 3T93B 3TDJA 4MBPA 5KDTB 2XXVA 2QS3A 1POY1 1MPCA 3G3GA 4Q0CA 4POXA 3VLUA 3Q27A 4GRKA 3FATA 1FTOA 4BDNA 1B7HA 2ESNA 5I2NA 1H45A 3C36A 1PBQA 3TTKA 2DWJA 4X1BA 1D3KA 3WAEA 2PYYA 2VOZA 3CIJA 1II5A 1Q1KA 1I69A 3VDFA 3K6XA 4GIZA 3W9WA 5JK4A 1MH3A 3QK6A 1MQDA 4NF8A 1Y4CA 5TPAA 4JBZA 2UVJA 3W15C 4FAJA 3AXFA 1EZ9A 3F11A 1IXGA 4RPNA 4I9DA 1B3LA 1Y20A 3TFLA 4AB5A 4F1YA 2O69A 1WVJA 2VHAA 3ODBA 4GD5A 5H8HB 4OEUA 2NOOA 1N0TA 3KN3A 4L17A 4R2FA 4JXIA 3LSLA 1MY3A 4YB5A 3D4CA 2Z8DA 4NF5B 3OMBA 1NH7A 1XT8A 4RNSA 2O51A 4IO6A 5TPAB 2UVIA 3OOAA 3PPRA 3PU5A 3IL1B 2I4CA 2F78A 3HCQA 2X7QA 3SEWA 3O66A 1LCTA 2GHAA 3TCHA 3CFLA 2XXRA 4X1DA 2OJTA 3TTNA 3L6GA 4P11A 1JEUA 3M3LA 1QJMA 4KCCA 5H8NA 1BTJA 3KJ7A 4OFJA 1SYHA 3B7DA 3KN8A 3VVEA 4BDMA 3T66A 1TT1A 5B7DA 5ICTA 3IK6B 2A5TB 3N26A 5DYHA 4F22A 4FATA 1T0KA 4QRZA 3TUSA 3VXBA 3FZVA 3E9XA 2H98A 3KFMA 1IIWA 1MY0A 1FTLA 1O7TA 2BJJX 1A8FA 3G3KA 3MQ9A 3H06B 3O28A 4MF3A 4O3AA 4ZEBA 1MPDA 4O3BA 5AA2A 1XC1A 4ZEIA 2ZNTA 2HZLA 2PX1A 2VGQA 1B3FA 3K00A 5F7VA 3WAFA 1D9YA 5I59B 3Q29A 1B46A 2DE3A 2OK2A 3FV1A 1B40A 1B32A 3MVYA 1IZ1A 1OQGA 1DSNA 2XXTA 4NTLA 3D4GA 4ZDMA 1BLFA 2HQ0A 4QFKA 5FTHA 4E0XA 2Q2AA 4OERA 1WODA 4EDPA 1NH8A 1RKMA 4NWDA 2QMXA 3O2AA 1LGBC 4IGTA 3T9HB 2OLBA 3MPLA 4HTGA 4F19A 3CSGA 4Z7EA 4I8CA 4OHNA 4M4GA 2IA4A 1B5JA 2RC9A 1IXIA 2D3IA 3BFTA 3ILTB 3SEXA 3T9VA 3RTWB 3IOWA 3VFJA 3OSRA 3K02A 5I2NB 1I6BA 1D9VA 3EN3A 3VLVA 1OQHA 1H76A 1S50A 3FJ7A 4H5FA 5I59A 1EH3A 5CMKA 1SW4A 1MXYA 4R74A 1A55A 2H5YA 3C35A 4FEDA 5K2XA 3QUJA 2F6GA 1B05A 4YKPA 3MVWA 3A09A 4PFYA 3LSFB 5ELVA 4DDDA 4QSCA 2I0BA 3QSLA 1XVXA 3CSBA 3SESA 3S9NC 1LSTA 4ESWA 4I62A 4PFUA 3RT6B 4IB2A 1MQJA 1LLSA 2XXHA 1FQEA 5FHMA 5KDTA 4GXAA 3OEKA 3QXMA 2P0SA 4G77A 3TCFA 1ZIUA 1B4ZA 2E1SA 1PEBA 2PBWA 3SETA 4N13A 4ZEKA 4PETA 1CE2A 1B3GA 2G93A 1P1WA 2I3VA 4R9GA 1L5TA 3S4UA 3SEUA 3K6VA 4ZEFA 4XXUA 1TFAA 3C32A 4IO2A 3T96B 5I84A 2QS1A 1LB9A 4ZS9A 4E0WA 1S7YA 1ZU0A 2DE4A 2E0SA 1HSLA 3C4MA 2AYSA 3JYRA 3LUYA 2Z8EA 3K4UA 3CI8A 2H99A 3JV9A 3MVZA 4O3CA 3TODA 5AA4A 3OO6A 1ZKBA 3IJXB 2HXWA 3UK4A 3I5OA 4QHQA 2GHBA 5A5XA 4NF6B 1YAEA 2I3WA 4DXBA 3VVDA 3LC8A 1GGGA 2XXQA 2ZYNA 2XD2A 3FVOA 3RY3A 1USYE 1P99A 2F5XA 3T22A 3UORA 4G4PA 5CBSA 3C33A 1Y1ZA 1MXWA 3B6TA 1QKAA 4X9TA 2REGA 4RPOA 2WKYA 2VD3A 3CVGA 3UA8A 1EZPA 1FCKA 3MWBA 5A5XB 3H4ZA 2F35A 1LAHE 3O9PA 1N3XA 1NFTA 1XS5A 2Q88A 2UYFA 3A3CA 3DP6A 1QUJA 3PGFA 4KI0E 4ONYA 4EQ7A 4U1ZA 1QUKA 4HCWA 3TTLA 1B7ZA 2H25A 3FJMA 1UIVA 3B6WA 1SW5A 2XXUA 2Y84A 3O97A 3QUFA 5H8NB 1PB9A 1R9QA 2W7YA 2Z22A 5AE4A 4C0RA 2I4BA 1TWYA 1MDQA 5EYFA 3K1NA 3HPIA 2V3QA 3RNNA 3EF7A 4AB6A 4ZE9A 2RINA 3U72A 1H43A 2IEEA 2R9JA 4GWOA 4KPTA 5DTBA 4BDRA 4C1TA 4UACA 3MZBA 2FYIA 2I49A 2ZNUA 4KYDA 1R9LA 5BUUA 5CBRA 3FD3A 3LR1A 4LUBA 4FEBA 4U4XA 3ZS6A 2ZXTA 4OXVA 1IQ7A 5H8QA 1QUIA 4C1UA 2QSXA 1HSJA 4ISUA 4GL0A 4YAHX 3ILUB 3VVFA 3G7WA 1GR2A 1H3DA 4JB7A 5L9MA 3K6UA 1B51A 3N6TA 4X48A 1P1OA 4ZZEA 5HM4B 1A40A 1N7WA 2UXAA 4JSDA 3KN7A 4NWCA 1UIUA 3TYHA 3EHSA 3PPNA 5K2YA 1VSOA 1AOVA 2CZLA 5ICQA 1DTGA 3G3HA 5TU0A 1B52A 1LBCA 3KBRA 4ELOA 1HSEA 4BLAA 3HHFA 2XXYA 4ZEDA 4AQ4A 2DYXA 4PFWA 1OVTA 2KLFA 3TMGA 2H4IA 3IR1A 3DM0A 3KG2A 5FHNA 3TZAA 4ESXA 4H1XA 4LATA 4BDOA 5CMCA 5DVFA 3SERA 2Z8FA 3TAJA 3TEPA 3USDA 1WDNA 4R75A 4NF5A 3BBRA 5L8DA 1N84A 4G8HA 3H6VA 1M5FA 3QYTA 4MFIA 3PUYE 2YJPA 4JSOA 2DQVA 3GXAA 1Y9UA 1PDAA 4F2QA 4DXUA 3G3IA 4F3GA 3GBAA 4OEVA 3H6UA 4PFTA 2DS9A 3O6GA 1UTHB 4QFOA 1B1XA 2AIXA 3U1OA 2O7IA 4XKQA 3PUVE 4H8IA 5CMMA 3K1MA 1JW4A 2Q89A 3DP8A 3S9EA 2NXOA 4OWDA 4ELQA 2GFEA 3MP8A 1SYIA 1SQYA 2RC7A 1M5BA 3I3VA 2NUVA 3OENA 5IAIA 2F7AA 1JETA 1M5DA 3IB2A 1MQHA 4YZZA 1AH5A 5EHSA 1PBPA 4F3PA 1B3HA 1AL3A 4OESA 5CC2A 2RCBA 3MW0A 3FJGA 4YU0A 2HEUA 4F31B 3O6IA 2THIA 2XX8A 2QS2A 1NNTA 5EHMA 4MLVA 4GXSB 1N7XA 1UQWA 1Z7ME 2F6PA 4GL8A 1I6QA 2B65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FQF A;  4G8M A;  3N94 A;  2V25 A;  4F18 A;  4OEN A;  1FQA A;  2QJE A;  3A3U A;  2Y7R A;  4ZE8 A;  5TP9 B;  4HW8 A;  2QMW A;  5AA2 D;  2XXX A;  2HFB A;  3ZKK A;  2VP1 A;  2QPQ A;  3MZ9 A;  5LOM A;  4PP0 A;  3V89 B;  3CFX A;  4F2O A;  5I2K B;  3V8X B;  4U2R A;  4YB7 A;  2PT1 A;  1DOT A;  2DOJ A;  3MUQ A;  2RCA A;  2RF1 A;  3ECR A;  3G3F A;  3DP4 A;  3PD9 A;  1UTH A;  4H5G A;  4IO4 A;  4OQO A;  4BDL A;  1FW0 A;  4OMB A;  3IX1 A;  3TQW A;  2UVH A;  5M2V A;  3U93 A;  4OFO A;  3RT8 A;  5CMB A;  4M1V A;  1Y3N A;  3JZJ A;  4Q8R A;  5DVJ A;  3TEL A;  1PB7 A;  3KOT A;  3N6U A;  3RN8 A;  1SD3 A;  1VFE A;  2I48 A;  3CFZ A;  3EHT A;  1MXV A;  4G68 C;  3SEY A;  3TQL A;  3U92 A;  3VV5 A;  3V83 A;  4F1U A;  1A8E A;  2ZYK A;  2F97 A;  4R2B A;  1DTZ A;  5I56 A;  1FQC A;  1LFI A;  1VFD A;  2DVZ A;  2ZNS A;  3O29 A;  3OO7 A;  4FEC A;  4LZ5 A;  4H65 A;  1R6Z A;  5J1D A;  5ITP A;  1PC3 A;  4JWY A;  3PMX A;  2NWJ A;  3C9H A;  3IOR A;  4G8N A;  2O7U A;  1IXH A;  1JEV A;  1Y4T A;  2DXY A;  4NED A;  4YIC A;  2PT2 A;  1SI0 A;  3MPK A;  1M5C A;  4LZ8 A;  4R73 A;  3IOV A;  1IEJ A;  1LCF A;  1N76 A;  4FOR A;  1BIY A;  4P0I A;  5L9S A;  1AIV A;  2QS4 A;  1OLA A;  1NL5 A;  4EXK A;  1DPP A;  3HO7 A;  3LSX A;  3H7M A;  4XKR A;  5DEX A;  1J1N A;  4KHZ E;  4IGR A;  1MM7 A;  1Q35 A;  3RGY A;  3CRB A;  3EPE A;  3IO6 A;  2V84 A;  1D4N A;  3PMW A;  3PUW E;  4GFR A;  4JWO A;  2NVU B;  3S2V A;  1N3W A;  2DSF A;  4PQJ A;  5JTY B;  1MY2 A;  4NF4 B;  2V3U A;  5ITO A;  