4EQ7A

Structure of atu4243-gaba receptor
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
320
structure length
320
Chain Sequence
NDLVFSSWGGTTQDAQKAAWAEKFMVETGINVLQDGPTDYGKLKAMVEANGVTWDVVDVEGDYAAQAGPKGLLEKLDFSVIDKTKLDPRFVTDYSVGSFYYSFVIGCNVDSVSACPKSWADLFDTAKFPGKRTFYKWSAPGVIEAALLADGVTADKLYPLDLDRAFKKLDTIKSDIIWWSGGAQSQQLIASAEAPFGSVWNGRMTALEQSGVKVETSWAQNITAADSLVVPKGTKNKDAAMKFIALATSAQAQADMATATGYAPVNIESAKLMDPKIAKSLPDQQTESQVNADMNYWAQHRDEIGERWYAWQAKHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter, substrate binding protein (Polyamine)
publication title Structural basis for selective GABA binding in bacterial pathogens.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Transport protein
total genus 98
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4eq7A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4eq7A01
1ZKBA 2F34A 4YB7A 1Q35A 4JDFA 2YLNA 4F3GA 3LC8A 1ELJA 3KN8A 4F19A 2YPNA 4FECA 2PT2A 3K4UA 3FVGA 4LQ5A 4FIMA 1JEVA 4FJPA 2VOZA 4H6DA 3UGWA 3TQWA 3OO8A 3DP4A 3FVNA 3SEYA 3OO9A 1Y4CA 3T96B 3I6VA 1FQFA 2I48A 1N76A 4EQBA 4F1UA 3EHUA 1TFDA 1SW5A 2D3IA 1M5DA 3V83A 2RCAA 4NF6A 4UA8A 4WKMA 3DP6A 1MY0A 1LB9A 5K2YA 1URGA 1I6BA 1M5BA 4HW8A 1BTJA 3PPRA 3AXFA 1NL5A 3IOVA 1SW2A 4G2ZA 4H65A 2I3WA 3KN3A 3TAJA 4DIGA 1ANFA 5M2VA 2I0CA 3PUVE 1IXCA 4I9DA 3IO4A 3S4UA 1BIYA 4AB5A 2I6EA 3SEUA 4F39A 2G93A 2O1LA 3E3KA 4JBZA 1XHYA 3D4CA 3K00A 3KSJA 1UIVA 2QS1A 4U4SA 1A99A 4H5GA 5H8NB 3FATA 2Q2AA 4PP0A 2A5TA 4ZEBA 2RINA 5CBRA 1H43A 4R73A 2UVHA 3VLVA 4G68A 1MDQA 1Z7ME 1RYOA 1SD3A 4P0GA 1O63A 5KCJA 5AA4A 2RF1A 1FQDA 5B7DA 4GIZA 1JETA 4F1VA 1QVSA 2I3VA 2D5WA 4ZEKA 3IX1A 1Y9UA 4OENA 4F29A 4KI0E 2ZYKA 5I2NB 2DVZA 1B58A 1VFDA 3ONMA 1SYHA 3CIJA 1JW4A 2DWIA 3MPKA 3VVDA 5J1DA 4ZS9A 4F2QA 2Y7KA 3KG2A 2PX1A 3RT6B 5I58A 3Q25A 1LCFA 4Q8RA 2QL3A 4QRZA 2YJPA 1Y1MA 3U94A 2O7IA 2R9JA 3HN0A 2KLFA 1URDA 2IEEA 3TTKA 1NKXA 3OEKA 4BLAA 3E4RA 2RC9A 1B5HA 3PUZE 5JTYA 4ELRA 3IOUA 3FIRA 1B3HA 1US4A 2F8DA 2F7BA 3HHGA 3W9VA 1MY4A 1MY3A 4GRKA 4DCYA 3FXQA 2UXAA 1XVYA 1Z7NE 2NUVA 2UYFA 1MPBA 4NF4B 1PB9A 2QMXA 4N13A 3SEXA 2Z22A 4DXCA 2Y84A 4N6PA 5I2KB 2Z8FA 4ND9A 4NF8B 4ZEFA 3M3FA 3EQ1A 1SI1A 4G8MA 4GXSB 4DCXA 1CB6A 2PT1A 2AYSA 2XXTA 4YKJA 2I0BA 4BDQA 3PUYE 2ZNSA 1SI0A 4R2BA 4Q0CA 3IO6A 4QF9A 3PD9A 3RQTA 3OMBA 4MLVA 1IIWA 1I6AA 1O7TA 1J1NA 4NTLA 1Y3NA 4X1DA 4TQUQ 1S50A 1ZJLA 2ONSA 1DPEA 3G3FA 1P1WA 3PD8A 1MS7A 2Q2CA 4LVQA 4OFOA 3UA8A 3MZ1A 4K3FA 3IK6B 3MPLA 1LB8A 3MUQA 4EDPA 4ZE9A 1MH3A 3KJTA 1NFTA 3ECRA 2XXVA 1JNFA 3TCFA 1EU8A 2O1MA 5FHOA 3TTNA 1USYH 1SBPA 5I59B 1DSNA 5H8NA 3GZGA 3H7MA 2DP8A 2H5YA 4LP2B 2V3TA 3G3IA 2XX7A 4H8IA 3RT8A 5KDTB 4IO4A 4IY6A 2V3UA 2XXUA 4F3PA 1ZMGA 4HCYA 3I3VA 3A09A 2OK2A 2I49A 2QMWA 4IB2A 4JWXA 1POTA 4QFPA 5FTIA 4U23A 4OERA 1M5FA 1FQCA 5I2NA 5F7VA 3K1PA 4HCWA 3CFLA 2Z23A 2OZZA 4OETA 4POXA 1Y1ZA 2QSXA 3CVGA 3KOSA 4GL8A 4FAJA 4OEVA 1LSTA 3H6WA 3L6HA 1S9TA 1LFHA 2E0SA 4XKQA 3VVEA 4F22A 2XXQA 4R9GA 3PPQA 4ONYA 5FHMA 2HAVA 3THIA 3TDJA 5AA2B 1MRPA 4GLIA 4LUBA 1R9LA 4YICA 2PVUA 1LAHE 5CM6A 1B5JA 3T9UA 1POY1 2HFBA 3KN7A 3FJMA 3LR1A 3EHSA 4WEDA 1R6ZA 3O9PA 4NF4A 4X9TA 1S7YA 1D4NA 4AB6A 4LZ7A 2ZNTA 2ZXTA 3U1OA 1P99A 2VHAA 4OXVA 1NMUA 4BDRA 1DTZA 1EZ9A 3C4MA 5I2KA 1MQHA 1PEBA 4FATA 4NF8A 5CBSA 5EYFA 3OENA 3TUSA 3U72A 3FV1A 4RYAA 3QXMA 5DTBA 3KOTA 4F18A 4EF1A 2ANJA 2DVCA 3R26A 1US5A 1WDNA 4WXJA 1A40A 1B46A 2XD2A 4JSOA 3U8QA 3VDFA 1B0HA 4JXIA 3GXAA 3IL1B 3MQ9A 3RTFB 1QW0A 2DE2A 3P7IA 2G29A 3K2DA 4R6YA 3B7DA 1NNKA 2F6GA 4BDLA 2ZYOA 4OHNA 3BFTA 2DS9A 1MY1A 1B52A 3ZKKA 1A8FA 3CR9A 1MDP1 4IY5A 4R74A 2B3BA 1GGGA 3LSWA 1BLFA 1I6QA 4H5FA 4BDOA 2THIA 3N5LA 3Q27A 1RKMA 1F9BA 2I4CA 2H25A 2H9BA 5I59A 1VFEA 3N6UA 3G3HA 3VLWA 3FJ7A 5KDTA 2DYXA 1B1XA 1XT8A 1VSOA 1IZ1A 2A5SA 1PBPA 3PV0E 1MQIA 2RC8A 2RKMA 4MLQA 4I8CA 2OBGA 3O29A 1EH3A 3MZ9A 4QFNA 3IAZA 2GRVA 2O69A 1B7HA 3MAMA 3S2VA 3M8UA 3C33A 2ZYNA 3S9NC 3KBRA 4KYDA 1NH7A 4PFTA 3IJXB 4R2FA 3HPIA 1AIVA 3C31A 1QKBA 2ZYMA 4OYVA 1MPCA 1N3WA 4KCCA 1ATGA 1ZBMA 4RK9A 5ICTA 3VXBA 3RPWA 1LGBC 4KYEA 1OLAA 1UQWA 4Q5TA 1SW4A 5AA2A 3MVYA 1EZOA 4QFLA 4NE4A 3T22A 4DXUA 5AA1A 4XIGQ 3ILTB 4THIA 3SESA 2F97A 3UN6A 1R9QA 5HBCA 1MXYA 4M4GA 4YKIA 2D21A 3SKPA 4BDMA 1B05A 4DLDA 1JVYA 1Y20A 2XXIA 1GTKA 5AE4A 1SW1A 3PGFA 2Q8JA 3UK4A 1B51A 3TTRA 3OELA 2RCBA 1N84A 4ELOA 2X26A 4P11A 3H4ZA 1ZTYA 3N94A 1H45A 3K0VA 4YKKA 3FVOA 3O2AA 3SETA 2RC7A 1XS5A 2DWAA 3N6TA 1D9VA 2Y7PA 2F36A 3RTWB 4YB5A 1Y4TA 2O84X 4LZ8A 4IGTA 2F35A 3PUWE 1B1HA 5ICQA 4KPTA 5DYHA 2O6AA 5JEIA 4YZZA 3HCQA 1MXXA 2OCUA 2QRYA 1OLCA 3Q26A 3QUJA 3K6WA 4GQOA 2XXPA 2P0SA 5A5XB 4JB7A 2O7UA 5EHMA 4QFKA 4RXLA 3TMGA 1IXGA 3QYTA 3FASA 3IORA 4IO7A 1WODA 4NF5B 5CMCA 4GXAA 2NVUB 3CG1A 4YU0A 1ZU0A 1IITA 3CSGA 4EXLA 4C0RA 2X7PA 1EZPA 4KYSA 1B4ZA 1P1UA 1B4HA 3GBAA 3U93A 2P2AA 5I56B 1L5TA 1BKAA 3FV2A 4R72A 5DVIA 2QS4A 4ESXA 1O64A 3MP6A 3FZVA 2LAOA 3BKIB 4C1TA 3FXUA 3MW0A 5H8SA 4ELPA 1MY2A 5TP9B 3SERA 2FYIA 1ZIUA 4MBPA 4RPNA 2NOOA 4G8NA 1N7XA 3TYHA 4POWA 1MG1A 5DVJA 5ITOA 2F6PA 5H8QB 3MZBA 3OEMA 1YCJA 1NNPA 1LFGA 3C35A 1QULA 3LBSA 2O51A 1MQJA 4DXBA 1IEJA 1A55A 2F5XA 1H44A 4U1ZA 3KEIA 1Q1KA 4OWDA 3E9XA 1PB8A 1OQHA 3K02A 3VXCA 4F3SA 4R6KA 2V84A 2Q9TA 3ZS6A 3K6VA 4MH5A 1BP5A 4RK2A 1HSJA 2GFEA 3OSQA 4DZ1A 5K2XA 1GV8A 5JK4A 2H4IA 2GHBA 5KZTA 5CMKA 3HHFA 4N07A 3TELA 2XXHA 4OQOA 2PBWA 4FEBA 1OVBA 1OVTA 3K01A 4KFQA 1VR5A 1N04A 1MXWA 1AOVA 