3MAM A;  2XXP A;  2F7B A;  2F36 A;  4OYV A;  3PV0 E;  4RXL A;  4KCD A;  1SDX A;  5AA1 A;  1MQI A;  2FNC A;  2O6A A;  2ZYM A;  2XXI A;  3H3G A;  3TKD A;  3W9V A;  4KYE A;  2HZK A;  3U94 A;  3C31 A;  3LSW A;  2ALU A;  3Q28 A;  1JQF A;  1B3E A;  3H03 A;  3FAS A;  3MZ1 A;  2D21 A;  3SDF A;  3THI A;  3TTM A;  1XHY A;  3CG3 A;  1B2H A;  2QL3 A;  3V5A A;  4DCY A;  1SBP A;  3HHG A;  3LBS A;  4FJP A;  4F39 A;  4WED A;  4NF4 A;  2X7P A;  5DT6 A;  3DLN A;  1S9T A;  4IO7 A;  4RK2 A;  5I58 A;  1RYX A;  3VE1 B;  1ANF A;  3PPO A;  2R6G E;  1P1N A;  4F1V A;  3E4R A;  3FVK A;  3BFU A;  3BKI B;  3MP6 A;  3Q26 A;  3KSJ A;  4KR5 A;  4R6K A;  2ZMB A;  5KCJ B;  1O64 A;  5I57 A;  2Q2C A;  2VD2 A;  4H0W A;  2I58 A;  2Z23 A;  4Z0I A;  2O1L A;  4LA9 A;  1IXC A;  3HST A;  2LAO A;  5AA3 A;  1A54 A;  3GBB A;  4NE4 A;  4ECF A;  3PPQ A;  3HV1 A;  3TTR A;  3FV2 A;  3IB0 A;  2P1S A;  4LZ7 A;  1SW1 A;  4WEP A;  4GLI A;  3U8Q A;  3R6U A;  4U22 A;  2O68 A;  5AA4 B;  1EU8 A;  2A5T A;  3IAZ A;  1MXZ A;  5FTI A;  5CRY A;  4NMY A;  1YPN A;  4QFN A;  2PMS A;  5H8F B;  3FXR A;  3FXU A;  5KZT A;  3MC2 A;  1NNP A;  2PVU A;  1URS A;  2GH9 A;  2HCA A;  1MY1 A;  3Q25 A;  3KZG A;  3K1P A;  3ONM A;  1US4 A;  4RYA A;  4ND9 A;  4DXC A;  5HBC A;  1B4H A;  3GZG A;  2OBG A;  4U1O A;  1IUD A;  1JNF A;  1FTK A;  1TXF A;  4ELP A;  3RLF E;  2REJ A;  4KD5 A;  3PMV A;  4DIG A;  4OVJ A;  4IO3 A;  3UN6 A;  3FVN A;  1GVC A;  5H8F A;  3K2D A;  4BDQ A;  2V3T A;  3TPA A;  2FA7 A;  1PB8 A;  1MDP 1;  1NKX A;  3QIM A;  4H6D A;  2B3F A;  4QSD A;  4EF2 A;  5IKB A;  3FXQ A;  2P2A A;  4R6Y A;  5DEX B;  1JVX A;  4HS7 A;  4TLL B;  5CM6 A;  2YPN A;  1MS7 A;  1QVS A;  1A7L A;  4OFL A;  3KOS A;  4F3S A;  5BWJ A;  1CB6 A;  2F7C A;  1NMU A;  2Q9T A;  4YB6 A;  4XKN A;  3OEL A;  3OXN A;  4YKK A;  2OCU A;  2B3B A;  1BP5 A;  1XOC A;  3T9X B;  3IOT A;  3KGC A;  4MLQ A;  4R72 A;  4U4S A;  5JEI A;  3S9L C;  1OLC A;  4NF8 B;  3K01 A;  4POW A;  1B1H A;  5I57 B;  4YMA A;  4HCY A;  4N07 A;  5L9O A;  4UA8 A;  3CG1 A;  3RUM A;  3S9M C;  3UIF A;  1QW0 A;  3VXC A;  4QFL A;  1EZO A;  4OZ9 A;  2Q8J A;  4YKI A;  4EF1 A;  1LAG E;  3OO8 A;  1IIT A;  1DPE A;  3N5L A;  2I6E A;  3K0V A;  1MXX A;  2QRY A;  1URG A;  2X26 A;  2Y7K A;  5ISU A;  1RYO A;  1B9J A;  1ZTY A;  2XX9 A;  4QSE A;  2XHD A;  3KJT A;  4IY5 A;  1LAX A;  1LFH A;  3G3J A;  2XD3 A;  1JW1 A;  3GLB A;  1MM6 A;  1TFD A;  4LVQ A;  1SI1 A;  4U21 A;  2Y7P A;  1B5H A;  3M8U A;  4EQ9 A;  1ZJL A;  1Z7N E;  4KFQ A;  1DMB A;  1MH4 A;  1R1N A;  5H8Q B;  2O84 X;  3T9U A;  5AA2 B;  5JTY A;  2DWA A;  1B0L A;  3SEV A;  2F8D A;  3VLW A;  3OSQ A;  4GOT A;  4EUO A;  4ZEC A;  2CMO A;  1B58 A;  2D5W A;  3B6Q A;  5H8S A;  3QAX A;  4DZ1 A;  3CR9 A;  4RK9 A;  1JW5 A;  1ZBM A;  3L6H A;  3M3F A;  4ZZA A;  4H67 A;  2F34 A;  4YKJ A;  4DE8 A;  4FE8 A;  4GQO A;  1UTB A;  4TQU Q;  1M5E A;  2ONK E;  1F9B A;  2R71 A;  4G68 A;  5HPQ A;  3OO9 A;  3H6W A;  3FGS A;  4LON B;  4RJZ A;  3MP1 A;  3MBP A;  5FHO A;  4XTC Q;  2DP8 A;  1YCJ A;  4R6H A;  1MY4 A;  1ATG A;  4GF8 A;  2DXR A;  2HAU A;  4Q5T A;  5CI5 A;  1N04 A;  4LQ5 A;  3FUZ A;  2OZZ A;  3E3K A;  3H6T A;  2Y7W A;  1VR5 A;  1MPB A;  1ZMG A;  4DLD A;  4ELR A;  5I56 B;  3E13 X;  1VE4 A;  3IO4 A;  2DWH A;  1OIB A;  4I1D A;  1LB8 A;  2A5S A;  3FVG A;  3MVX A;  3EQ1 A;  4QF9 A;  4R9F A;  3KEI A;  1BKA A;  1O63 A;  3IOU A;  1B0H A;  4PE5 B;  4LP2 B;  3PUZ E;  1GV8 A;  3RTF B;  1FTJ A;  2O1M A;  1H44 A;  5H8H A;  2Y7I A;  4H8J A;  1POT A;  3TCG A;  3C34 A;  1SVX B;  2XX7 A;  3UGW A;  1LFG A;  2RC8 A;  4EQB A;  3PD8 A;  3OEM A;  4KYS A;  3PUX E;  1OMP A;  4MH5 A;  4XKP A;  5DVI A;  4QFP A;  1Y3Q A;  4FIM A;  1KWH A;  2UVG A;  5KCJ A;  3OD7 A;  1I6A A;  1FQD A;  2ONR A;  2XXW A;  4NF6 A;  4TLM B;  2AL5 A;  3I6V A;  3UP9 A;  4RA1 A;  4EXL A;  3R7X A;  3ZSF A;  2RKM A;  5B70 A;  1MRP A;  4IO5 A;  2DWI A;  1OVB A;  1FQB A;  1GTK A;  2UYE A;  1USY H;  3RPW A;  1P1Q A;  3SKP A;  5I58 B;  2HAV A;  4DCX A;  1B7U A;  1ELJ A;  4THI A;  3R26 A;  4N6P A;  1ZLQ A;  1NNK A;  1SW2 A;  1URD A;  1AMF A;  2OWT A;  1MXU A;  1MG1 A;  2H9B A;  1FTM A;  2DE2 A;  2I0C A;  2V93 A;  2YLN A;  3P7I A;  4U23 A;  3KSX A;  3IB1 A;  4WKM A;  1B5I A;  4WXJ A;  2ONS A;  1P1U A;  2DVC A;  2OWS A;  1A99 A;  4K3F A;  4OTE A;  4XIG Q;  1NNF A;  5F1Q A;  1Y1M A;  1LAF E;  2AL4 A;  4GVO A;  2ANJ A;  4YMB A;  1B6H A;  4JDF A;  4F3B A;  3MJN A;  3IJO B;  3K6W A;  3M3K A;  2M8C A;  3DEL B;  2G29 A;  4JWX A;  4G2Z A;  1QUL A;  4LQ2 A;  5I2K A;  1XVY A;  1US5 A;  2ABH A;  1YTV A;  3EHU A;  3FIR A;  4F29 A;  2ZYO A;  3O6H A;  3HN0 A;  4P0G A;  4KQP A;  2GRV A;  5TP9 A;  3ZKL A;  4RY1 A;  4IY6 A;  4OET A;  4TOZ A;  4Q30 B;  3RQT A;  1QKB A;  3PPP A;  1JVY A;  1LBB A;  1MQG A;  4G68 B;  1UTB B;  1Y3P A;  3T93 B;  3TDJ A;  4MBP A;  5KDT B;  2XXV A;  2QS3 A;  1POY 1;  1MPC A;  3G3G A;  4Q0C A;  4POX A;  3VLU A;  3Q27 A;  4GRK A;  3FAT A;  1FTO A;  4BDN A;  1B7H A;  2ESN A;  5I2N A;  1H45 A;  3C36 A;  1PBQ A;  3TTK A;  2DWJ A;  4X1B A;  1D3K A;  3WAE A;  2PYY A;  2VOZ A;  3CIJ A;  1II5 A;  1Q1K A;  1I69 A;  3VDF A;  3K6X A;  4GIZ A;  3W9W A;  5JK4 A;  1MH3 A;  3QK6 A;  1MQD A;  4NF8 A;  1Y4C A;  5TPA A;  4JBZ A;  2UVJ A;  3W15 C;  4FAJ A;  3AXF A;  1EZ9 A;  3F11 A;  1IXG A;  4RPN A;  4I9D A;  1B3L A;  1Y20 A;  3TFL A;  4AB5 A;  4F1Y A;  2O69 A;  1WVJ A;  2VHA A;  3ODB A;  4GD5 A;  5H8H B;  4OEU A;  2NOO A;  1N0T A;  3KN3 A;  4L17 A;  4R2F A;  4JXI A;  3LSL A;  1MY3 A;  4YB5 A;  3D4C A;  2Z8D A;  4NF5 B;  3OMB A;  1NH7 A;  1XT8 A;  4RNS A;  2O51 A;  4IO6 A;  5TPA B;  2UVI A;  3OOA A;  3PPR A;  3PU5 A;  3IL1 B;  2I4C A;  2F78 A;  3HCQ A;  2X7Q A;  3SEW A;  3O66 A;  1LCT A;  2GHA A;  3TCH A;  3CFL A;  2XXR A;  4X1D A;  2OJT A;  3TTN A;  3L6G A;  4P11 A;  1JEU A;  3M3L A;  1QJM A;  4KCC A;  5H8N A;  1BTJ A;  3KJ7 A;  4OFJ A;  1SYH A;  3B7D A;  3KN8 A;  3VVE A;  4BDM A;  3T66 A;  1TT1 A;  5B7D A;  5ICT A;  3IK6 B;  2A5T B;  3N26 A;  5DYH A;  4F22 A;  4FAT A;  1T0K A;  4QRZ A;  3TUS A;  3VXB A;  3FZV A;  3E9X A;  2H98 A;  3KFM A;  1IIW A;  1MY0 A;  1FTL A;  1O7T A;  2BJJ X;  1A8F A;  3G3K A;  3MQ9 A;  3H06 B;  3O28 A;  4MF3 A;  4O3A A;  4ZEB A;  1MPD A;  4O3B A;  5AA2 A;  1XC1 A;  4ZEI A;  2ZNT A;  2HZL A;  2PX1 A;  2VGQ A;  1B3F A;  3K00 A;  5F7V A;  3WAF A;  1D9Y A;  5I59 B;  3Q29 A;  1B46 A;  2DE3 A;  2OK2 A;  3FV1 A;  1B40 A;  1B32 A;  3MVY A;  1IZ1 A;  1OQG A;  1DSN A;  2XXT A;  4NTL A;  3D4G A;  4ZDM A;  1BLF A;  2HQ0 A;  4QFK A;  5FTH A;  4E0X A;  2Q2A A;  4OER A;  1WOD A;  4EDP A;  1NH8 A;  1RKM A;  4NWD A;  2QMX A;  3O2A A;  1LGB C;  4IGT A;  3T9H B;  2OLB A;  3MPL A;  4HTG A;  4F19 A;  3CSG A;  4Z7E A;  4I8C A;  4OHN A;  4M4G A;  2IA4 A;  1B5J A;  2RC9 A;  1IXI A;  2D3I A;  3BFT A;  3ILT B;  3SEX A;  3T9V A;  3RTW B;  3IOW A;  3VFJ A;  3OSR A;  3K02 A;  5I2N B;  1I6B A;  1D9V A;  3EN3 A;  3VLV A;  1OQH A;  1H76 A;  1S50 A;  3FJ7 A;  4H5F A;  5I59 A;  1EH3 A;  5CMK A;  1SW4 A;  1MXY A;  4R74 A;  1A55 A;  2H5Y A;  3C35 A;  4FED A;  5K2X A;  3QUJ A;  2F6G A;  1B05 A;  4YKP A;  3MVW A;  3A09 A;  4PFY A;  3LSF B;  5ELV A;  4DDD A;  4QSC A;  2I0B A;  3QSL A;  1XVX A;  3CSB A;  3SES A;  3S9N C;  1LST A;  4ESW A;  4I62 A;  4PFU A;  3RT6 B;  4IB2 A;  1MQJ A;  1LLS A;  2XXH A;  1FQE A;  5FHM A;  5KDT A;  4GXA A;  3OEK A;  3QXM A;  2P0S A;  4G77 A;  3TCF A;  1ZIU A;  1B4Z A;  2E1S A;  1PEB A;  2PBW A;  3SET A;  4N13 A;  4ZEK A;  4PET A;  1CE2 A;  1B3G A;  2G93 A;  1P1W A;  2I3V A;  4R9G A;  1L5T A;  3S4U A;  3SEU A;  3K6V A;  4ZEF A;  4XXU A;  1TFA A;  3C32 A;  4IO2 A;  3T96 B;  5I84 A;  2QS1 A;  1LB9 A;  4ZS9 A;  4E0W A;  1S7Y A;  1ZU0 A;  2DE4 A;  2E0S A;  1HSL A;  3C4M A;  2AYS A;  3JYR A;  3LUY A;  2Z8E A;  3K4U A;  3CI8 A;  2H99 A;  3JV9 A;  3MVZ A;  4O3C A;  3TOD A;  5AA4 A;  3OO6 A;  1ZKB A;  3IJX B;  2HXW A;  3UK4 A;  3I5O A;  4QHQ A;  2GHB A;  5A5X A;  4NF6 B;  1YAE A;  2I3W A;  4DXB A;  3VVD A;  3LC8 A;  1GGG A;  2XXQ A;  2ZYN A;  2XD2 A;  3FVO A;  3RY3 A;  1USY E;  1P99 A;  2F5X A;  3T22 A;  3UOR A;  4G4P A;  5CBS A;  3C33 A;  1Y1Z A;  1MXW A;  3B6T A;  1QKA A;  4X9T A;  2REG A;  4RPO A;  2WKY A;  2VD3 A;  3CVG A;  3UA8 A;  1EZP A;  1FCK A;  3MWB A;  5A5X B;  3H4Z A;  2F35 A;  1LAH E;  3O9P A;  1N3X A;  1NFT A;  1XS5 A;  2Q88 A;  2UYF A;  3A3C A;  3DP6 A;  1QUJ A;  3PGF A;  4KI0 E;  4ONY A;  4EQ7 A;  4U1Z A;  1QUK A;  4HCW A;  3TTL A;  1B7Z A;  2H25 A;  3FJM A;  1UIV A;  3B6W A;  1SW5 A;  2XXU A;  2Y84 A;  3O97 A;  3QUF A;  5H8N B;  1PB9 A;  1R9Q A;  2W7Y A;  2Z22 A;  5AE4 A;  4C0R A;  2I4B A;  1TWY A;  1MDQ A;  5EYF A;  3K1N A;  3HPI A;  2V3Q A;  3RNN A;  3EF7 A;  4AB6 A;  4ZE9 A;  2RIN A;  3U72 A;  1H43 A;  2IEE A;  2R9J A;  4GWO A;  4KPT A;  5DTB A;  4BDR A;  4C1T A;  4UAC A;  3MZB A;  2FYI A;  2I49 A;  2ZNU A;  4KYD A;  1R9L A;  5BUU A;  5CBR A;  3FD3 A;  3LR1 A;  4LUB A;  4FEB A;  4U4X A;  3ZS6 A;  2ZXT A;  4OXV A;  1IQ7 A;  5H8Q A;  1QUI A;  4C1U A;  2QSX A;  1HSJ A;  4ISU A;  4GL0 A;  4YAH X;  3ILU B;  3VVF A;  3G7W A;  1GR2 A;  1H3D A;  4JB7 A;  5L9M A;  3K6U A;  1B51 A;  3N6T A;  4X48 A;  1P1O A;  4ZZE A;  5HM4 B;  1A40 A;  1N7W A;  2UXA A;  4JSD A;  3KN7 A;  4NWC A;  1UIU A;  3TYH A;  3EHS A;  3PPN A;  5K2Y A;  1VSO A;  1AOV A;  2CZL A;  5ICQ A;  1DTG A;  3G3H A;  5TU0 A;  1B52 A;  1LBC A;  3KBR A;  4ELO A;  1HSE A;  4BLA A;  3HHF A;  2XXY A;  4ZED A;  4AQ4 A;  2DYX A;  4PFW A;  1OVT A;  2KLF A;  3TMG A;  2H4I A;  3IR1 A;  3DM0 A;  3KG2 A;  5FHN A;  3TZA A;  4ESX A;  4H1X A;  4LAT A;  4BDO A;  5CMC A;  5DVF A;  3SER A;  2Z8F A;  3TAJ A;  3TEP A;  3USD A;  1WDN A;  4R75 A;  4NF5 A;  3BBR A;  5L8D A;  1N84 A;  4G8H A;  3H6V A;  1M5F A;  3QYT A;  4MFI A;  3PUY E;  2YJP A;  4JSO A;  2DQV A;  3GXA A;  1Y9U A;  1PDA A;  4F2Q A;  4DXU A;  3G3I A;  4F3G A;  3GBA A;  4OEV A;  3H6U A;  4PFT A;  2DS9 A;  3O6G A;  1UTH B;  4QFO A;  1B1X A;  2AIX A;  3U1O A;  2O7I A;  4XKQ A;  3PUV E;  4H8I A;  5CMM A;  3K1M A;  1JW4 A;  2Q89 A;  3DP8 A;  3S9E A;  2NXO A;  4OWD A;  4ELQ A;  2GFE A;  3MP8 A;  1SYI A;  1SQY A;  2RC7 A;  1M5B A;  3I3V A;  2NUV A;  3OEN A;  5IAI A;  2F7A A;  1JET A;  1M5D A;  3IB2 A;  1MQH A;  4YZZ A;  1AH5 A;  5EHS A;  1PBP A;  4F3P A;  1B3H A;  1AL3 A;  4OES A;  5CC2 A;  2RCB A;  3MW0 A;  3FJG A;  4YU0 A;  2HEU A;  4F31 B;  3O6I A;  2THI A;  2XX8 A;  2QS2 A;  1NNT A;  5EHM A;  4MLV A;  4GXS B;  1N7X A;  1UQW A;  1Z7M E;  2F6P A;  4GL8 A;  1I6Q A;  2B65 A; 
#chains in the Genus database with same CATH topology