2XD3A 2B3FA 1QKAA 2HAUA 1LFIA 4RPOA 2ONRA 2AL4A 3HSTA 2HEUA 2R71A 1VE4A 1CE2A 3MC2A 3IB1A 4L17A 2OLBA 1GR2A 4MF3A 3T93B 4OMBA 1B3FA 3PPPA 3V5AA 1JQFA 5H8FB 3LUYA 5L9SA 1LAFE 3G3JA 4R9FA 3CSBA 1I69A 4TOZA 3H6VA 5H8HB 3T66A 4C1UA 3H3GA 1YTVA 2DWJA 4JWYA 3IOTA 5A5XA 1A8EA 4QHQA 4ECFA 1IXHA 1TWYA 1B7UA 2Q88A 1H76A 2Y7WA 1SQYA 4NF5A 4QSEA 4ZEIA 4PQJA 1UTHB 2XXWA 4MFIA 4I62A 3LSXA 1B5IA 4KQPA 1MQGA 3VV5A 4ZZEA 1FQAA 3OOAA 1YAEA 2IA4A 4G4PA 4QSDA 4ZZAA 4OFLA 3JV9A 3S9MC 1M5EA 2GH9A 5I56A 4X1BA 5AA2D 4E0XA 3O6HA 4LQ2A 3UP9A 1LBBA 3H03A 5TPAB 3H06B 5DEXB 3GBBA 2I58A 5TP9A 3ODBA 2OJTA 1JW5A 2VD2A 4R6HA 4U22A 3TCGA 4GOTA 3C32A 3PMXA 3LSFB 3SDFA 2AL5A 3BBRA 5H8QA 3TQLA 4O3AA 1TFAA 4JWOA 3OO6A 4XKPA 5I57B 4KHZE 4YKPA 4XTCQ 2XX9A 3KGCA 3MWBA 4OEUA 2REGA 1T0KA 4GF8A 2UVIA 2F7CA 5AA3A 4G77A 1B7ZA 2AIXA 3JZJA 3DELB 3G3KA 3KJ7A 3TPAA 2DSFA 4XXUA 2OWSA 5BWJA 3TTMA 3ILUB 3FJGA 1FTLA 1H3DA 2F78A 3A3CA 3HO7A 3CI8A 3T9HB 1PB7A 3A3UA 4PETA 1SYIA 2REJA 3O28A 1MPDA 3U92A 3MJNA 3EF7A 2FA7A 2HQ0A 4EQ9A 1MXUA 4DE8A 3QAXA 5F1QA 4U4XA 1QJMA 1B2HA 3I5OA 4NEDA 2XXYA 4RY1A 3G3GA 3Q28A 1B6HA 4EQ7A 1B9JA 4IGRA 5CI5A 5ELVA 2ZMBA 3MP8A 2PMSA 4ELQA 4ZECA 4IO6A 1QUKA 5H8FA 1ZLQA 4PFYA 1OMPA 4KD5A 4EXKA 4IO5A 3H6TA 4RA1A 3FUZA 5H8HA 3IB0A 1RYXA 2O68A 2Z8DA 3O66A 1MXZA 3IB2A 1XOCA 3DP8A 2H99A 3IR1A 1P1QA 3M3LA 5LOMA 5CMMA 4U1OA 4HS7A 3ZKLA 3W9WA 2UYEA 3Q29A 4P0IA 1UTHA 2V3QA 1USYE 3TTLA 1B3GA 1QUJA 4FE8A 3JYRA 3KZGA 1N0TA 4EUOA 2R6GE 3CFZA 3OO7A 3M3KA 4O3BA 5L9OA 4H0WA 2HCAA 3FVKA 3S9EA 4F3BA 1GVCA 1MH4A 2ZNUA 3SEVA 5TPAA 4Z7EA 5FHNA 3VVFA 3T9XB 5DEXA 4DDDA 1LLSA 3H6UA 1AMFA 5ITPA 3S9LC 3RGYA 2UVGA 2XHDA 1DPPA 4PFUA 4TLMB 4F2OA 3RUMA 3ZSFA 1SVXB 1LAGE 5FTHA 1OIBA 3TCHA 2Z8EA 4GD5A 3MBPA 2QS3A 2V93A 5I57A 2XXXA 4PE5B 4X48A 3O6GA 4R75A 1FTOA 5CMBA 5HM4B 4OZ9A 5CRYA 3SEWA 3B6WA 4ZEDA 1Y3PA 1UTBB 2Y7IA 3TZAA 1D3KA 3E13X 4JSDA 4F1YA 3MVXA 4FEDA 3F11A 3O97A 4OVJA 4LONB 3EN3A 4G8HA 4GWOA 2DE3A 3TKDA 1OQGA 2VP1A 2QJEA 4E0WA 3BFUA 3QK6A 2HZKA 4WEPA 3RLFE 1TT1A 5BUUA 4G68C 3TEPA 1NNFA 4I1DA 5I84A 5B70A 4GVOA 4U21A 4TLLB 3RNNA 2V25A 2CZLA 5IAIA 3CFXA 3HV1A 1LAXA 3USDA 4ZDMA 4OTEA 1HSLA 1MM7A 1FW0A 3PPNA 4EF2A 4U2RA 4NMYA 1MQDA 3O6IA 4KCDA 4GL0A 3QUFA 4NWCA 3QIMA 1PC3A 1URSA 4OESA 4H8JA 1B32A 3D4GA 3G7WA 3EPEA 2E1SA 3B6QA 2PYYA 1B40A 1MM6A 4RNSA 4NWDA 4PFWA 5IKBA 2F7AA 2M8CA 3FGSA 1PDAA 2B65A 2Q89A 4YAHX 1KWHA 1II5A 4RJZA 3TFLA 4XKRA 1Y3QA 2P1SA 3N26A 3VE1B 3V8XB 1P1NA 2DXYA 3UIFA 3CG3A 3TODA 3K6UA 1FQBA 4LZ5A 1N3XA 2ONKE 3EHTA 2XX8A 1N7WA 3OXNA 3C36A 4Z0IA 2CMOA 4AQ4A 3PMVA 4ZE8A 1TXFA 1SDXA 2Y7RA 3IOWA 2DOJA 3RN8A 1JW1A 5DT6A 3C34A 2FNCA 2DXRA 2NXOA 1UIUA 1FTJA 3B6TA 3R7XA 2WKYA 3MVWA 4ISUA 1A54A 4H67A 1FTKA 1WVJA 3L6GA 2HZLA 1JEUA 4NF6B 4BDNA 4YB6A 3UORA 5CC2A 1FQEA 5L8DA 1IXIA 3WAEA 4YMAA 1DOTA 3K6XA 2DQVA 4IO2A 3IJOB 4OFJA 1M5CA 1PBQA 5ISUA 3CRBA 3T9VA 4KR5A 1D9YA 3C9HA 2OWTA 1IUDA 1UTBA 4M1VA 3FXRA 3K1MA 2XXRA 3DLNA 2BJJX 2VD3A 3RY3A 3KFMA 4XKNA 1B3LA 5EHSA 2A5TB 3VFJA 3FD3A 4G68B 4H1XA 1LCTA 1HSEA 5KCJB 5AA4B 1A7LA 2ABHA 4YMBA 1B0LA 4QSCA 1XVXA 3PUXE 3OD7A 2HXWA 3QSLA 1IQ7A 1JVXA 1P1OA 1QUIA 2QPQA 1DMBA 2QS2A 3MVZA 2H98A 4GFRA 2VGQA 4LA9A 3R6UA 4HTGA 2GHAA 5L9MA 3PU5A 1AL3A 3OSRA 5HPQA 5TU0A 2DE4A 5I58B 2I4BA 3KSXA 3PMWA 2X7QA 3V89B 3LSLA 4FORA 1YPNA 2W7YA 3GLBA 4O3CA 4ESWA 4F31B 5DVFA 4LATA 2DWHA 3DM0A 3MP1A 2ESNA 1NH8A 1B3EA 1AH5A 5JTYB 3PPOA 4Q30B 1LBCA 1R1NA 1FTMA 2ALUA 1XC1A 4UACA 4QFOA 1FCKA 3VLUA 1MXVA 2NWJA 1DTGA 1NNTA 3W15C 3WAFA 2UVJA 4IO3A 3K1NA
chains in the Genus database with same CATH superfamily
1ZKBA 2F34A 4YB7A 1Q35A 4JDFA 2YLNA 4F3GA 3LC8A 1FPBA 1ELJA 4XF5A 1DBZA 3KN8A 4F19A 2WBBA 2YPNA 4FECA 2PT2A 3K4UA 3FVGA 4LQ5A 4FIMA 1JEVA 4FJPA 2VOZA 4H6DA 2QVUA 3UGWA 5EQAA 3TQWA 3OO8A 3DP4A 3FVNA 3SEYA 3OO9A 1Y4CA 3T96B 3I6VA 1FQFA 2I48A 1N76A 4EQBA 4F1UA 4JVCA 4OA4A 3EHUA 1TFDA 1SW5A 2D3IA 1RDYA 1M5DA 3V83A 2RCAA 4NX1A 4NF6A 4UA8A 4WKMA 2PCRA 3DP6A 1MY0A 1LB9A 5K2YA 1URGA 1I6BA 1M5BA 4HW8A 1BTJA 3PPRA 3AXFA 1NL5A 3IOVA 1EYJA 1SW2A 4G2ZA 2F3DA 4H65A 1EYKA 2I3WA 3KN3A 3TAJA 4DIGA 1ANFA 4PTKA 5M2VA 2I0CA 2PFZA 3PUVE 3IFCA 1IXCA 4I9DA 3IO4A 3S4UA 1BIYA 4AB5A 2I6EA 3SEUA 4F39A 2FVZA 2G93A 2O1LA 4PGNA 3E3KA 4PDDA 4JBZA 1XHYA 2VPOA 3D4CA 3K00A 3KSJA 1UIVA 2QS1A 4U4SA 1A99A 4H5GA 5IGAA 5H8NB 3FATA 2Q2AA 4GWZA 4PP0A 3B50A 2A5TA 4ZEBA 2RINA 5CBRA 1H43A 4R73A 2UVHA 3VLVA 4G68A 1MDQA 1Z7ME 1RYOA 1SD3A 4P0GA 4FBPA 1O63A 5KCJA 5AA4A 2RF1A 1FQDA 5B7DA 4GIZA 1JETA 4F1VA 1QVSA 2I3VA 2D5WA 3U65A 4ZEKA 1FPKA 3IX1A 1Y9UA 4OENA 4F29A 4KI0E 5IZ1A 2ZYKA 5I2NB 2DVZA 1B58A 1VFDA 1FSAA 3ONMA 1SYHA 4N4UA 3CIJA 1JW4A 2DWIA 3MPKA 3VVDA 5J1DA 4ZS9A 1FPFA 4F2QA 2Y7KA 3KG2A 2PX1A 1LBXA 3RT6B 5I58A 3Q25A 2FIXA 1LCFA 4Q8RA 2QL3A 4QRZA 2YJPA 1Y1MA 3U94A 2O7IA 2R9JA 3HN0A 2KLFA 1URDA 1VDWA 2CEXA 2IEEA 3TTKA 1NKXA 3OEKA 4PF8A 4BLAA 3E4RA 4H46A 2RC9A 1B5HA 3PUZE 5JTYA 4ELRA 3IOUA 4X8RA 3FIRA 1B3HA 4I3EA 1Q9DA 1US4A 2F8DA 2F7BA 1SPIA 3HHGA 3W9VA 1MY4A 1MY3A 4GRKA 4DCYA 3FXQA 2UXAA 1XVYA 5EYGA 1Z7NE 2NUVA 2UYFA 1MPBA 4NF4B 1PB9A 2QMXA 4N13A 4GWSA 3SEXA 2Z22A 5LTCA 4DXCA 1YYZA 2Y84A 4N6PA 5I2KB 2Z8FA 4ND9A 4NF8B 4ZEFA 2ZZVA 3M3FA 3EQ1A 1SI1A 4G8MA 4GXSB 4DCXA 1CB6A 2PT1A 2AYSA 2XXTA 4YKJA 2I0BA 4BDQA 3PUYE 2ZNSA 1SI0A 4R2BA 4Q0CA 3IO6A 2HPGA 4QF9A 3PD9A 4AS4A 3RQTA 3OMBA 4MLVA 5ET7A 1IIWA 1I6AA 1O7TA 1J1NA 4O7MA 4NTLA 1Y3NA 4X1DA 4TQUQ 1S50A 1ZJLA 2ONSA 1DPEA 3G3FA 1P1WA 3PD8A 1MS7A 2Q2CA 1EYIA 4LVQA 4OFOA 3UA8A 3MZ1A 4K3FA 3IK6B 3MPLA 1LB8A 3MUQA 4NHBA 2WYKA 4MNIA 4EDPA 4ZE9A 1MH3A 3KJTA 1NFTA 3ECRA 2XXVA 1JNFA 3TCFA 4MMPA 1EU8A 2O1MA 5FHOA 3TTNA 1USYH 5ET8A 1SBPA 5I59B 1DSNA 3H7MA 3GZGA 5H8NA 2DP8A 4LP2B 2H5YA 3KC0A 2V3TA 2F3BA 5J16A 3G3IA 2XX7A 4H8IA 3RT8A 5KDTB 4IO4A 1FBDA 4IY6A 3RPLB 3KC1A 2V3UA 2XXUA 4F3PA 5DW8A 1ZMGA 4HCYA 3I3VA 3A09A 2OK2A 2I49A 4PF6A 2QMWA 4IB2A 4JWXA 1POTA 1KZ8A 4QFPA 5FTIA 4U23A 4OERA 1M5FA 4AS5A 1FQCA 5I2NA 5F7VA 1FTAA 3K1PA 4HCWA 3CFLA 2Z23A 2OZZA 4OVSA 4MJOA 4OETA 4POXA 1Y1ZA 2QSXA 3CVGA 3KOSA 4GL8A 4FAJA 4QBAA 1K9YA 4OEVA 1LSTA 3H6WA 3L6HA 1S9TA 1LFHA 2E0SA 4XKQA 3VVEA 2CEYA 4F22A 2XXQA 3ROJA 4R9GA 2CZIA 3PPQA 2QVRA 4N8GA 2DDKA 4QXDA 4ONYA 5FHMA 2HAVA 5ESYA 2MKZA 3THIA 3TDJA 1FPEA 5AA2B 1MRPA 4GLIA 4LUBA 4MX6A 1R9LA 4YICA 2PVUA 1LAHE 5CM6A 1B5JA 3T9UA 1POY1 2HFBA 3KN7A 3FJMA 3LR1A 3EHSA 4WEDA 1R6ZA 3O9PA 4NF4A 4X9TA 1S7YA 1D4NA 4AB6A 4O94A 4LZ7A 2ZNTA 4GBWA 2ZXTA 3U1OA 1P99A 2VHAA 4OXVA 1YZ0A 1NMUA 4BDRA 1DTZA 1EZ9A 3C4MA 5I2KA 1MQHA 1PEBA 3FXBA 2Y5LA 4FATA 4NF8A 4LN5A 5CBSA 4UABA 5EYFA 3OENA 3TUSA 3U72A 3LUZA 3FV1A 5I5PA 1CNQA 3D1RA 4RYAA 3QXMA 5DTBA 3KOTA 4F18A 4EF1A 2ANJA 2DVCA 3R26A 1US5A 1WDNA 4WXJA 1A40A 1FRPA 4MAGA 1B46A 2XD2A 4JSOA 3RYDA 3U8QA 3VDFA 1B0HA 4JXIA 3GXAA 4PAFA 3IL1B 3MQ9A 3RTFB 1QW0A 2DE2A 3P7IA 2V4CA 2G29A 3K2DA 4R6YA 3B7DA 1NNKA 2OX3A 2F6GA 4BDLA 4PDHA 2ZYOA 4OHNA 3BFTA 2DS9A 4MNPA 1MY1A 1B52A 3ZKKA 1A8FA 3CR9A 1MDP1 1NUXA 5ET5A 4IY5A 4R74A 2B3BA 1GGGA 3LSWA 1BLFA 1I6QA 4H5FA 4BDOA 2THIA 3N5LA 3Q27A 1RKMA 1F9BA 2I4CA 5EQ8A 2H25A 2H9BA 5I59A 4HE1A 1VFEA 3N6UA 3G3HA 3VLWA 3FJ7A 5KDTA 3RPLA 2DYXA 1B1XA 1XT8A 1VSOA 1IZ1A 4PBQA 2A5SA 1PBPA 3PV0E 2OWZA 1MQIA 2RC8A 2RKMA 4MLQA 4I8CA 2OBGA 3O29A 1EH3A 3MZ9A 4QFNA 3IAZA 1FBHA 2GRVA 2O69A 1B7HA 3MAMA 4H45A 3S2VA 4NQ8A 3M8UA 1FBCA 3C33A 2ZYNA 3S9NC 3KBRA 1IMDA 4KYDA 1NH7A 4PFTA 3IJXB 4R2FA 3HPIA 1AIVA 3C31A 1QKBA 2ZYMA 4N81A 4N6KA 4OYVA 1MPCA 2CZKA 1N3WA 3SZPA 4KCCA 2KQZA 1ATGA 1ZBMA 4RK9A 5ICTA 3VXBA 3RPWA 5EQ9A 1LGBC 4KYEA 3CHGA 1OLAA 1UQWA 4Q5TA 1SW4A 5AA2A 3MVYA 1NV4A 1EZOA 4QFLA 4NE4A 3T22A 4DXUA 1KA1A 5AA1A 3EKIA 4XIGQ 1XI6A 1NI9A 3ILTB 4THIA 3SESA 2F97A 3UN6A 1R9QA 5HBCA 1MXYA 4M4GA 4YKIA 2D21A 3SKPA 4BDMA 1B05A 2XWIA 4DLDA 1JVYA 2WX9A 1Y20A 2XXIA 1GTKA 1SW1A 3PGFA 2Q8JA 5AE4A 3UK4A 1B51A 3TTRA 3OELA 2RCBA 1N84A 4ELOA 2Q74A 2X26A 4P11A 1NV5A 2FHYA 3H4ZA 1JP4A 1ZTYA 2XWOA 3N94A 1H45A 1IMBA 3K0VA 4YKKA 2WYPA 3FVOA 3O2AA 3SETA 2RC7A 1XS5A 2DWAA 3N6TA 1D9VA 1G0HA 2Y7PA 1IMAA 1FPDA 2F36A 1QGXA 4MHFA 3RTWB 2P3NA 4YB5A 1Y4TA 2O84X 4PGPA 4LZ8A 4IGTA 2F35A 3PUWE 1B1HA 2XWVA 5ICQA 4NF0A 4KPTA 2HHMA 5DYHA 2O6AA 5JEIA 4YZZA 3HCQA 1MXXA 2OCUA 1BK4A 2QRYA 3QUJA 1OLCA 1IMEA 3Q26A 4P47A 3K6WA 4I40A 4GQOA 2XXPA 2P0SA 5A5XB 4JB7A 4PAIA 2O7UA 5EHMA 4QFKA 4RXLA 4OVPA 3TMGA 1IXGA 3QYTA 3FASA 3IORA 4IO7A 1WODA 4NF5B 4P3LA 5CMCA 4GXAA 2NVUB 1G0IA 3CG1A 4YU0A 1AWBA 1ZU0A 1IITA 3CSGA 4EXLA 4C0RA 2X7PA 1EZPA 4KYSA 1B4ZA 1P1UA 1B4HA 3GBAA 3U93A 2P2AA 5I56B 1L5TA 1NV2A 1BKAA 3FV2A 4R72A 4XEQA 2QS4A 5DVIA 4ESXA 1O64A 3MP6A 3FZVA 2LAOA 3BKIB 4C1TA 3FXUA 3MW0A 5H8SA 4ELPA 1D9QA 1MY2A 5TP9B 3SERA 2FYIA 1ZIUA 4MBPA 4RPNA 2VT5A 4NGUA 2NOOA 4G8NA 1K9ZA 1N7XA 3TYHA 4POWA 1FBEA 1MG1A 5DVJA 5ITOA 2F6PA 5H8QB 3MZBA 3OEMA 1YCJA 1NNPA 1LFGA 2JJKA 3C35A 1FJ9A 1QULA 2XWKA 3LBSA 2O51A 4DI3D 1MQJA 4DXBA 1IEJA 1A55A 2F5XA 1H44A 3QMFA 4U1ZA 3KEIA 1Q1KA 4OWDA 2ZZXA 3E9XA 1PB8A 1OQHA 3K02A 3VXCA 4F3SA 4R6KA 2V84A 2Q9TA 3ZS6A 3K6VA 4HXVA 1FBPA 4MH5A 1BP5A 4RK2A 4IR8A 1DCUA 1HSJA 3T1BA 2GFEA 4O7IA 3OSQA 4DZ1A 5K2XA 1GV8A 5JK4A 2H4IA 2GHBA 5KZTA 5CMKA 1NV7A 3HHFA 4N07A 3TELA 2XXHA 4OQOA 2PBWA 4FEBA 4PFBA 1NUYA 1OVBA 1OVTA 3K01A 4KFQA 1VR5A 1N04A 1MXWA 1INPA 3PTYA 1AOVA 2XD3A 4P1LA 2B3FA 1QKAA 5IZ3B 2HAUA 1LFIA 4RPOA 1NV3A 2ONRA 2AL4A 3HSTA 2HEUA 2R71A 1VE4A 1CE2A 3MC2A 3IB1A 4L17A 2OLBA 1GR2A 4MF3A 3T93B 4OMBA 1B3FA 2KR0A 3PPPA 1FPJA 3V5AA 4O8MA 1JQFA 2FBPA 5H8FB 1NV0A 3LUYA 2PFYA 2XA5A 4N17A 5L9SA 1LAFE 3G3JA 4R9FA 4OVRA 3CSBA 1I69A 4TOZA 1FPGA 3H6VA 3LV0A 5H8HB 3T66A 4C1UA 3H3GA 1YTVA 2DWJA 4JWYA 3IOTA 5A5XA 1A8EA 4QHQA 4ECFA 3MYUA 1IXHA 1TWYA 1B7UA 3BIGA 2Q88A 1H76A 2Y7WA 1SQYA 4NF5A 4QSEA 4ZEIA 4PQJA 1UTHB 2XXWA 4MFIA 4GWYA 4I62A 3LSXA 1B5IA 4KQPA 1MQGA 3VV5A 4ZZEA 2B4MA 1FQAA 3OOAA 1YAEA 2IA4A 4G4PA 1LBYA 4QSDA 4ZZAA 4OFLA 3JV9A 2P3VA 3S9MC 1M5EA 2GH9A 5I56A 4X1BA 5AA2D 4E0XA 3O6HA 4LQ2A 3UP9A 1LBBA 3IFAA 3H03A 4GWXA 5TPAB 3H06B 5DEXB 3GBBA 1FPLA 2I58A 5TP9A 3ODBA 2OJTA 1JW5A 3NOHA 2VD2A 4R6HA 4U22A 3TCGA 4GOTA 3C32A 3PMXA 3LSFB 3SDFA 2AL5A 3BBRA 5H8QA 3TQLA 4O3AA 2XXKA 1TFAA 4JWOA 3OO6A 4XKPA 5I57B 4KHZE 4YKPA 4XTCQ 2XX9A 3KGCA 5T3JA 3MWBA 4OEUA 2REGA 1T0KA 4GF8A 2UVIA 2F7CA 5AA3A 2FIEA 4G77A 1B7ZA 2AIXA 3JZJA 3DELB 3G3KA 3KJ7A 3TPAA 2DSFA 4XXUA 2OWSA 5BWJA 2WEFA 3TTMA 3ILUB 3FJGA 4GWWA 1FTLA 1H3DA 2F78A 3A3CA 3HO7A 3CI8A 3T9HB 1PB7A 3A3UA 4PETA 1SYIA 2REJA 3O28A 4XFEA 1MPDA 3U92A 3MJNA 4HE0A 4DI4B 4I3YA 3EF7A 2FA7A 2HQ0A 4EQ9A 1MXUA 4PE3A 4DE8A 3QAXA 5F1QA 4U4XA 1QJMA 1B2HA 3I5OA 4NEDA 2XXYA 4RY1A 3G3GA 5IZ3A 3Q28A 1B6HA 4EQ7A 1B9JA 4IGRA 5CI5A 5ELVA 1LBZA 2ZMBA 3MP8A 3MSTA 2PMSA 4ELQA 4ZECA 4IO6A 1QUKA 5H8FA 1ZLQA 3HFUA 4PFYA 2Q8MA 2R8TA 4P1EA 4GX6A 1OMPA 4KD5A 4MIJA 2BJIA 4EXKA 4IO5A 3H6TA 4RA1A 3FUZA 5H8HA 3IB0A 1RYXA 4HE2A 4PFIA 2O68A 