 1YXI A;  4F18 A;  4OEN A;  2Y7R A;  4ZE8 A;  3E79 A;  2QMW A;  3ZKK A;  3MZ9 A;  2QPQ A;  3B8B A;  3V89 B;  4U2R A;  4YB7 A;  4N15 A;  2RCA A;  3ECR A;  4H5G A;  4BDL A;  4OMB A;  3U93 A;  3JZJ A;  3N6U A;  3RN8 A;  3CFZ A;  3EHT A;  4G68 C;  3TQL A;  3SEY A;  4R2B A;  2F97 A;  1FQC A;  3OO7 A;  4FEC A;  5J1D A;  5ITP A;  4JWY A;  2Y5L A;  3IOR A;  3IFC A;  2DXY A;  3MPK A;  3IOV A;  1IEJ A;  4P0I A;  4EXK A;  4XKR A;  1MM7 A;  1Q35 A;  2XWO A;  3CRB A;  3PUW E;  4GFR A;  1N3W A;  2V3U A;  2WX9 A;  3MAM A;  5AA1 A;  4C0R A;  4RXL A;  3BIG A;  1B3E A;  3GYY A;  2D21 A;  1B2H A;  1Q9D A;  1SBP A;  4WED A;  4NF4 A;  5I58 A;  3FBP A;  4GWS A;  4PC9 A;  3E4R A;  3FVK A;  2XWV A;  1XI6 A;  3Q26 A;  2ZMB A;  5I57 A;  2Q2C A;  2VD2 A;  3NOH A;  2LAO A;  4ECF A;  3PPQ A;  3TTR A;  3FV2 A;  5LDZ A;  4LZ7 A;  4GLI A;  2O68 A;  5AA4 B;  5I3S A;  5FTI A;  4NMY A;  1YPN A;  2PMS A;  1URS A;  3Q25 A;  3K1P A;  1US4 A;  4DXC A;  3GZG A;  2OBG A;  1FTK A;  4OVJ A;  2V3T A;  1NKX A;  4H6D A;  2B3F A;  4QSD A;  5IKB A;  4R6Y A;  1FPF A;  4YB6 A;  4XKN A;  3OXN A;  4YKK A;  2B3B A;  3RPL B;  3KGC A;  4MLQ A;  4U4S A;  5I57 B;  4N8Y A;  4UA8 A;  3CG1 A;  1QW0 A;  3VXC A;  4QFL A;  2Q8J A;  4YKI A;  1IIT A;  4OVQ A;  5ISU A;  1ZTY A;  2XX9 A;  1LAX A;  2XD3 A;  3GLB A;  4LVQ A;  1SI1 A;  2Y7P A;  1ZJL A;  3T9U A;  5H8Q B;  1MH4 A;  5JTY A;  2DWA A;  3VLW A;  2FVZ A;  2F8D A;  3OSQ A;  4JVD A;  2D5W A;  1K9Y A;  5H8S A;  5EYH A;  4H45 A;  4N81 A;  4YKJ A;  4FE8 A;  1M5E A;  3OO9 A;  3H6W A;  4RJZ A;  1MY4 A;  1ATG A;  4OA4 A;  2DXR A;  4LQ5 A;  3FUZ A;  3E3K A;  2Y7W A;  1VR5 A;  5ET5 A;  3E13 X;  3IO4 A;  2A5S A;  3FVG A;  4R9F A;  1BKA A;  1H44 A;  3TCG A;  4DI3 D;  4GX4 A;  4MIJ A;  3OD7 A;  2AL5 A;  4RA1 A;  4IO5 A;  1GTK A;  2HAV A;  4DCX A;  2DE2 A;  2V93 A;  4N6K A;  4WXJ A;  3IB1 A;  1B5I A;  2ONS A;  2DVC A;  4OTE A;  4N17 A;  1Y1M A;  2AL4 A;  4GVO A;  4XF5 A;  4JDF A;  3KC1 A;  3IJO B;  3K6W A;  3MJN A;  1FBH A;  1QUL A;  4MMP A;  1XVY A;  3FIR A;  3O6H A;  4TOZ A;  1QKB A;  3PPP A;  1LBB A;  5ET6 A;  1LBW A;  1LBV A;  4POX A;  3Q27 A;  4GRK A;  1EYK A;  1B7H A;  2ESN A;  3C36 A;  4X1B A;  1II5 A;  3VDF A;  3QK6 A;  4NF8 A;  1MQD A;  4NX1 A;  1Y4C A;  5TPA A;  1EZ9 A;  4RPN A;  1IXG A;  2KR0 A;  1NV0 A;  4AB5 A;  4F1Y A;  2VHA A;  4OEU A;  1N0T A;  3LSL A;  2FHY A;  4HE0 A;  4PAI A;  3OMB A;  1NH7 A;  4RNS A;  2I4C A;  3HCQ A;  2X7Q A;  1LCT A;  2XXR A;  1JP4 A;  4X1D A;  3L6G A;  4P11 A;  5H8N A;  1BTJ A;  3KJ7 A;  1SYH A;  3KN8 A;  5B7D A;  4QRZ A;  1IIW A;  1MY0 A;  2HHM A;  2BJJ X;  3MQ9 A;  1A8F A;  4O3A A;  3H06 B;  2HZL A;  2PX1 A;  3K00 A;  1D9Y A;  3Q29 A;  2DE3 A;  3FV1 A;  1B40 A;  1OQG A;  4NTL A;  1BLF A;  4QFK A;  5FTH A;  4NWD A;  1FJ6 A;  2OLB A;  4HTG A;  4Z7E A;  2QVU A;  2IA4 A;  2RC9 A;  1IXI A;  3RTW B;  5A5L A;  2OWZ A;  1I6B A;  1EH3 A;  4XFE A;  5I7I A;  4FED A;  3QUJ A;  4YKP A;  3A09 A;  4PFY A;  1NV3 A;  2I0B A;  3S9N C;  4I62 A;  4PFU A;  1LLS A;  5FHM A;  1ZIU A;  2PBW A;  1FBC A;  4ZEK A;  1CE2 A;  1P1W A;  1NV6 A;  3ISP A;  1S7Y A;  3LUY A;  2Z8E A;  3CI8 A;  2H99 A;  3MVZ A;  3UK4 A;  5A5X A;  1YAE A;  1GGG A;  4F3S A;  2F5X A;  1MXW A;  4RPO A;  3O9P A;  1N3X A;  1NFT A;  3PGF A;  4EQ7 A;  1QUJ A;  4U1Z A;  1QUK A;  2Y84 A;  1PB9 A;  3RNN A;  3TUS A;  4ZE9 A;  3EF7 A;  2RIN A;  4C1T A;  2FYI A;  2I49 A;  5CBR A;  5F24 A;  1G0I A;  4NAP A;  3LR1 A;  3ZS6 A;  1AIV A;  4IR8 A;  5H8Q A;  4GL0 A;  3ILU B;  1GR2 A;  1H3D A;  3K6U A;  3D1R A;  3N6T A;  4ZZE A;  3KN7 A;  4NF0 A;  4N8G A;  3PPN A;  1DTG A;  1LBC A;  4ELO A;  1HSE A;  2DYX A;  2H4I A;  3KG2 A;  2V4C A;  5FHN A;  4N6D A;  4PBH A;  3RPL A;  4NF5 A;  3H6V A;  1FBP A;  3GXA A;  1G0H A;  3H6U A;  2R8T A;  4PFT A;  4QFO A;  3ROJ A;  1CNQ A;  4XKQ A;  3K1M A;  4OWD A;  2GFE A;  4GBW A;  1SQY A;  2RC7 A;  1M5B A;  3OEN A;  4YZZ A;  1B3H A;  4OES A;  2HEU A;  2THI A;  1NNT A;  4MLV A;  2F6P A;  1FQF A;  4G8M A;  5TP9 B;  2HFB A;  4PP0 A;  4F2O A;  5I2K B;  3V8X B;  3MUQ A;  3PD9 A;  1NV4 A;  2RF1 A;  3G3F A;  3T1B A;  1UTH A;  3TQW A;  3IX1 A;  2UVH A;  5M2V A;  5CMB A;  4M1V A;  1Y3N A;  4Q8R A;  4O8M A;  3TEL A;  1FRP A;  1SD3 A;  3U92 A;  4F1U A;  1DTZ A;  1LFI A;  1VFD A;  4I3Y A;  1R6Z A;  1IXH A;  1IMD A;  4NED A;  4LZ8 A;  1LCF A;  5L9S A;  3CHG A;  3LSX A;  3PMW A;  2Q8M A;  2DSF A;  1MY2 A;  4NF4 B;  3PV0 E;  4KCD A;  1SDX A;  2O6A A;  3H3G A;  3FXB A;  4X04 A;  3U94 A;  3THI A;  3SDF A;  1XHY A;  4F39 A;  1IMA A;  2X7P A;  3DLN A;  4PGP A;  3VE1 B;  1ANF A;  2R6G E;  4F1V A;  1FPI A;  3BFU A;  4KR5 A;  4H0W A;  4Z0I A;  5AA3 A;  2JJK A;  2P1S A;  2L5V A;  4U22 A;  1NNP A;  3KZG A;  2B4M A;  4RYA A;  2REJ A;  4KD5 A;  3PMV A;  4IO3 A;  3FVN A;  1GVC A;  4BDQ A;  3TPA A;  4EF2 A;  2HPG A;  3QIM A;  3FXQ A;  4TLL B;  1QVS A;  1CB6 A;  2F7C A;  1NMU A;  3T9X B;  1BP5 A;  1XOC A;  3IOT A;  4GX3 A;  5JEI A;  1B1H A;  4YMA A;  5L9O A;  4MCO A;  1LAG E;  3N5L A;  2I6E A;  1URG A;  4QSE A;  4GWW A;  4NQ8 A;  1INP A;  4U21 A;  1B5H A;  5AA2 B;  1DMB A;  1R1N A;  1B0L A;  4GOT A;  2CMO A;  3QAX A;  3KC0 A;  3CR9 A;  1JW5 A;  3M3F A;  4H67 A;  4LON B;  3FGS A;  1FBG A;  5CI5 A;  1N04 A;  2GQ1 A;  4DLD A;  1NUW A;  4QF9 A;  5IZZ A;  4LP2 B;  3PUZ E;  4P1E A;  1GV8 A;  3RTF B;  1FTJ A;  2O1M A;  5H8H A;  4I40 A;  5IZ3 B;  4KYS A;  3PUX E;  4MH5 A;  2KQZ A;  4MEV A;  1Y3Q A;  4FIM A;  1KWH A;  4NF6 A;  3UP9 A;  3I6V A;  4O7I A;  3R7X A;  4EXL A;  