2Z8DA 3O66A 1MXZA 3IB2A 5LDZA 1XOCA 3DP8A 2H99A 3IR1A 1P1QA 3M3LA 5LOMA 1DK4A 5CMMA 4U1OA 4HS7A 3ZKLA 1IMCA 3W9WA 2UYEA 3Q29A 4JVIA 4P0IA 1UTHA 2V3QA 1USYE 3TTLA 1B3GA 1QUJA 4FE8A 3JYRA 2HXRA 3KZGA 1N0TA 4EUOA 2R6GE 3CFZA 3OO7A 3M3KA 4O3BA 4JVDA 5L9OA 4OANA 4H0WA 2HCAA 3FVKA 1FBGA 3S9EA 4F3BA 2QFLA 1GVCA 1MH4A 4NN3A 2ZNUA 3SEVA 5TPAA 4Z7EA 5FHNA 3VVFA 3T9XB 5DEXA 4NG7A 4DDDA 1LLSA 3H6UA 1AMFA 5A5LA 5ITPA 3S9LC 3RGYA 2UVGA 2XHDA 1DPPA 4PFUA 4TLMB 4F2OA 3RUMA 3ZSFA 3E78A 1SVXB 2L5VA 1LAGE 5FTHA 1OIBA 3TCHA 2Z8EA 4GD5A 2B4LA 3MBPA 2QS3A 4N15A 1FBFA 2V93A 5I57A 2XXXA 4PE5B 1NUWA 4X48A 3O6GA 4R75A 1FTOA 5CMBA 4NAPA 2Y5KA 5HM4B 4OZ9A 3A29A 5CRYA 3SEWA 3B6WA 4ZEDA 5I3SA 1Y3PA 1UTBB 2Y7IA 4MEVA 3TZAA 1D3KA 3E13X 4JSDA 4F1YA 3MVXA 4FEDA 3F11A 3O97A 5EQ7A 4OVJA 4LONB 3EN3A 4G8HA 4GWOA 2DE3A 3TKDA 1OQGA 2VP1A 2QJEA 4N8YA 4E0WA 3BFUA 3QK6A 1RDXA 2HZKA 4WEPA 3RLFE 4PFRA 1TT1A 5BUUA 4G68C 3TEPA 1NNFA 4I1DA 5I84A 5B70A 4GVOA 4U21A 4TLLB 3RNNA 2V25A 2CZLA 5IAIA 3CFXA 3HV1A 1LAXA 3USDA 4ZDMA 4OTEA 3T0JA 4GWUA 1HSLA 1MM7A 1FW0A 3PPNA 4EF2A 4P56A 4U2RA 4NMYA 5IM2A 5EYHA 3BIHA 1MQDA 3O6IA 4KCDA 4GL0A 3QUFA 4NWCA 3QIMA 1PC3A 1URSA 4OESA 4H8JA 1B32A 3D4GA 3G7WA 3EPEA 2E1SA 4X04A 1RDZA 3B6QA 2PYYA 1B40A 1MM6A 4RNSA 4NWDA 4PFWA 5IKBA 2F7AA 2M8CA 3FGSA 1PDAA 4N6DA 1NV1A 2B65A 2Q89A 4YAHX 1KWHA 1II5A 4RJZA 5F24A 3TFLA 4XKRA 1Y3QA 2P1SA 1LBWA 3N26A 3VE1B 3V8XB 4MNCA 4KXPA 1P1NA 2DXYA 3UIFA 3CG3A 3TODA 3K6UA 2CZHA 1FQBA 4LZ5A 1N3XA 2ONKE 3EHTA 2XX8A 1N7WA 5ET6A 3OXNA 3C36A 4Z0IA 2CMOA 4AQ4A 3PMVA 4ZE8A 1TXFA 1SDXA 2Y7RA 3IOWA 2DOJA 3RN8A 1JW1A 5DT6A 1NUZA 3C34A 4P9KA 2FNCA 2DXRA 2NXOA 1UIUA 1FTJA 3B6TA 3R7XA 2WKYA 3MVWA 4ISUA 1LEVA 1A54A 1FJ6A 4H67A 1FTKA 1WVJA 3L6GA 2HZLA 1JEUA 4NF6B 4BDNA 4YB6A 3UORA 5CC2A 1FQEA 3GYYA 1FPIA 2VPNA 4N91A 5L8DA 2QVVA 1IXIA 3WAEA 4YMAA 1DOTA 3K6XA 2DQVA 4IO2A 4OFJA 3IJOB 1M5CA 4PBHA 1PBQA 5ISUA 3CRBA 3T9VA 4KR5A 1D9YA 4PAKA 3C9HA 2OWTA 1IUDA 1UTBA 1YXIA 4M1VA 3FXRA 3K1MA 2XXRA 3DLNA 2BJJX 3ISPA 3E79A 2VD3A 3RY3A 3KFMA 5FBPA 4XKNA 1B3LA 5EHSA 2A5TB 3VFJA 3FD3A 4G68B 4PC9A 4H1XA 1LCTA 1HSEA 5KCJB 5AA4B 1A7LA 2ABHA 4YMBA 1B0LA 4QSCA 1XVXA 3PUXE 3OD7A 1IMFA 2HXWA 3QSLA 4G61A 1IQ7A 1JVXA 1P1OA 1QUIA 2QPQA 1DMBA 2QS2A 3MVZA 2H98A 4GFRA 2VGQA 4LA9A 3R6UA 4HTGA 2GHAA 3B8BA 4MCOA 5L9MA 3PU5A 2ZZWA 1AL3A 4OVTA 3OSRA 3KBZA 5HPQA 5TU0A 2DE4A 5I58B 2I4BA 3KSXA 3PMWA 1LBVA 2X7QA 3V89B 3LSLA 4FORA 1YPNA 2WBDA 4GBVA 2W7YA 3GLBA 4O3CA 4ESWA 4F31B 4GX3A 5DVFA 4LATA 2DWHA 3FBPA 4PCDA 3DM0A 3MP1A 5IZZA 2ESNA 1NH8A 1B3EA 4P8BA 1AH5A 5JTYB 4GX4A 3PPOA 4Q30B 1LBCA 1R1NA 5I7IA 1NV6A 1FTMA 2ALUA 1XC1A 4UACA 4QFOA 1FCKA 3VLUA 2GQ1A 1MXVA 2NWJA 1DTGA 4OVQA 1NNTA 3W15C 3WAFA 2UVJA 1KA0A 4IO3A 3K1NA
chains in the Genus database with same CATH topology
1ZKBA 2F34A 4YB7A 1Q35A 4JDFA 2YLNA 4F3GA 3LC8A 1ELJA 3KN8A 4F19A 2YPNA 4FECA 2PT2A 3K4UA 3FVGA 4LQ5A 4FIMA 1JEVA 4FJPA 2VOZA 4H6DA 3UGWA 3TQWA 3OO8A 3DP4A 3FVNA 3SEYA 3OO9A 1Y4CA 3T96B 3I6VA 1FQFA 2I48A 1N76A 4EQBA 4F1UA 3EHUA 1TFDA 1SW5A 2D3IA 1M5DA 3V83A 2RCAA 4NF6A 4UA8A 4WKMA 3DP6A 1MY0A 1LB9A 5K2YA 1URGA 1I6BA 1M5BA 4HW8A 1BTJA 3PPRA 3AXFA 1NL5A 3IOVA 1SW2A 4G2ZA 4H65A 2I3WA 3KN3A 3TAJA 4DIGA 1ANFA 5M2VA 2I0CA 3PUVE 1IXCA 4I9DA 3IO4A 3S4UA 1BIYA 4AB5A 2I6EA 3SEUA 4F39A 2G93A 2O1LA 3E3KA 4JBZA 1XHYA 3D4CA 3K00A 3KSJA 1UIVA 2QS1A 4U4SA 1A99A 4H5GA 5H8NB 3FATA 2Q2AA 4PP0A 2A5TA 4ZEBA 2RINA 5CBRA 1H43A 4R73A 2UVHA 3VLVA 4G68A 1MDQA 1Z7ME 1RYOA 1SD3A 4P0GA 1O63A 5KCJA 5AA4A 2RF1A 1FQDA 5B7DA 4GIZA 1JETA 4F1VA 1QVSA 2I3VA 2D5WA 4ZEKA 3IX1A 1Y9UA 4OENA 4F29A 4KI0E 2ZYKA 5I2NB 2DVZA 1B58A 1VFDA 3ONMA 1SYHA 3CIJA 1JW4A 2DWIA 3MPKA 3VVDA 5J1DA 4ZS9A 4F2QA 2Y7KA 3KG2A 2PX1A 3RT6B 5I58A 3Q25A 1LCFA 4Q8RA 2QL3A 4QRZA 2YJPA 1Y1MA 3U94A 2O7IA 2R9JA 3HN0A 2KLFA 1URDA 2IEEA 3TTKA 1NKXA 3OEKA 4BLAA 3E4RA 2RC9A 1B5HA 3PUZE 5JTYA 4ELRA 3IOUA 3FIRA 1B3HA 1US4A 2F8DA 2F7BA 3HHGA 3W9VA 1MY4A 1MY3A 4GRKA 4DCYA 3FXQA 2UXAA 1XVYA 1Z7NE 2NUVA 2UYFA 1MPBA 4NF4B 1PB9A 2QMXA 4N13A 3SEXA 2Z22A 4DXCA 2Y84A 4N6PA 5I2KB 2Z8FA 4ND9A 4NF8B 4ZEFA 3M3FA 3EQ1A 1SI1A 4G8MA 4GXSB 4DCXA 1CB6A 2PT1A 2AYSA 2XXTA 4YKJA 2I0BA 4BDQA 3PUYE 2ZNSA 1SI0A 4R2BA 4Q0CA 3IO6A 4QF9A 3PD9A 3RQTA 3OMBA 4MLVA 1IIWA 1I6AA 1O7TA 1J1NA 4NTLA 1Y3NA 4X1DA 4TQUQ 1S50A 1ZJLA 2ONSA 1DPEA 3G3FA 1P1WA 3PD8A 1MS7A 2Q2CA 4LVQA 4OFOA 3UA8A 3MZ1A 4K3FA 3IK6B 3MPLA 1LB8A 3MUQA 4EDPA 4ZE9A 1MH3A 3KJTA 1NFTA 3ECRA 2XXVA 1JNFA 3TCFA 1EU8A 2O1MA 5FHOA 3TTNA 1USYH 1SBPA 5I59B 1DSNA 5H8NA 3GZGA 3H7MA 2DP8A 2H5YA 4LP2B 2V3TA 3G3IA 2XX7A 4H8IA 3RT8A 5KDTB 4IO4A 4IY6A 2V3UA 2XXUA 4F3PA 1ZMGA 4HCYA 3I3VA 3A09A 2OK2A 2I49A 2QMWA 4IB2A 4JWXA 1POTA 4QFPA 5FTIA 4U23A 4OERA 1M5FA 1FQCA 5I2NA 5F7VA 3K1PA 4HCWA 3CFLA 2Z23A 2OZZA 4OETA 4POXA 1Y1ZA 2QSXA 3CVGA 3KOSA 4GL8A 4FAJA 4OEVA 1LSTA 3H6WA 3L6HA 1S9TA 1LFHA 2E0SA 4XKQA 3VVEA 4F22A 2XXQA 4R9GA 3PPQA 4ONYA 5FHMA 2HAVA 3THIA 3TDJA 5AA2B 1MRPA 4GLIA 4LUBA 1R9LA 4YICA 2PVUA 1LAHE 5CM6A 1B5JA 3T9UA 1POY1 2HFBA 3KN7A 3FJMA 3LR1A 3EHSA 4WEDA 1R6ZA 3O9PA 4NF4A 4X9TA 1S7YA 1D4NA 4AB6A 4LZ7A 2ZNTA 2ZXTA 3U1OA 1P99A 2VHAA 4OXVA 1NMUA 4BDRA 1DTZA 1EZ9A 3C4MA 5I2KA 1MQHA 1PEBA 4FATA 4NF8A 5CBSA 5EYFA 3OENA 3TUSA 3U72A 3FV1A 4RYAA 3QXMA 5DTBA 3KOTA 4F18A 4EF1A 2ANJA 2DVCA 3R26A 1US5A 1WDNA 4WXJA 1A40A 1B46A 2XD2A 4JSOA 3U8QA 3VDFA 1B0HA 4JXIA 3GXAA 3IL1B 3MQ9A 3RTFB 1QW0A 2DE2A 3P7IA 2G29A 3K2DA 4R6YA 3B7DA 1NNKA 2F6GA 4BDLA 2ZYOA 4OHNA 3BFTA 2DS9A 1MY1A 1B52A 3ZKKA 1A8FA 3CR9A 1MDP1 4IY5A 4R74A 2B3BA 1GGGA 3LSWA 1BLFA 1I6QA 4H5FA 4BDOA 2THIA 3N5LA 3Q27A 1RKMA 1F9BA 2I4CA 2H25A 2H9BA 5I59A 1VFEA 3N6UA 3G3HA 3VLWA 3FJ7A 5KDTA 2DYXA 1B1XA 1XT8A 1VSOA 1IZ1A 2A5SA 1PBPA 3PV0E 1MQIA 2RC8A 2RKMA 4MLQA 4I8CA 2OBGA 3O29A 1EH3A 3MZ9A 4QFNA 3IAZA 2GRVA 2O69A 1B7HA 3MAMA 3S2VA 3M8UA 3C33A 2ZYNA 3S9NC 3KBRA 4KYDA 1NH7A 4PFTA 3IJXB 4R2FA 3HPIA 1AIVA 3C31A 1QKBA 2ZYMA 4OYVA 1MPCA 1N3WA 4KCCA 1ATGA 1ZBMA 4RK9A 5ICTA 3VXBA 3RPWA 1LGBC 4KYEA 1OLAA 1UQWA 4Q5TA 1SW4A 5AA2A 3MVYA 1EZOA 4QFLA 4NE4A 3T22A 4DXUA 5AA1A 4XIGQ 3ILTB 4THIA 3SESA 2F97A 3UN6A 1R9QA 5HBCA 1MXYA 4M4GA 4YKIA 2D21A 3SKPA 4BDMA 1B05A 4DLDA 1JVYA 1Y20A 2XXIA 1GTKA 5AE4A 1SW1A 3PGFA 2Q8JA 3UK4A 1B51A 3TTRA 3OELA 2RCBA 1N84A 4ELOA 2X26A 4P11A 3H4ZA 1ZTYA 3N94A 1H45A 3K0VA 4YKKA 3FVOA 3O2AA 3SETA 2RC7A 1XS5A 2DWAA 3N6TA 1D9VA 2Y7PA 2F36A 3RTWB 4YB5A 1Y4TA 2O84X 4LZ8A 4IGTA 2F35A 3PUWE 1B1HA 5ICQA 4KPTA 5DYHA 2O6AA 5JEIA 4YZZA 3HCQA 1MXXA 2OCUA 2QRYA 1OLCA 3Q26A 3QUJA 3K6WA 4GQOA 2XXPA 2P0SA 5A5XB 4JB7A 2O7UA 5EHMA 4QFKA 4RXLA 3TMGA 1IXGA 3QYTA 3FASA 3IORA 4IO7A 1WODA 4NF5B 5CMCA 4GXAA 2NVUB 3CG1A 4YU0A 1ZU0A 1IITA 3CSGA 4EXLA 4C0RA 2X7PA 1EZPA 4KYSA 1B4ZA 1P1UA 1B4HA 3GBAA 3U93A 2P2AA 5I56B 1L5TA 1BKAA 3FV2A 4R72A 5DVIA 2QS4A 4ESXA 1O64A 3MP6A 3FZVA 2LAOA 3BKIB 4C1TA 3FXUA 3MW0A 5H8SA 4ELPA 1MY2A 5TP9B 3SERA 2FYIA 1ZIUA 4MBPA 4RPNA 2NOOA 4G8NA 1N7XA 3TYHA 4POWA 1MG1A 5DVJA 5ITOA 2F6PA 5H8QB 3MZBA 3OEMA 1YCJA 1NNPA 1LFGA 3C35A 1QULA 3LBSA 2O51A 1MQJA 4DXBA 1IEJA 1A55A 2F5XA 1H44A 4U1ZA 3KEIA 1Q1KA 4OWDA 3E9XA 1PB8A 1OQHA 3K02A 3VXCA 4F3SA 4R6KA 2V84A 2Q9TA 3ZS6A 3K6VA 4MH5A 1BP5A 4RK2A 1HSJA 2GFEA 3OSQA 4DZ1A 5K2XA 1GV8A 5JK4A 2H4IA 2GHBA 5KZTA 5CMKA 3HHFA 4N07A 3TELA 2XXHA 4OQOA 2PBWA 4FEBA 1OVBA 1OVTA 3K01A 4KFQA 1VR5A 1N04A 1MXWA 1AOVA 2XD3A 2B3FA 1QKAA 2HAUA 1LFIA 4RPOA 2ONRA 2AL4A 3HSTA 2HEUA 2R71A 1VE4A 1CE2A 3MC2A 3IB1A 4L17A 2OLBA 1GR2A 4MF3A 3T93B 4OMBA 1B3FA 3PPPA 3V5AA 1JQFA 5H8FB 3LUYA 5L9SA 1LAFE 3G3JA 4R9FA 3CSBA 1I69A 4TOZA 3H6VA 5H8HB 3T66A 4C1UA 3H3GA 1YTVA 2DWJA 4JWYA 3IOTA 5A5XA 1A8EA 4QHQA 4ECFA 1IXHA 1TWYA 1B7UA 2Q88A 1H76A 2Y7WA 1SQYA 4NF5A 4QSEA 4ZEIA 4PQJA 1UTHB 2XXWA 4MFIA 4I62A 3LSXA 1B5IA 4KQPA 1MQGA 3VV5A 4ZZEA 1FQAA 3OOAA 1YAEA 2IA4A 4G4PA 4QSDA 4ZZAA 4OFLA 3JV9A 3S9MC 1M5EA 2GH9A 5I56A 4X1BA 5AA2D 4E0XA 3O6HA 4LQ2A 3UP9A 1LBBA 3H03A 5TPAB 3H06B 5DEXB 3GBBA 2I58A 5TP9A 3ODBA 2OJTA 1JW5A 2VD2A 4R6HA 4U22A 3TCGA 4GOTA 3C32A 3PMXA 3LSFB 3SDFA 2AL5A 3BBRA 5H8QA 3TQLA 4O3AA 1TFAA 4JWOA 3OO6A 4XKPA 5I57B 4KHZE 4YKPA 4XTCQ 2XX9A 3KGCA 3MWBA 4OEUA 2REGA 1T0KA 4GF8A 2UVIA 2F7CA 5AA3A 4G77A 1B7ZA 2AIXA 3JZJA 3DELB 3G3KA 3KJ7A 3TPAA 2DSFA 4XXUA 2OWSA 5BWJA 3TTMA 3ILUB 3FJGA 1FTLA 1H3DA 2F78A 3A3CA 3HO7A 3CI8A 3T9HB 1PB7A 3A3UA 4PETA 1SYIA 2REJA 3O28A 1MPDA 3U92A 3MJNA 3EF7A 2FA7A 2HQ0A 4EQ9A 1MXUA 4DE8A 3QAXA 5F1QA 4U4XA 1QJMA 1B2HA 3I5OA 4NEDA 2XXYA 4RY1A 3G3GA 3Q28A 1B6HA 4EQ7A 1B9JA 4IGRA 5CI5A 5ELVA 2ZMBA 3MP8A 2PMSA 4ELQA 4ZECA 4IO6A 1QUKA 5H8FA 1ZLQA 4PFYA 1OMPA 4KD5A 4EXKA 4IO5A 3H6TA 4RA1A 3FUZA 5H8HA 3IB0A 1RYXA 2O68A 2Z8DA 3O66A 1MXZA 3IB2A 1XOCA 3DP8A 2H99A 3IR1A 1P1QA 3M3LA 5LOMA 5CMMA 4U1OA 4HS7A 3ZKLA 3W9WA 2UYEA 3Q29A 4P0IA 1UTHA 2V3QA 1USYE 3TTLA 1B3GA 1QUJA 4FE8A 3JYRA 3KZGA 1N0TA 4EUOA 2R6GE 3CFZA 3OO7A 3M3KA 4O3BA 5L9OA 4H0WA 2HCAA 3FVKA 3S9EA 4F3BA 1GVCA 1MH4A 2ZNUA 3SEVA 5TPAA 4Z7EA 5FHNA 3VVFA 3T9XB 5DEXA 4DDDA 1LLSA 3H6UA 1AMFA 5ITPA 3S9LC 3RGYA 2UVGA 2XHDA 1DPPA 4PFUA 4TLMB 4F2OA 3RUMA 3ZSFA 1SVXB 1LAGE 5FTHA 1OIBA 3TCHA 2Z8EA 4GD5A 3MBPA 2QS3A 2V93A 5I57A 2XXXA 4PE5B 4X48A 3O6GA 4R75A 1FTOA 5CMBA 5HM4B 4OZ9A 5CRYA 3SEWA 3B6WA 4ZEDA 1Y3PA 1UTBB 2Y7IA 3TZAA 1D3KA 3E13X 4JSDA 4F1YA 3MVXA 4FEDA 3F11A 3O97A 4OVJA 4LONB 3EN3A 4G8HA 4GWOA 2DE3A 3TKDA 1OQGA 2VP1A 2QJEA 4E0WA 3BFUA 3QK6A 2HZKA 4WEPA 3RLFE 1TT1A 5BUUA 4G68C 3TEPA 1NNFA 4I1DA 5I84A 5B70A 4GVOA 4U21A 4TLLB 3RNNA 2V25A 2CZLA 5IAIA 3CFXA 3HV1A 1LAXA 3USDA 4ZDMA 4OTEA 1HSLA 1MM7A 1FW0A 3PPNA 4EF2A 4U2RA 4NMYA 1MQDA 3O6IA 4KCDA 4GL0A 3QUFA 4NWCA 3QIMA 1PC3A 1URSA 4OESA 4H8JA 1B32A 3D4GA 3G7WA 3EPEA 2E1SA 3B6QA 2PYYA 1B40A 1MM6A 4RNSA 4NWDA 4PFWA 5IKBA 2F7AA 2M8CA 3FGSA 1PDAA 2B65A 2Q89A 4YAHX 1KWHA 1II5A 4RJZA 3TFLA 4XKRA 1Y3QA 2P1SA 3N26A 3VE1B 3V8XB 1P1NA 2DXYA 3UIFA 3CG3A 3TODA 3K6UA 1FQBA 4LZ5A 1N3XA 2ONKE 3EHTA 2XX8A 1N7WA 3OXNA 3C36A 4Z0IA 2CMOA 4AQ4A 3PMVA 4ZE8A 1TXFA 1SDXA 2Y7RA 3IOWA 2DOJA 3RN8A 1JW1A 5DT6A 3C34A 2FNCA 2DXRA 2NXOA 1UIUA 1FTJA 3B6TA 3R7XA 2WKYA 3MVWA 4ISUA 1A54A 4H67A 1FTKA 1WVJA 3L6GA 2HZLA 1JEUA 4NF6B 4BDNA 4YB6A 3UORA 5CC2A 1FQEA 5L8DA 1IXIA 3WAEA 4YMAA 1DOTA 3K6XA 2DQVA 4IO2A 3IJOB 4OFJA 1M5CA 1PBQA 5ISUA 3CRBA 3T9VA 4KR5A 1D9YA 3C9HA 2OWTA 1IUDA 1UTBA 4M1VA 3FXRA 3K1MA 2XXRA 3DLNA 2BJJX 2VD3A 3RY3A 3KFMA 4XKNA 1B3LA 5EHSA 2A5TB 3VFJA 3FD3A 4G68B 4H1XA 1LCTA 1HSEA 5KCJB 5AA4B 1A7LA 2ABHA 4YMBA 1B0LA 4QSCA 1XVXA 3PUXE 3OD7A 2HXWA 3QSLA 1IQ7A 1JVXA 1P1OA 1QUIA 2QPQA 1DMBA 2QS2A 3MVZA 2H98A 4GFRA 2VGQA 4LA9A 3R6UA 4HTGA 2GHAA 5L9MA 3PU5A 1AL3A 3OSRA 5HPQA 5TU0A 2DE4A 5I58B 2I4BA 3KSXA 3PMWA 2X7QA 3V89B 3LSLA 4FORA 1YPNA 2W7YA 3GLBA 4O3CA 4ESWA 4F31B 5DVFA 4LATA 2DWHA 3DM0A 3MP1A 2ESNA 1NH8A 1B3EA 1AH5A 5JTYB 3PPOA 4Q30B 1LBCA 1R1NA 1FTMA 2ALUA 1XC1A 4UACA 4QFOA 1FCKA 3VLUA 1MXVA 