5EQ8 A;  1BK4 A;  1OVB A;  2DWI A;  4P1L A;  4THI A;  4N6P A;  1ZLQ A;  1URD A;  4U4X A;  2OWT A;  1MXU A;  1IMC A;  1MG1 A;  2I0C A;  3KSX A;  1P1U A;  1A99 A;  4YMB A;  1B6H A;  2M8C A;  3DEL B;  1LBX A;  4F29 A;  4PAF A;  3ZKL A;  4IY6 A;  2Q74 A;  4G68 B;  3TDJ A;  1JVY A;  5KDT B;  1UTB B;  3G3G A;  3LV0 A;  1H45 A;  3TTK A;  2DWJ A;  3CIJ A;  4I9D A;  3TFL A;  3ODB A;  4MNC A;  3KN3 A;  4L17 A;  1MY3 A;  3D4C A;  4NF5 B;  2O51 A;  4IO6 A;  5TPA B;  3PPR A;  3IL1 B;  1EYI A;  3CFL A;  5DW8 A;  2QFL A;  1JEU A;  4NHB A;  4OFJ A;  3B7D A;  4BDM A;  3T66 A;  4FAT A;  3VXB A;  2H98 A;  1DCU A;  4FBP A;  3G3K A;  3O28 A;  5F7V A;  3WAF A;  1B32 A;  3MVY A;  1DSN A;  4ZDM A;  4HW8 A;  2HQ0 A;  4OER A;  4MNI A;  1WOD A;  2QMX A;  4IGT A;  3MPL A;  3BFT A;  1B5J A;  3OSR A;  3VLV A;  1H76 A;  2F6G A;  1DBZ A;  4PFR A;  5ELV A;  2P3V A;  4DDD A;  2ZZX A;  3QSL A;  3CSB A;  3SES A;  1LST A;  5ET8 A;  3RT6 B;  1MQJ A;  1FQE A;  5KDT A;  2P0S A;  4G77 A;  3SET A;  1PEB A;  4PET A;  4AS5 A;  4R9G A;  1L5T A;  3S4U A;  3SEU A;  3T96 B;  4ZS9 A;  1ZU0 A;  2DE4 A;  2E0S A;  2AYS A;  5AA4 A;  1ZKB A;  2B4L A;  2XXQ A;  2XD2 A;  3RY3 A;  3UOR A;  1Y1Z A;  4X9T A;  2REG A;  1NUZ A;  3CVG A;  3UA8 A;  4AS4 A;  1FCK A;  2Y5K A;  3MWB A;  3H4Z A;  3A3C A;  4P47 A;  2UYF A;  2CEY A;  2H25 A;  3FJM A;  3O97 A;  1SW5 A;  5AE4 A;  1MDQ A;  1FPB A;  3U72 A;  1H43 A;  2IEE A;  2VPO A;  3MZB A;  4LUB A;  4FEB A;  1FTA A;  1HSJ A;  3VVF A;  3G7W A;  4JB7 A;  2FIX A;  1B51 A;  1P1O A;  1N7W A;  4JSD A;  2WBB A;  3G3H A;  1FPL A;  3KBR A;  4AQ4 A;  1OVT A;  2KLF A;  2MKZ A;  3E78 A;  5DVF A;  3SER A;  1IMB A;  1D9Q A;  1FBD A;  1WDN A;  4R75 A;  3BBR A;  4G8H A;  2YJP A;  4JVI A;  1Y9U A;  1FPG A;  2QVV A;  2O7I A;  3U1O A;  5ESY A;  4H8I A;  1IMF A;  4NN3 A;  3MYU A;  2NUV A;  1JET A;  5EHS A;  5CMK A;  1AL3 A;  2RCB A;  4YU0 A;  1VDW A;  2QS2 A;  5EHM A;  1RDY A;  2B65 A;  1FQA A;  2QJE A;  3A3U A;  5AA2 D;  5LOM A;  2VP1 A;  4HE1 A;  1YYZ A;  2PT1 A;  1DOT A;  2DOJ A;  4OQO A;  1FW0 A;  3RT8 A;  2FIE A;  1PB7 A;  3V83 A;  1A8E A;  2ZYK A;  3O29 A;  2ZNS A;  4LZ5 A;  4H65 A;  1PC3 A;  3PMX A;  2NWJ A;  2O7U A;  1LBY A;  1JEV A;  4YIC A;  2PT2 A;  4R73 A;  4FOR A;  1BIY A;  2XWI A;  1OLA A;  1NL5 A;  1DPP A;  3HO7 A;  5DEX A;  4PE3 A;  2HXR A;  2V84 A;  3S2V A;  5JTY B;  2F7B A;  2F36 A;  1MQI A;  4NG7 A;  4KYE A;  2HZK A;  5IGA A;  1JQF A;  3H03 A;  3MZ1 A;  4I3E A;  3CG3 A;  2QL3 A;  3V5A A;  3LBS A;  4FJP A;  5DT6 A;  4IO7 A;  1RYX A;  3PPO A;  1P1N A;  3BIH A;  4R6K A;  5KCJ B;  1O64 A;  2I58 A;  2Z23 A;  1IXC A;  4GWZ A;  1FJ9 A;  3R6U A;  3IAZ A;  5CRY A;  5KZT A;  3FXU A;  1MY1 A;  3ONM A;  5EQ9 A;  5HBC A;  4U1O A;  1TXF A;  4ELP A;  2WBD A;  3K2D A;  2FA7 A;  1MDP 1;  2P2A A;  5DEX B;  1JVX A;  4P56 A;  1MS7 A;  4OAN A;  2Q9T A;  2OCU A;  1OLC A;  4NF8 B;  3U65 A;  3K01 A;  2XXK A;  3UIF A;  4OZ9 A;  4H46 A;  1NV1 A;  1MXX A;  2QRY A;  2Y7K A;  3EKI A;  1RYO A;  1LFH A;  3G3J A;  1JW1 A;  1MM6 A;  2F3B A;  3SEV A;  1RDZ A;  1B58 A;  4DZ1 A;  4PTK A;  4RK9 A;  1FSA A;  4ZZA A;  4GQO A;  4TQU Q;  5HPQ A;  1F9B A;  1KA0 A;  3MBP A;  5FHO A;  2DP8 A;  1YCJ A;  4R6H A;  4GF8 A;  4LN5 A;  2OZZ A;  3H6T A;  1MPB A;  1ZMG A;  4ELR A;  1VE4 A;  4I1D A;  3EQ1 A;  3KEI A;  4PE5 B;  1POT A;  3C34 A;  4GWU A;  1LFG A;  4EQB A;  3PD8 A;  3OEM A;  4XKP A;  4QFP A;  1FPJ A;  1NI9 A;  2UVG A;  1I6A A;  1FQD A;  2XXW A;  2RKM A;  1MRP A;  1P1Q A;  2YLN A;  2H9B A;  1FTM A;  4WKM A;  2OWS A;  4XIG Q;  5F1Q A;  1LAF E;  2ANJ A;  2G29 A;  4G2Z A;  2ABH A;  2ZYO A;  4P0G A;  4KQP A;  2GRV A;  4RY1 A;  4OET A;  4Q30 B;  1MQG A;  1Y3P A;  4MBP A;  3FAT A;  4BDN A;  5I2N A;  1PBQ A;  1D3K A;  2PYY A;  2VOZ A;  1I69 A;  4GIZ A;  3W9W A;  5JK4 A;  1MH3 A;  4JBZ A;  1B3L A;  1Y20 A;  1FPK A;  1WVJ A;  4R2F A;  4JXI A;  4YB5 A;  1EYJ A;  1XT8 A;  3PU5 A;  4OVR A;  2ZZV A;  3SEW A;  3O66 A;  3TCH A;  2OJT A;  3M3L A;  1QJM A;  3VVE A;  1TT1 A;  3IK6 B;  3N26 A;  1T0K A;  3E9X A;  3KFM A;  4HXV A;  1O7T A;  4MF3 A;  1FPE A;  2CZK A;  5AA2 A;  4O3B A;  2VGQ A;  1LBZ A;  3PTY A;  1IZ1 A;  2WYP A;  2XXT A;  4EDP A;  1NH8 A;  1RKM A;  3O2A A;  1LGB C;  4F19 A;  3CSG A;  4I8C A;  1K9Z A;  5EQ7 A;  2D3I A;  3ILT B;  3T9V A;  1KA1 A;  5I2N B;  3EN3 A;  1OQH A;  3FJ7 A;  4PFB A;  1MXY A;  2H5Y A;  3C35 A;  3MVW A;  4QSC A;  1XVX A;  1KZ8 A;  4ESW A;  4IB2 A;  2XXH A;  4GXA A;  3OEK A;  1B3G A;  4ZEF A;  4XXU A;  5IM2 A;  3C32 A;  1YZ0 A;  3JYR A;  1HSL A;  3C4M A;  3K4U A;  4O3C A;  3JV9 A;  4PF8 A;  2BJI A;  5IZ1 A;  3T22 A;  1USY E;  1P99 A;  4G4P A;  5EQA A;  2CEX A;  3C33 A;  4PDD A;  2VD3 A;  5A5X B;  2F35 A;  1LAH E;  4KI0 E;  1NV7 A;  3DP6 A;  4ONY A;  4HCW A;  3TTL A;  1IME A;  1FBE A;  1FPD A;  1UIV A;  3QUF A;  1DK4 A;  2OX3 A;  2W7Y A;  5EYF A;  3K1N A;  3KBZ A;  4BDR A;  4EUO A;  4GWO A;  3IFA A;  4KPT A;  4OXV A;  4C1U A;  4N4U A;  4YAH X;  5L9M A;  2FBP A;  4X48 A;  5HM4 B;  1A40 A;  2UXA A;  3TYH A;  1UIU A;  5ET7 A;  3EHS A;  1VSO A;  5ICQ A;  4BLA A;  3HHF A;  4ZED A;  4DI4 B;  4PFW A;  3TMG A;  1QGX A;  4LAT A;  5CMC A;  1LEV A;  2Z8F A;  1FBF A;  5L8D A;  1N84 A;  3QYT A;  1M5F A;  4JSO A;  3G3I A;  4OEV A;  4O94 A;  4XEQ A;  1UTH B;  2AIX A;  1JW4 A;  3DP8 A;  3S9E A;  1AWB A;  4O7M A;  