2NWJA 1DTGA 1NNTA 3W15C 3WAFA 2UVJA 4IO3A 3K1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZKB A;  2F34 A;  4YB7 A;  1Q35 A;  4JDF A;  2YLN A;  4F3G A;  3LC8 A;  1ELJ A;  3KN8 A;  4F19 A;  2YPN A;  4FEC A;  2PT2 A;  3K4U A;  3FVG A;  4LQ5 A;  4FIM A;  1JEV A;  4FJP A;  2VOZ A;  4H6D A;  3UGW A;  3TQW A;  3OO8 A;  3DP4 A;  3FVN A;  3SEY A;  3OO9 A;  1Y4C A;  3T96 B;  3I6V A;  1FQF A;  2I48 A;  1N76 A;  4EQB A;  4F1U A;  3EHU A;  1TFD A;  1SW5 A;  2D3I A;  1M5D A;  3V83 A;  2RCA A;  4NF6 A;  4UA8 A;  4WKM A;  3DP6 A;  1MY0 A;  1LB9 A;  5K2Y A;  1URG A;  1I6B A;  1M5B A;  4HW8 A;  1BTJ A;  3PPR A;  3AXF A;  1NL5 A;  3IOV A;  1SW2 A;  4G2Z A;  4H65 A;  2I3W A;  3KN3 A;  3TAJ A;  4DIG A;  1ANF A;  5M2V A;  2I0C A;  3PUV E;  1IXC A;  4I9D A;  3IO4 A;  3S4U A;  1BIY A;  4AB5 A;  2I6E A;  3SEU A;  4F39 A;  2G93 A;  2O1L A;  3E3K A;  4JBZ A;  1XHY A;  3D4C A;  3K00 A;  3KSJ A;  1UIV A;  2QS1 A;  4U4S A;  1A99 A;  4H5G A;  5H8N B;  3FAT A;  2Q2A A;  4PP0 A;  2A5T A;  4ZEB A;  2RIN A;  5CBR A;  1H43 A;  4R73 A;  2UVH A;  3VLV A;  4G68 A;  1MDQ A;  1Z7M E;  1RYO A;  1SD3 A;  4P0G A;  1O63 A;  5KCJ A;  5AA4 A;  2RF1 A;  1FQD A;  5B7D A;  4GIZ A;  1JET A;  4F1V A;  1QVS A;  2I3V A;  2D5W A;  4ZEK A;  3IX1 A;  1Y9U A;  4OEN A;  4F29 A;  4KI0 E;  2ZYK A;  5I2N B;  2DVZ A;  1B58 A;  1VFD A;  3ONM A;  1SYH A;  3CIJ A;  1JW4 A;  2DWI A;  3MPK A;  3VVD A;  5J1D A;  4ZS9 A;  4F2Q A;  2Y7K A;  3KG2 A;  2PX1 A;  3RT6 B;  5I58 A;  3Q25 A;  1LCF A;  4Q8R A;  2QL3 A;  4QRZ A;  2YJP A;  1Y1M A;  3U94 A;  2O7I A;  2R9J A;  3HN0 A;  2KLF A;  1URD A;  2IEE A;  3TTK A;  1NKX A;  3OEK A;  4BLA A;  3E4R A;  2RC9 A;  1B5H A;  3PUZ E;  5JTY A;  4ELR A;  3IOU A;  3FIR A;  1B3H A;  1US4 A;  2F8D A;  2F7B A;  3HHG A;  3W9V A;  1MY4 A;  1MY3 A;  4GRK A;  4DCY A;  3FXQ A;  2UXA A;  1XVY A;  1Z7N E;  2NUV A;  2UYF A;  1MPB A;  4NF4 B;  1PB9 A;  2QMX A;  4N13 A;  3SEX A;  2Z22 A;  4DXC A;  2Y84 A;  4N6P A;  5I2K B;  2Z8F A;  4ND9 A;  4NF8 B;  4ZEF A;  3M3F A;  3EQ1 A;  1SI1 A;  4G8M A;  4GXS B;  4DCX A;  1CB6 A;  2PT1 A;  2AYS A;  2XXT A;  4YKJ A;  2I0B A;  4BDQ A;  3PUY E;  2ZNS A;  1SI0 A;  4R2B A;  4Q0C A;  3IO6 A;  4QF9 A;  3PD9 A;  3RQT A;  3OMB A;  4MLV A;  1IIW A;  1I6A A;  1O7T A;  1J1N A;  4NTL A;  1Y3N A;  4X1D A;  4TQU Q;  1S50 A;  1ZJL A;  2ONS A;  1DPE A;  3G3F A;  1P1W A;  3PD8 A;  1MS7 A;  2Q2C A;  4LVQ A;  4OFO A;  3UA8 A;  3MZ1 A;  4K3F A;  3IK6 B;  3MPL A;  1LB8 A;  3MUQ A;  4EDP A;  4ZE9 A;  1MH3 A;  3KJT A;  1NFT A;  3ECR A;  2XXV A;  1JNF A;  3TCF A;  1EU8 A;  2O1M A;  5FHO A;  3TTN A;  1USY H;  1SBP A;  5I59 B;  1DSN A;  5H8N A;  3GZG A;  3H7M A;  2DP8 A;  2H5Y A;  4LP2 B;  2V3T A;  3G3I A;  2XX7 A;  4H8I A;  3RT8 A;  5KDT B;  4IO4 A;  4IY6 A;  2V3U A;  2XXU A;  4F3P A;  1ZMG A;  4HCY A;  3I3V A;  3A09 A;  2OK2 A;  2I49 A;  2QMW A;  4IB2 A;  4JWX A;  1POT A;  4QFP A;  5FTI A;  4U23 A;  4OER A;  1M5F A;  1FQC A;  5I2N A;  5F7V A;  3K1P A;  4HCW A;  3CFL A;  2Z23 A;  2OZZ A;  4OET A;  4POX A;  1Y1Z A;  2QSX A;  3CVG A;  3KOS A;  4GL8 A;  4FAJ A;  4OEV A;  1LST A;  3H6W A;  3L6H A;  1S9T A;  1LFH A;  2E0S A;  4XKQ A;  3VVE A;  4F22 A;  2XXQ A;  4R9G A;  3PPQ A;  4ONY A;  5FHM A;  2HAV A;  3THI A;  3TDJ A;  5AA2 B;  1MRP A;  4GLI A;  4LUB A;  1R9L A;  4YIC A;  2PVU A;  1LAH E;  5CM6 A;  1B5J A;  3T9U A;  1POY 1;  2HFB A;  3KN7 A;  3FJM A;  3LR1 A;  3EHS A;  4WED A;  1R6Z A;  3O9P A;  4NF4 A;  4X9T A;  1S7Y A;  1D4N A;  4AB6 A;  4LZ7 A;  2ZNT A;  2ZXT A;  3U1O A;  1P99 A;  2VHA A;  4OXV A;  1NMU A;  4BDR A;  1DTZ A;  1EZ9 A;  3C4M A;  5I2K A;  1MQH A;  1PEB A;  4FAT A;  4NF8 A;  5CBS A;  5EYF A;  3OEN A;  3TUS A;  3U72 A;  3FV1 A;  4RYA A;  3QXM A;  5DTB A;  3KOT A;  4F18 A;  4EF1 A;  2ANJ A;  2DVC A;  3R26 A;  1US5 A;  1WDN A;  4WXJ A;  1A40 A;  1B46 A;  2XD2 A;  4JSO A;  3U8Q A;  3VDF A;  1B0H A;  4JXI A;  3GXA A;  3IL1 B;  3MQ9 A;  3RTF B;  1QW0 A;  2DE2 A;  3P7I A;  2G29 A;  3K2D A;  4R6Y A;  3B7D A;  1NNK A;  2F6G A;  4BDL A;  2ZYO A;  4OHN A;  3BFT A;  2DS9 A;  1MY1 A;  1B52 A;  3ZKK A;  1A8F A;  3CR9 A;  1MDP 1;  4IY5 A;  4R74 A;  2B3B A;  1GGG A;  3LSW A;  1BLF A;  1I6Q A;  4H5F A;  4BDO A;  2THI A;  3N5L A;  3Q27 A;  1RKM A;  1F9B A;  2I4C A;  2H25 A;  2H9B A;  5I59 A;  1VFE A;  3N6U A;  3G3H A;  3VLW A;  3FJ7 A;  5KDT A;  2DYX A;  1B1X A;  1XT8 A;  1VSO A;  1IZ1 A;  2A5S A;  1PBP A;  3PV0 E;  1MQI A;  2RC8 A;  2RKM A;  4MLQ A;  4I8C A;  2OBG A;  3O29 A;  1EH3 A;  3MZ9 A;  4QFN A;  3IAZ A;  2GRV A;  2O69 A;  1B7H A;  3MAM A;  3S2V A;  3M8U A;  3C33 A;  2ZYN A;  3S9N C;  3KBR A;  4KYD A;  1NH7 A;  4PFT A;  3IJX B;  4R2F A;  3HPI A;  1AIV A;  3C31 A;  1QKB A;  2ZYM A;  4OYV A;  1MPC A;  1N3W A;  4KCC A;  1ATG A;  1ZBM A;  4RK9 A;  5ICT A;  3VXB A;  3RPW A;  1LGB C;  4KYE A;  1OLA A;  1UQW A;  4Q5T A;  1SW4 A;  5AA2 A;  3MVY A;  1EZO A;  4QFL A;  4NE4 A;  3T22 A;  4DXU A;  5AA1 A;  4XIG Q;  3ILT B;  4THI A;  3SES A;  2F97 A;  3UN6 A;  1R9Q A;  5HBC A;  1MXY A;  4M4G A;  4YKI A;  2D21 A;  3SKP A;  4BDM A;  1B05 A;  4DLD A;  1JVY A;  1Y20 A;  2XXI A;  1GTK A;  5AE4 A;  1SW1 A;  3PGF A;  2Q8J A;  3UK4 A;  1B51 A;  3TTR A;  3OEL A;  2RCB A;  1N84 A;  4ELO A;  2X26 A;  4P11 A;  3H4Z A;  1ZTY A;  3N94 A;  1H45 A;  3K0V A;  4YKK A;  3FVO A;  3O2A A;  3SET A;  2RC7 A;  1XS5 A;  2DWA