5IAI A;  2F7A A;  1M5D A;  3IB2 A;  1MQH A;  1PBP A;  4F3P A;  3FJG A;  1NV2 A;  3O6I A;  2XX8 A;  4GL8 A;  1I6Q A;  3N94 A;  2V25 A;  2XXX A;  3CFX A;  3DP4 A;  4IO4 A;  4OFO A;  5DVJ A;  3KOT A;  1VFE A;  2I48 A;  2CZH A;  1MXV A;  3VV5 A;  5I56 A;  2DVZ A;  2ZZW A;  3C9H A;  4G8N A;  1Y4T A;  1SI0 A;  1M5C A;  5IZ3 A;  1N76 A;  2QS4 A;  2CZI A;  3H7M A;  1J1N A;  5T3J A;  2XWK A;  4KHZ E;  4IGR A;  3RGY A;  3EPE A;  3IO6 A;  2NVU B;  1D4N A;  4JVC A;  4JWO A;  4PQJ A;  5ITO A;  2XXP A;  4OYV A;  4F3G A;  4P3L A;  3TKD A;  2FNC A;  3W9V A;  2ZYM A;  2XXI A;  3C31 A;  3LSW A;  2ALU A;  3Q28 A;  3TTM A;  3FAS A;  4QBA A;  4DCY A;  3HHG A;  1S9T A;  2P3N A;  4RK2 A;  3T0J A;  3BKI B;  3MP6 A;  3KSJ A;  2O1L A;  4LA9 A;  3HST A;  3A29 A;  1A54 A;  5J16 A;  3GBB A;  4NE4 A;  3HV1 A;  4MJO A;  3IB0 A;  1SW1 A;  4WEP A;  3U8Q A;  1EU8 A;  2A5T A;  1MXZ A;  2DDK A;  4QFN A;  5H8F B;  3FXR A;  3MC2 A;  4OVT A;  2PVU A;  2GH9 A;  2HCA A;  4P8B A;  2WEF A;  4ND9 A;  1B4H A;  4UAB A;  1IUD A;  1JNF A;  3RLF E;  4DIG A;  5H8F A;  3UN6 A;  3LUZ A;  1PB8 A;  4HS7 A;  5CM6 A;  2QVR A;  2YPN A;  4GX6 A;  4OFL A;  1A7L A;  3KOS A;  5BWJ A;  3OEL A;  3S9L C;  4R72 A;  4NGU A;  4POW A;  4HCY A;  4N07 A;  3RUM A;  1EZO A;  4EF1 A;  3OO8 A;  1RDX A;  1DPE A;  3K0V A;  2X26 A;  1B9J A;  2XHD A;  3KJT A;  4IY5 A;  4X8R A;  1TFD A;  1NV5 A;  3M8U A;  3B50 A;  4EQ9 A;  1Z7N E;  4KFQ A;  2O84 X;  4ZEC A;  3B6Q A;  3RYD A;  1ZBM A;  3L6H A;  4GWY A;  4PBQ A;  2F34 A;  4DE8 A;  1UTB A;  2ONK E;  2R71 A;  4G68 A;  3MST A;  3MP1 A;  4XTC Q;  2HAU A;  4Q5T A;  5I56 B;  2DWH A;  1OIB A;  1LB8 A;  3MVX A;  1O63 A;  3IOU A;  1B0H A;  4QXD A;  2Y7I A;  4H8J A;  2PFY A;  1SVX B;  2XX7 A;  3UGW A;  2RC8 A;  5DVI A;  3HFU A;  1OMP A;  4P9K A;  5KCJ A;  2ONR A;  4TLM B;  3ZSF A;  5B70 A;  2UYE A;  1FQB A;  1USY H;  3RPW A;  3SKP A;  3QMF A;  5I58 B;  1B7U A;  1ELJ A;  3R26 A;  1NNK A;  1SW2 A;  1AMF A;  4U23 A;  3P7I A;  3SEX A;  4K3F A;  1NNF A;  4F3B A;  3M3K A;  4JWX A;  4KXP A;  4LQ2 A;  5I2K A;  1US5 A;  3EHU A;  1YTV A;  3HN0 A;  4GWX A;  5TP9 A;  3RQT A;  3T93 B;  2XXV A;  2QS3 A;  1POY 1;  1MPC A;  4Q0C A;  3VLU A;  1FTO A;  4MHF A;  3WAE A;  4PGN A;  1Q1K A;  3K6X A;  2UVJ A;  3W15 C;  4FAJ A;  3AXF A;  3F11 A;  2O69 A;  5H8H B;  4GD5 A;  2NOO A;  2Z8D A;  2UVI A;  3OOA A;  2F78 A;  2GHA A;  4GBV A;  3TTN A;  4KCC A;  5ICT A;  2A5T B;  5DYH A;  4F22 A;  2WYK A;  3FZV A;  1FTL A;  4ZEB A;  1MPD A;  1XC1 A;  4ZEI A;  2ZNT A;  1B3F A;  5I59 B;  1B46 A;  2OK2 A;  4OVP A;  4E0X A;  3D4G A;  2Q2A A;  5EYG A;  2VPN A;  3T9H B;  4OHN A;  4M4G A;  4N91 A;  3S9M C;  3VFJ A;  3IOW A;  1SPI A;  3K02 A;  4G61 A;  1D9V A;  4MAG A;  1S50 A;  4H5F A;  5I59 A;  1SW4 A;  4R74 A;  1A55 A;  5K2X A;  1B05 A;  3LSF B;  5LTC A;  3QXM A;  3TCF A;  1B4Z A;  2E1S A;  4N13 A;  2G93 A;  2I3V A;  3K6V A;  2VT5 A;  1TFA A;  4IO2 A;  4PAK A;  5I84 A;  5FBP A;  2QS1 A;  1LB9 A;  4E0W A;  4PDH A;  3TOD A;  3OO6 A;  3IJX B;  2HXW A;  3I5O A;  4QHQ A;  2GHB A;  4NF6 B;  2I3W A;  4PF6 A;  4DXB A;  4PFI A;  3LC8 A;  3VVD A;  2ZYN A;  3SZP A;  3FVO A;  5CBS A;  2F3D A;  3B6T A;  1QKA A;  2WKY A;  2PFZ A;  1EZP A;  1NUY A;  1XS5 A;  2Q88 A;  4OVS A;  4MNP A;  1B7Z A;  4PCD A;  3B6W A;  2XXU A;  4HE2 A;  5H8N B;  1R9Q A;  2Z22 A;  5I5P A;  2I4B A;  1TWY A;  3HPI A;  2V3Q A;  4AB6 A;  4F31 B;  5DTB A;  2R9J A;  4UAC A;  5BUU A;  2ZNU A;  4KYD A;  1R9L A;  3FD3 A;  2ZXT A;  1IQ7 A;  1QUI A;  2QSX A;  4ISU A;  4NWC A;  5K2Y A;  1AOV A;  2CZL A;  5TU0 A;  1B52 A;  2XXY A;  2XA5 A;  3IR1 A;  3DM0 A;  3TZA A;  4ESX A;  4H1X A;  4BDO A;  3TAJ A;  3TEP A;  3USD A;  4MX6 A;  1NUX A;  4MFI A;  3PUY E;  2DQV A;  4F2Q A;  1PDA A;  4DXU A;  3GBA A;  2DS9 A;  3O6G A;  1B1X A;  3PUV E;  5CMM A;  2Q89 A;  2NXO A;  4ELQ A;  3MP8 A;  1SYI A;  3I3V A;  1AH5 A;  5CC2 A;  3MW0 A;  4GXS B;  1N7X A;  1UQW A;  1Z7M E;  2PCR A; 
#chains in the Genus database with same CATH homology
 1FQF A;  4G8M A;  3N94 A;  2V25 A;  4F18 A;  4OEN A;  1FQA A;  2QJE A;  3A3U A;  2Y7R A;  4ZE8 A;  5TP9 B;  4HW8 A;  2QMW A;  5AA2 D;  2XXX A;  2HFB A;  3ZKK A;  2VP1 A;  2QPQ A;  3MZ9 A;  5LOM A;  4PP0 A;  3V89 B;  3CFX A;  4F2O A;  5I2K B;  3V8X B;  4U2R A;  4YB7 A;  2PT1 A;  1DOT A;  2DOJ A;  3MUQ A;  2RCA A;  2RF1 A;  3ECR A;  3G3F A;  3DP4 A;  3PD9 A;  1UTH A;  4H5G A;  4IO4 A;  4OQO A;  4BDL A;  1FW0 A;  4OMB A;  3IX1 A;  3TQW A;  2UVH A;  5M2V A;  3U93 A;  4OFO A;  3RT8 A;  5CMB A;  4M1V A;  1Y3N A;  3JZJ A;  4Q8R A;  5DVJ A;  3TEL A;  1PB7 A;  3KOT A;  3N6U A;  3RN8 A;  1SD3 A;  1VFE A;  2I48 A;  3CFZ A;  3EHT A;  1MXV A;  4G68 C;  3SEY A;  3TQL A;  3U92 A;  3VV5 A;  3V83 A;  4F1U A;  1A8E A;  2ZYK A;  2F97 A;  4R2B A;  1DTZ A;  5I56 A;  1FQC A;  1LFI A;  1VFD A;  2DVZ A;  2ZNS A;  3O29 A;  3OO7 A;  4FEC A;  4LZ5 A;  4H65 A;  1R6Z A;  5J1D A;  5ITP A;  1PC3 A;  4JWY A;  3PMX A;  2NWJ A;  3C9H A;  3IOR A;  4G8N A;  2O7U A;  1IXH A;  1JEV A;  1Y4T A;  2DXY A;  4NED A;  4YIC A;  2PT2 A;  1SI0 A;  3MPK A;  1M5C A;  4LZ8 A;  4R73 A;  3IOV A;  1IEJ A;  1LCF A;  1N76 A;  4FOR A;  1BIY A;  4P0I A;  5L9S A;  1AIV A;  2QS4 A;  1OLA A;  1NL5 A;  4EXK A;  1DPP A;  3HO7 A;  3LSX A;  3H7M A;  4XKR A;  5DEX A;  1J1N A;  4KHZ E;  4IGR A;  1MM7 A;  1Q35 A;  3RGY A;  3CRB A;  