A;  3N6T A;  1D9V A;  2Y7P A;  2F36 A;  3RTW B;  4YB5 A;  1Y4T A;  2O84 X;  4LZ8 A;  4IGT A;  2F35 A;  3PUW E;  1B1H A;  5ICQ A;  4KPT A;  5DYH A;  2O6A A;  5JEI A;  4YZZ A;  3HCQ A;  1MXX A;  2OCU A;  2QRY A;  1OLC A;  3Q26 A;  3QUJ A;  3K6W A;  4GQO A;  2XXP A;  2P0S A;  5A5X B;  4JB7 A;  2O7U A;  5EHM A;  4QFK A;  4RXL A;  3TMG A;  1IXG A;  3QYT A;  3FAS A;  3IOR A;  4IO7 A;  1WOD A;  4NF5 B;  5CMC A;  4GXA A;  2NVU B;  3CG1 A;  4YU0 A;  1ZU0 A;  1IIT A;  3CSG A;  4EXL A;  4C0R A;  2X7P A;  1EZP A;  4KYS A;  1B4Z A;  1P1U A;  1B4H A;  3GBA A;  3U93 A;  2P2A A;  5I56 B;  1L5T A;  1BKA A;  3FV2 A;  4R72 A;  5DVI A;  2QS4 A;  4ESX A;  1O64 A;  3MP6 A;  3FZV A;  2LAO A;  3BKI B;  4C1T A;  3FXU A;  3MW0 A;  5H8S A;  4ELP A;  1MY2 A;  5TP9 B;  3SER A;  2FYI A;  1ZIU A;  4MBP A;  4RPN A;  2NOO A;  4G8N A;  1N7X A;  3TYH A;  4POW A;  1MG1 A;  5DVJ A;  5ITO A;  2F6P A;  5H8Q B;  3MZB A;  3OEM A;  1YCJ A;  1NNP A;  1LFG A;  3C35 A;  1QUL A;  3LBS A;  2O51 A;  1MQJ A;  4DXB A;  1IEJ A;  1A55 A;  2F5X A;  1H44 A;  4U1Z A;  3KEI A;  1Q1K A;  4OWD A;  3E9X A;  1PB8 A;  1OQH A;  3K02 A;  3VXC A;  4F3S A;  4R6K A;  2V84 A;  2Q9T A;  3ZS6 A;  3K6V A;  4MH5 A;  1BP5 A;  4RK2 A;  1HSJ A;  2GFE A;  3OSQ A;  4DZ1 A;  5K2X A;  1GV8 A;  5JK4 A;  2H4I A;  2GHB A;  5KZT A;  5CMK A;  3HHF A;  4N07 A;  3TEL A;  2XXH A;  4OQO A;  2PBW A;  4FEB A;  1OVB A;  1OVT A;  3K01 A;  4KFQ A;  1VR5 A;  1N04 A;  1MXW A;  1AOV A;  2XD3 A;  2B3F A;  1QKA A;  2HAU A;  1LFI A;  4RPO A;  2ONR A;  2AL4 A;  3HST A;  2HEU A;  2R71 A;  1VE4 A;  1CE2 A;  3MC2 A;  3IB1 A;  4L17 A;  2OLB A;  1GR2 A;  4MF3 A;  3T93 B;  4OMB A;  1B3F A;  3PPP A;  3V5A A;  1JQF A;  5H8F B;  3LUY A;  5L9S A;  1LAF E;  3G3J A;  4R9F A;  3CSB A;  1I69 A;  4TOZ A;  3H6V A;  5H8H B;  3T66 A;  4C1U A;  3H3G A;  1YTV A;  2DWJ A;  4JWY A;  3IOT A;  5A5X A;  1A8E A;  4QHQ A;  4ECF A;  1IXH A;  1TWY A;  1B7U A;  2Q88 A;  1H76 A;  2Y7W A;  1SQY A;  4NF5 A;  4QSE A;  4ZEI A;  4PQJ A;  1UTH B;  2XXW A;  4MFI A;  4I62 A;  3LSX A;  1B5I A;  4KQP A;  1MQG A;  3VV5 A;  4ZZE A;  1FQA A;  3OOA A;  1YAE A;  2IA4 A;  4G4P A;  4QSD A;  4ZZA A;  4OFL A;  3JV9 A;  3S9M C;  1M5E A;  2GH9 A;  5I56 A;  4X1B A;  5AA2 D;  4E0X A;  3O6H A;  4LQ2 A;  3UP9 A;  1LBB A;  3H03 A;  5TPA B;  3H06 B;  5DEX B;  3GBB A;  2I58 A;  5TP9 A;  3ODB A;  2OJT A;  1JW5 A;  2VD2 A;  4R6H A;  4U22 A;  3TCG A;  4GOT A;  3C32 A;  3PMX A;  3LSF B;  3SDF A;  2AL5 A;  3BBR A;  5H8Q A;  3TQL A;  4O3A A;  1TFA A;  4JWO A;  3OO6 A;  4XKP A;  5I57 B;  4KHZ E;  4YKP A;  4XTC Q;  2XX9 A;  3KGC A;  3MWB A;  4OEU A;  2REG A;  1T0K A;  4GF8 A;  2UVI A;  2F7C A;  5AA3 A;  4G77 A;  1B7Z A;  2AIX A;  3JZJ A;  3DEL B;  3G3K A;  3KJ7 A;  3TPA A;  2DSF A;  4XXU A;  2OWS A;  5BWJ A;  3TTM A;  3ILU B;  3FJG A;  1FTL A;  1H3D A;  2F78 A;  3A3C A;  3HO7 A;  3CI8 A;  3T9H B;  1PB7 A;  3A3U A;  4PET A;  1SYI A;  2REJ A;  3O28 A;  1MPD A;  3U92 A;  3MJN A;  3EF7 A;  2FA7 A;  2HQ0 A;  4EQ9 A;  1MXU A;  4DE8 A;  3QAX A;  5F1Q A;  4U4X A;  1QJM A;  1B2H A;  3I5O A;  4NED A;  2XXY A;  4RY1 A;  3G3G A;  3Q28 A;  1B6H A;  4EQ7 A;  1B9J A;  4IGR A;  5CI5 A;  5ELV A;  2ZMB A;  3MP8 A;  2PMS A;  4ELQ A;  4ZEC A;  4IO6 A;  1QUK A;  5H8F A;  1ZLQ A;  4PFY A;  1OMP A;  4KD5 A;  4EXK A;  4IO5 A;  3H6T A;  4RA1 A;  3FUZ A;  5H8H A;  3IB0 A;  1RYX A;  2O68 A;  2Z8D A;  3O66 A;  1MXZ A;  3IB2 A;  1XOC A;  3DP8 A;  2H99 A;  3IR1 A;  1P1Q A;  3M3L A;  5LOM A;  5CMM A;  4U1O A;  4HS7 A;  3ZKL A;  3W9W A;  2UYE A;  3Q29 A;  4P0I A;  1UTH A;  2V3Q A;  1USY E;  3TTL A;  1B3G A;  1QUJ A;  4FE8 A;  3JYR A;  3KZG A;  1N0T A;  4EUO A;  2R6G E;  3CFZ A;  3OO7 A;  3M3K A;  4O3B A;  5L9O A;  4H0W A;  2HCA A;  3FVK A;  3S9E A;  4F3B A;  1GVC A;  1MH4 A;  2ZNU A;  3SEV A;  5TPA A;  4Z7E A;  5FHN A;  3VVF A;  3T9X B;  5DEX A;  4DDD A;  1LLS A;  3H6U A;  1AMF A;  5ITP A;  3S9L C;  3RGY A;  2UVG A;  2XHD A;  1DPP A;  4PFU A;  4TLM B;  4F2O A;  3RUM A;  3ZSF A;  1SVX B;  1LAG E;  5FTH A;  1OIB A;  3TCH A;  2Z8E A;  4GD5 A;  3MBP A;  2QS3 A;  2V93 A;  5I57 A;  2XXX A;  4PE5 B;  4X48 A;  3O6G A;  4R75 A;  1FTO A;  5CMB A;  5HM4 B;  4OZ9 A;  5CRY A;  3SEW A;  3B6W A;  4ZED A;  1Y3P A;  1UTB B;  2Y7I A;  3TZA A;  1D3K A;  3E13 X;  4JSD A;  4F1Y A;  3MVX A;  4FED A;  3F11 A;  3O97 A;  4OVJ A;  4LON B;  3EN3 A;  4G8H A;  4GWO A;  2DE3 A;  3TKD A;  1OQG A;  2VP1 A;  2QJE A;  4E0W A;  3BFU A;  3QK6 A;  2HZK A;  4WEP A;  3RLF E;  1TT1 A;  5BUU A;  4G68 C;  3TEP A;  1NNF A;  4I1D A;  5I84 A;  5B70 A;  4GVO A;  4U21 A;  4TLL B;  3RNN A;  2V25 A;  2CZL A;  5IAI A;  3CFX A;  3HV1 A;  1LAX A;  3USD A;  4ZDM A;  4OTE A;  1HSL A;  1MM7 A;  1FW0 A;  3PPN A;  4EF2 A;  4U2R A;  4NMY A;  1MQD A;  3O6I A;  4KCD A;  4GL0 A;  3QUF A;  4NWC A;  3QIM A;  1PC3 A;  1URS A;  4OES A;  4H8J A;  1B32 A;  3D4G A;  3G7W A;  3EPE A;  2E1S A;  3B6Q A;  2PYY A;  1B40 A;  1MM6 A;  4RNS A;  4NWD A;  4PFW A;  5IKB A;  2F7A A;  2M8C A;  3FGS A;  1PDA A;  2B65 A;  2Q89 A;  4YAH X;  1KWH A;  1II5 A;  4RJZ A;  3TFL A;  4XKR A;  1Y3Q A;  2P1S A;  3N26 A;  3VE1 B;  3V8X B;  1P1N A;  2DXY A;  3UIF A;  3CG3 A;  3TOD A;  3K6U A;  1FQB A;  4LZ5 A;  1N3X A;  2ONK E;  3EHT A;  2XX8 A;  1N7W A;  3OXN A;  3C36 A;  4Z0I A;  2CMO A;  4AQ4 A;  3PMV A;  4ZE8 A;  1TXF A;  1SDX A;  2Y7R A;  3IOW