3EPE A;  3IO6 A;  2V84 A;  1D4N A;  3PMW A;  3PUW E;  4GFR A;  4JWO A;  2NVU B;  3S2V A;  1N3W A;  2DSF A;  4PQJ A;  5JTY B;  1MY2 A;  4NF4 B;  2V3U A;  5ITO A;  3MAM A;  2XXP A;  2F7B A;  2F36 A;  4OYV A;  3PV0 E;  4RXL A;  4KCD A;  1SDX A;  5AA1 A;  1MQI A;  2FNC A;  2O6A A;  2ZYM A;  2XXI A;  3H3G A;  3TKD A;  3W9V A;  4KYE A;  2HZK A;  3U94 A;  3C31 A;  3LSW A;  2ALU A;  3Q28 A;  1JQF A;  1B3E A;  3H03 A;  3FAS A;  3MZ1 A;  2D21 A;  3SDF A;  3THI A;  3TTM A;  1XHY A;  3CG3 A;  1B2H A;  2QL3 A;  3V5A A;  4DCY A;  1SBP A;  3HHG A;  3LBS A;  4FJP A;  4F39 A;  4WED A;  4NF4 A;  2X7P A;  5DT6 A;  3DLN A;  1S9T A;  4IO7 A;  4RK2 A;  5I58 A;  1RYX A;  3VE1 B;  1ANF A;  3PPO A;  2R6G E;  1P1N A;  4F1V A;  3E4R A;  3FVK A;  3BFU A;  3BKI B;  3MP6 A;  3Q26 A;  3KSJ A;  4KR5 A;  4R6K A;  2ZMB A;  5KCJ B;  1O64 A;  5I57 A;  2Q2C A;  2VD2 A;  4H0W A;  2I58 A;  2Z23 A;  4Z0I A;  2O1L A;  4LA9 A;  1IXC A;  3HST A;  2LAO A;  5AA3 A;  1A54 A;  3GBB A;  4NE4 A;  4ECF A;  3PPQ A;  3HV1 A;  3TTR A;  3FV2 A;  3IB0 A;  2P1S A;  4LZ7 A;  1SW1 A;  4WEP A;  4GLI A;  3U8Q A;  3R6U A;  4U22 A;  2O68 A;  5AA4 B;  1EU8 A;  2A5T A;  3IAZ A;  1MXZ A;  5FTI A;  5CRY A;  4NMY A;  1YPN A;  4QFN A;  2PMS A;  5H8F B;  3FXR A;  3FXU A;  5KZT A;  3MC2 A;  1NNP A;  2PVU A;  1URS A;  2GH9 A;  2HCA A;  1MY1 A;  3Q25 A;  3KZG A;  3K1P A;  3ONM A;  1US4 A;  4RYA A;  4ND9 A;  4DXC A;  5HBC A;  1B4H A;  3GZG A;  2OBG A;  4U1O A;  1IUD A;  1JNF A;  1FTK A;  1TXF A;  4ELP A;  3RLF E;  2REJ A;  4KD5 A;  3PMV A;  4DIG A;  4OVJ A;  4IO3 A;  3UN6 A;  3FVN A;  1GVC A;  5H8F A;  3K2D A;  4BDQ A;  2V3T A;  3TPA A;  2FA7 A;  1PB8 A;  1MDP 1;  1NKX A;  3QIM A;  4H6D A;  2B3F A;  4QSD A;  4EF2 A;  5IKB A;  3FXQ A;  2P2A A;  4R6Y A;  5DEX B;  1JVX A;  4HS7 A;  4TLL B;  5CM6 A;  2YPN A;  1MS7 A;  1QVS A;  1A7L A;  4OFL A;  3KOS A;  4F3S A;  5BWJ A;  1CB6 A;  2F7C A;  1NMU A;  2Q9T A;  4YB6 A;  4XKN A;  3OEL A;  3OXN A;  4YKK A;  2OCU A;  2B3B A;  1BP5 A;  1XOC A;  3T9X B;  3IOT A;  3KGC A;  4MLQ A;  4R72 A;  4U4S A;  5JEI A;  3S9L C;  1OLC A;  4NF8 B;  3K01 A;  4POW A;  1B1H A;  5I57 B;  4YMA A;  4HCY A;  4N07 A;  5L9O A;  4UA8 A;  3CG1 A;  3RUM A;  3S9M C;  3UIF A;  1QW0 A;  3VXC A;  4QFL A;  1EZO A;  4OZ9 A;  2Q8J A;  4YKI A;  4EF1 A;  1LAG E;  3OO8 A;  1IIT A;  1DPE A;  3N5L A;  2I6E A;  3K0V A;  1MXX A;  2QRY A;  1URG A;  2X26 A;  2Y7K A;  5ISU A;  1RYO A;  1B9J A;  1ZTY A;  2XX9 A;  4QSE A;  2XHD A;  3KJT A;  4IY5 A;  1LAX A;  1LFH A;  3G3J A;  2XD3 A;  1JW1 A;  3GLB A;  1MM6 A;  1TFD A;  4LVQ A;  1SI1 A;  4U21 A;  2Y7P A;  1B5H A;  3M8U A;  4EQ9 A;  1ZJL A;  1Z7N E;  4KFQ A;  1DMB A;  1MH4 A;  1R1N A;  5H8Q B;  2O84 X;  3T9U A;  5AA2 B;  5JTY A;  2DWA A;  1B0L A;  3SEV A;  2F8D A;  3VLW A;  3OSQ A;  4GOT A;  4EUO A;  4ZEC A;  2CMO A;  1B58 A;  2D5W A;  3B6Q A;  5H8S A;  3QAX A;  4DZ1 A;  3CR9 A;  4RK9 A;  1JW5 A;  1ZBM A;  3L6H A;  3M3F A;  4ZZA A;  4H67 A;  2F34 A;  4YKJ A;  4DE8 A;  4FE8 A;  4GQO A;  1UTB A;  4TQU Q;  1M5E A;  2ONK E;  1F9B A;  2R71 A;  4G68 A;  5HPQ A;  3OO9 A;  3H6W A;  3FGS A;  4LON B;  4RJZ A;  3MP1 A;  3MBP A;  5FHO A;  4XTC Q;  2DP8 A;  1YCJ A;  4R6H A;  1MY4 A;  1ATG A;  4GF8 A;  2DXR A;  2HAU A;  4Q5T A;  5CI5 A;  1N04 A;  4LQ5 A;  3FUZ A;  2OZZ A;  3E3K A;  3H6T A;  2Y7W A;  1VR5 A;  1MPB A;  1ZMG A;  4DLD A;  4ELR A;  5I56 B;  3E13 X;  1VE4 A;  3IO4 A;  2DWH A;  1OIB A;  4I1D A;  1LB8 A;  2A5S A;  3FVG A;  3MVX A;  3EQ1 A;  4QF9 A;  4R9F A;  3KEI A;  1BKA A;  1O63 A;  3IOU A;  1B0H A;  4PE5 B;  4LP2 B;  3PUZ E;  1GV8 A;  3RTF B;  1FTJ A;  2O1M A;  1H44 A;  5H8H A;  2Y7I A;  4H8J A;  1POT A;  3TCG A;  3C34 A;  1SVX B;  2XX7 A;  3UGW A;  1LFG A;  2RC8 A;  4EQB A;  3PD8 A;  3OEM A;  4KYS A;  3PUX E;  1OMP A;  4MH5 A;  4XKP A;  5DVI A;  4QFP A;  1Y3Q A;  4FIM A;  1KWH A;  2UVG A;  5KCJ A;  3OD7 A;  1I6A A;  1FQD A;  2ONR A;  2XXW A;  4NF6 A;  4TLM B;  2AL5 A;  3I6V A;  3UP9 A;  4RA1 A;  4EXL A;  3R7X A;  3ZSF A;  2RKM A;  5B70 A;  1MRP A;  4IO5 A;  2DWI A;  1OVB A;  1FQB A;  1GTK A;  2UYE A;  1USY H;  3RPW A;  1P1Q A;  3SKP A;  5I58 B;  2HAV A;  4DCX A;  1B7U A;  1ELJ A;  4THI A;  3R26 A;  4N6P A;  1ZLQ A;  1NNK A;  1SW2 A;  1URD A;  1AMF A;  2OWT A;  1MXU A;  1MG1 A;  2H9B A;  1FTM A;  2DE2 A;  2I0C A;  2V93 A;  2YLN A;  3P7I A;  4U23 A;  3KSX A;  3IB1 A;  4WKM A;  1B5I A;  4WXJ A;  2ONS A;  1P1U A;  2DVC A;  2OWS A;  1A99 A;  4K3F A;  4OTE A;  4XIG Q;  1NNF A;  5F1Q A;  1Y1M A;  1LAF E;  2AL4 A;  4GVO A;  2ANJ A;  4YMB A;  1B6H A;  4JDF A;  4F3B A;  3MJN A;  3IJO B;  3K6W A;  3M3K A;  2M8C A;  3DEL B;  2G29 A;  4JWX A;  4G2Z A;  1QUL A;  4LQ2 A;  5I2K A;  1XVY A;  1US5 A;  2ABH A;  1YTV A;  3EHU A;  3FIR A;  4F29 A;  2ZYO A;  3O6H A;  3HN0 A;  4P0G A;  4KQP A;  2GRV A;  5TP9 A;  3ZKL A;  4RY1 A;  4IY6 A;  4OET A;  4TOZ A;  4Q30 B;  3RQT A;  1QKB A;  3PPP A;  1JVY A;  1LBB A;  1MQG A;  4G68 B;  1UTB B;  1Y3P A;  3T93 B;  3TDJ A;  4MBP A;  5KDT B;  2XXV A;  2QS3 A;  1POY 1;  1MPC A;  3G3G A;  4Q0C A;  4POX A;  3VLU A;  3Q27 A;  4GRK A;  3FAT A;  1FTO A;  4BDN A;  1B7H A;  2ESN A;  5I2N A;  1H45 A;  3C36 A;  1PBQ A;  3TTK A;  2DWJ A;  4X1B A;  1D3K A;  3WAE A;  2PYY A;  2VOZ A;  3CIJ A;  1II5 A;  1Q1K A;  1I69 A;  3VDF A;  3K6X A;  4GIZ A;  3W9W A;  5JK4 A;  1MH3 A;  3QK6 A;  1MQD A;  4NF8 A;  1Y4C A;  5TPA A;  4JBZ A;  2UVJ A;  3W15 C;  4FAJ A;  3AXF A;  1EZ9 A;  3F11 A;  1IXG A;  4RPN A;  4I9D A;  1B3L A;  1Y20 A;  3TFL A;  4AB5 A;  4F1Y A;  2O69 A;  1WVJ A;  2VHA A;  3ODB A;  4GD5 A;  5H8H B;  4OEU A;  2NOO A;  1N0T A;  3KN3 A;  4L17 A;  4R2F A;  4JXI A;  3LSL A;  1MY3 A;  4YB5 A;  3D4C A;  2Z8D A;  4NF5 B;  3OMB A;  1NH7 A;  1XT8 A;  4RNS A;  2O51 A;  4IO6 A;  5TPA B;  2UVI A;  3OOA A;  3PPR A;  3PU5 A;  3IL1 B;  2I4C A;  2F78 A;  3HCQ A;  2X7Q A;  3SEW A;  3O66 A;  1LCT A;  2GHA A;  3TCH A;  3CFL A;  2XXR A;  4X1D A;  2OJT A;  3TTN A;  3L6G A;  4P11 A;  1JEU A;  3M3L A;  1QJM A;  4KCC A;  5H8N A;  1BTJ A;  3KJ7 A;  4OFJ A;  1SYH A;  3B7D A;  3KN8 A;  3VVE A;  4BDM A;  3T66 A;  1TT1 A;  5B7D A;  5ICT A;  3IK6 B;  2A5T B;  3N26 A;  5DYH A;  4F22 A;  4FAT A;  1T0K A;  4QRZ A;  3TUS A;  3VXB A;  3FZV A;  3E9X A;  2H98 A;  3KFM A;  1IIW A;  1MY0 A;  1FTL A;  1O7T A;  2BJJ X;  1A8F A;  3G3K A;  3MQ9 A;  3H06 B;  3O28 A;  4MF3 A;  4O3A A;  4ZEB A;  1MPD A;  4O3B A;  5AA2 A;  1XC1 A;  4ZEI A;  2ZNT A;  2HZL A;  2PX1 A;  2VGQ A;  1B3F A;  3K00 A;  5F7V A;  3WAF A;  1D9Y A;  5I59 B;  3Q29 A;  1B46 A;  2DE3 A;  2OK2 A;  3FV1 A;  1B40 A;  1B32 A;  3MVY A;  1IZ1 A;  1OQG A;  1DSN A;  2XXT A;  4NTL A;  3D4G A;  4ZDM A;  1BLF A;  2HQ0 A;  4QFK A;  5FTH A;  4E0X A;  2Q2A A;  4OER A;  1WOD A;  4EDP A;  1NH8 A;  1RKM A;  4NWD A;  2QMX A;  3O2A A;  1LGB C;  4IGT A;  3T9H B;  2OLB A;  3MPL A;  4HTG A;  4F19 A;  3CSG A;  4Z7E A;  4I8C A;  4OHN A;  4M4G A;  2IA4 A;  1B5J A;  2RC9 A;  1IXI A;  2D3I A;  3BFT A;  3ILT B;  3SEX A;  3T9V A;  3RTW B;  3IOW A;  3VFJ A;  3OSR A;  3K02 A;  5I2N B;  1I6B A;  1D9V A;  3EN3 A;  3VLV A;  1OQH A;  1H76 A;  1S50 A;  3FJ7 A;  4H5F A;  5I59 A;  1EH3 A;  5CMK A;  1SW4 A;  1MXY A;  4R74 A;  1A55 A;  2H5Y A;  3C35 A;  4FED A;  5K2X A;  3QUJ A;  2F6G A;  1B05 A;  4YKP A;  3MVW A;  3A09 A;  4PFY A;  3LSF B;  5ELV A;  4DDD A;  4QSC A;  2I0B A;  3QSL A;  1XVX A;  3CSB A;  3SES A;  3S9N C;  1LST A;  4ESW A;  4I62 A;  4PFU A;  3RT6 B;  4IB2 A;  1MQJ A;  1LLS A;  2XXH A;  1FQE A;  5FHM A;  5KDT A;  4GXA A;  3OEK A;  3QXM A;  2P0S A;  4G77 A;  3TCF A;  1ZIU A;  1B4Z A;  2E1S A;  1PEB A;  2PBW A;  3SET A;  4N13 A;  4ZEK A;  4PET A;  1CE2 A;  1B3G A;  2G93 A;  1P1W A;  2I3V A;  4R9G A;  1L5T A;  3S4U A;  3SEU A;  3K6V A;  4ZEF A;  4XXU A;  1TFA A;  3C32 A;  4IO2 A;  3T96 B;  5I84 A;  2QS1 A;  1LB9 A;  4ZS9 A;  4E0W A;  1S7Y A;  1ZU0 A;  2DE4 A;  2E0S A;  1HSL A;  3C4M A;  2AYS A;  3JYR A;  3LUY A;  2Z8E A;  3K4U A;  3CI8 A;  2H99 A;  3JV9 A;  3MVZ A;  4O3C A;  3TOD A;  5AA4 A;  3OO6 A;  1ZKB A;  3IJX B;  2HXW A;  3UK4 A;  3I5O A;  4QHQ A;  2GHB A;  5A5X A;  4NF6 B;  1YAE A;  2I3W A;  4DXB A;  3VVD A;  3LC8 A;  1GGG A;  2XXQ A;  2ZYN A;  2XD2 A;  3FVO A;  3RY3 A;  1USY E;  1P99 A;  2F5X A;  3T22 A;  3UOR A;  4G4P A;  5CBS A;  3C33 A;  1Y1Z A;  1MXW A;  3B6T A;  1QKA A;  4X9T A;  2REG A;  4RPO A;  2WKY A;  2VD3 A;  3CVG A;  3UA8 A;  1EZP A;  1FCK A;  3MWB A;  5A5X B;  3H4Z A;  2F35 A;  1LAH E;  3O9P A;  1N3X A;  1NFT A;  1XS5 A;  2Q88 A;  2UYF A;  3A3C A;  3DP6 A;  1QUJ A;  3PGF A;  4KI0 E;  4ONY A;  4EQ7 A;  4U1Z A;  1QUK A;  4HCW A;  3TTL A;  1B7Z A;  2H25 A;  3FJM A;  1UIV A;  3B6W A;  1SW5 A;  2XXU A;  2Y84 A;  3O97 A;  3QUF A;  5H8N B;  1PB9 A;  1R9Q A;  2W7Y A;  2Z22 A;  5AE4 A;  4C0R A;  2I4B A;  1TWY A;  1MDQ A;  5EYF A;  3K1N A;  3HPI A;  2V3Q A;  3RNN A;  3EF7 A;  4AB6 A;  4ZE9 A;  2RIN A;  3U72 A;  1H43 A;  2IEE A;  2R9J A;  4GWO A;  4KPT A;  5DTB A;  4BDR A;  4C1T A;  4UAC A;  3MZB A;  2FYI A;  2I49 A;  2ZNU A;  4KYD A;  1R9L A;  5BUU A;  5CBR A;  3FD3 A;  3LR1 A;  4LUB A;  4FEB A;  4U4X A;  3ZS6 A;  2ZXT A;  4OXV A;  1IQ7 A;  5H8Q A;  1QUI A;  4C1U A;  2QSX A;  1HSJ A;  4ISU A;  4GL0 A;  4YAH X;  3ILU B;  3VVF A;  3G7W A;  1GR2 A;  1H3D A;  4JB7 A;  5L9M A;  3K6U A;  1B51 A;  3N6T A;  4X48 A;  1P1O A;  4ZZE A;  5HM4 B;  1A40 A;  1N7W A;  2UXA A;  4JSD A;  3KN7 A;  4NWC A;  1UIU A;  3TYH A;  3EHS A;  3PPN A;  5K2Y A;  1VSO A;  1AOV A;  2CZL A;  5ICQ A;  1DTG A;  3G3H A;  5TU0 A;  1B52 A;  1LBC A;  3KBR A;  4ELO A;  1HSE A;  4BLA A;  3HHF A;  2XXY A;  4ZED A;  4AQ4 A;  2DYX A;  4PFW A;  1OVT A;  2KLF A;  3TMG A;  2H4I A;  3IR1 A;  3DM0 A;  3KG2 A;  5FHN A;  3TZA A;  4ESX A;  4H1X A;  4LAT A;  4BDO A;  5CMC A;  5DVF A;  3SER A;  2Z8F A;  3TAJ A;  3TEP A;  3USD A;  1WDN A;  4R75 A;  4NF5 A;  3BBR A;  5L8D A;  1N84 A;  4G8H A;  3H6V A;  1M5F A;  3QYT A;  4MFI A;  3PUY E;  2YJP A;  4JSO A;  2DQV A;  3GXA A;  1Y9U A;  1PDA A;  4F2Q A;  4DXU A;  3G3I A;  4F3G A;  3GBA A;  4OEV A;  3H6U A;  4PFT A;  2DS9 A;  3O6G A;  1UTH B;  4QFO A;  1B1X A;  2AIX A;  3U1O A;  2O7I A;  4XKQ A;  3PUV E;  4H8I A;  5CMM A;  3K1M A;  1JW4 A;  2Q89 A;  3DP8 A;  3S9E A;  2NXO A;  4OWD A;  4ELQ A;  2GFE A;  3MP8 A;  1SYI A;  1SQY A;  2RC7 A;  1M5B A;  3I3V A;  2NUV A;  3OEN A;  5IAI A;  2F7A A;  1JET A;  1M5D A;  3IB2 A;  1MQH A;  4YZZ A;  1AH5 A;  5EHS A;  1PBP A;  4F3P A;  1B3H A;  1AL3 A;  4OES A;  5CC2 A;  2RCB A;  3MW0 A;  3FJG A;  4YU0 A;  2HEU A;  4F31 B;  3O6I A;  2THI A;  2XX8 A;  2QS2 A;  1NNT A;  5EHM A;  4MLV A;  4GXS B;  1N7X A;  1UQW A;  1Z7M E;  2F6P A;  4GL8 A;  1I6Q A;  2B65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...