A;  2DOJ A;  3RN8 A;  1JW1 A;  5DT6 A;  3C34 A;  2FNC A;  2DXR A;  2NXO A;  1UIU A;  1FTJ A;  3B6T A;  3R7X A;  2WKY A;  3MVW A;  4ISU A;  1A54 A;  4H67 A;  1FTK A;  1WVJ A;  3L6G A;  2HZL A;  1JEU A;  4NF6 B;  4BDN A;  4YB6 A;  3UOR A;  5CC2 A;  1FQE A;  5L8D A;  1IXI A;  3WAE A;  4YMA A;  1DOT A;  3K6X A;  2DQV A;  4IO2 A;  3IJO B;  4OFJ A;  1M5C A;  1PBQ A;  5ISU A;  3CRB A;  3T9V A;  4KR5 A;  1D9Y A;  3C9H A;  2OWT A;  1IUD A;  1UTB A;  4M1V A;  3FXR A;  3K1M A;  2XXR A;  3DLN A;  2BJJ X;  2VD3 A;  3RY3 A;  3KFM A;  4XKN A;  1B3L A;  5EHS A;  2A5T B;  3VFJ A;  3FD3 A;  4G68 B;  4H1X A;  1LCT A;  1HSE A;  5KCJ B;  5AA4 B;  1A7L A;  2ABH A;  4YMB A;  1B0L A;  4QSC A;  1XVX A;  3PUX E;  3OD7 A;  2HXW A;  3QSL A;  1IQ7 A;  1JVX A;  1P1O A;  1QUI A;  2QPQ A;  1DMB A;  2QS2 A;  3MVZ A;  2H98 A;  4GFR A;  2VGQ A;  4LA9 A;  3R6U A;  4HTG A;  2GHA A;  5L9M A;  3PU5 A;  1AL3 A;  3OSR A;  5HPQ A;  5TU0 A;  2DE4 A;  5I58 B;  2I4B A;  3KSX A;  3PMW A;  2X7Q A;  3V89 B;  3LSL A;  4FOR A;  1YPN A;  2W7Y A;  3GLB A;  4O3C A;  4ESW A;  4F31 B;  5DVF A;  4LAT A;  2DWH A;  3DM0 A;  3MP1 A;  2ESN A;  1NH8 A;  1B3E A;  1AH5 A;  5JTY B;  3PPO A;  4Q30 B;  1LBC A;  1R1N A;  1FTM A;  2ALU A;  1XC1 A;  4UAC A;  4QFO A;  1FCK A;  3VLU A;  1MXV A;  2NWJ A;  1DTG A;  1NNT A;  3W15 C;  3WAF A;  2UVJ A;  4IO3 A;  3K1N A; 
#chains in the Genus database with same CATH topology
 1ZKB A;  2F34 A;  4YB7 A;  1Q35 A;  4JDF A;  2YLN A;  4F3G A;  3LC8 A;  1FPB A;  1ELJ A;  4XF5 A;  1DBZ A;  3KN8 A;  4F19 A;  2WBB A;  2YPN A;  4FEC A;  2PT2 A;  3K4U A;  3FVG A;  4LQ5 A;  4FIM A;  1JEV A;  4FJP A;  2VOZ A;  4H6D A;  2QVU A;  3UGW A;  5EQA A;  3TQW A;  3OO8 A;  3DP4 A;  3FVN A;  3SEY A;  3OO9 A;  1Y4C A;  3T96 B;  3I6V A;  1FQF A;  2I48 A;  1N76 A;  4EQB A;  4F1U A;  4JVC A;  4OA4 A;  3EHU A;  1TFD A;  1SW5 A;  2D3I A;  1RDY A;  1M5D A;  3V83 A;  2RCA A;  4NX1 A;  4NF6 A;  4UA8 A;  4WKM A;  2PCR A;  3DP6 A;  1MY0 A;  1LB9 A;  5K2Y A;  1URG A;  1I6B A;  1M5B A;  4HW8 A;  1BTJ A;  3PPR A;  3AXF A;  1NL5 A;  3IOV A;  1EYJ A;  1SW2 A;  4G2Z A;  2F3D A;  4H65 A;  1EYK A;  2I3W A;  3KN3 A;  3TAJ A;  4DIG A;  1ANF A;  4PTK A;  5M2V A;  2I0C A;  2PFZ A;  3PUV E;  3IFC A;  1IXC A;  4I9D A;  3IO4 A;  3S4U A;  1BIY A;  4AB5 A;  2I6E A;  3SEU A;  4F39 A;  2FVZ A;  2G93 A;  2O1L A;  4PGN A;  3E3K A;  4PDD A;  4JBZ A;  1XHY A;  2VPO A;  3D4C A;  3K00 A;  3KSJ A;  1UIV A;  2QS1 A;  4U4S A;  1A99 A;  4H5G A;  5IGA A;  5H8N B;  3FAT A;  2Q2A A;  4GWZ A;  4PP0 A;  3B50 A;  2A5T A;  4ZEB A;  2RIN A;  5CBR A;  1H43 A;  4R73 A;  2UVH A;  3VLV A;  4G68 A;  1MDQ A;  1Z7M E;  1RYO A;  1SD3 A;  4P0G A;  4FBP A;  1O63 A;  5KCJ A;  5AA4 A;  2RF1 A;  1FQD A;  5B7D A;  4GIZ A;  1JET A;  4F1V A;  1QVS A;  2I3V A;  2D5W A;  3U65 A;  4ZEK A;  1FPK A;  3IX1 A;  1Y9U A;  4OEN A;  4F29 A;  4KI0 E;  5IZ1 A;  2ZYK A;  5I2N B;  2DVZ A;  1B58 A;  1VFD A;  1FSA A;  3ONM A;  1SYH A;  4N4U A;  3CIJ A;  1JW4 A;  2DWI A;  3MPK A;  3VVD A;  5J1D A;  4ZS9 A;  1FPF A;  4F2Q A;  2Y7K A;  3KG2 A;  2PX1 A;  1LBX A;  3RT6 B;  5I58 A;  3Q25 A;  2FIX A;  1LCF A;  4Q8R A;  2QL3 A;  4QRZ A;  2YJP A;  1Y1M A;  3U94 A;  2O7I A;  2R9J A;  3HN0 A;  2KLF A;  1URD A;  1VDW A;  2CEX A;  2IEE A;  3TTK A;  1NKX A;  3OEK A;  4PF8 A;  4BLA A;  3E4R A;  4H46 A;  2RC9 A;  1B5H A;  3PUZ E;  5JTY A;  4ELR A;  3IOU A;  4X8R A;  3FIR A;  1B3H A;  4I3E A;  1Q9D A;  1US4 A;  2F8D A;  2F7B A;  1SPI A;  3HHG A;  3W9V A;  1MY4 A;  1MY3 A;  4GRK A;  4DCY A;  3FXQ A;  2UXA A;  1XVY A;  5EYG A;  1Z7N E;  2NUV A;  2UYF A;  1MPB A;  4NF4 B;  1PB9 A;  2QMX A;  4N13 A;  4GWS A;  3SEX A;  2Z22 A;  5LTC A;  4DXC A;  1YYZ A;  2Y84 A;  4N6P A;  5I2K B;  2Z8F A;  4ND9 A;  4NF8 B;  4ZEF A;  2ZZV A;  3M3F A;  3EQ1 A;  1SI1 A;  4G8M A;  4GXS B;  4DCX A;  1CB6 A;  2PT1 A;  2AYS A;  2XXT A;  4YKJ A;  2I0B A;  4BDQ A;  3PUY E;  2ZNS A;  1SI0 A;  4R2B A;  4Q0C A;  3IO6 A;  2HPG A;  4QF9 A;  3PD9 A;  4AS4 A;  3RQT A;  3OMB A;  4MLV A;  5ET7 A;  1IIW A;  1I6A A;  1O7T A;  1J1N A;  4O7M A;  4NTL A;  1Y3N A;  4X1D A;  4TQU Q;  1S50 A;  1ZJL A;  2ONS A;  1DPE A;  3G3F A;  1P1W A;  3PD8 A;  1MS7 A;  2Q2C A;  1EYI A;  4LVQ A;  4OFO A;  3UA8 A;  3MZ1 A;  4K3F A;  3IK6 B;  3MPL A;  1LB8 A;  3MUQ A;  4NHB A;  2WYK A;  4MNI A;  4EDP A;  4ZE9 A;  1MH3 A;  3KJT A;  1NFT A;  3ECR A;  2XXV A;  1JNF A;  3TCF A;  4MMP A;  1EU8 A;  2O1M A;  5FHO A;  3TTN A;  1USY H;  5ET8 A;  1SBP A;  5I59 B;  1DSN A;  3H7M A;  3GZG A;  5H8N A;  2DP8 A;  4LP2 B;  2H5Y A;  3KC0 A;  2V3T A;  2F3B A;  5J16 A;  3G3I A;  2XX7 A;  4H8I A;  3RT8 A;  5KDT B;  4IO4 A;  1FBD A;  4IY6 A;  3RPL B;  3KC1 A;  2V3U A;  2XXU A;  4F3P A;  5DW8 A;  1ZMG A;  4HCY A;  3I3V A;  3A09 A;  2OK2 A;  2I49 A;  4PF6 A;  2QMW A;  4IB2 A;  4JWX A;  1POT A;  1KZ8 A;  4QFP A;  5FTI A;  4U23 A;  4OER A;  1M5F A;  4AS5 A;  1FQC A;  5I2N A;  5F7V A;  1FTA A;  3K1P A;  4HCW A;  3CFL A;  2Z23 A;  2OZZ A;  4OVS A;  4MJO A;  4OET A;  4POX A;  1Y1Z A;  2QSX A;  3CVG A;  3KOS A;  4GL8 A;  4FAJ A;  4QBA A;  1K9Y A;  4OEV A;  1LST A;  3H6W A;  3L6H A;  1S9T A;  1LFH A;  2E0S A;  4XKQ A;  3VVE A;  2CEY A;  4F22 A;  2XXQ A;  3ROJ A;  4R9G A;  2CZI A;  3PPQ A;  2QVR A;  4N8G A;  2DDK A;  4QXD A;  4ONY A;  5FHM A;  2HAV A;  5ESY A;  2MKZ A;  3THI A;  3TDJ A;  1FPE A;  5AA2 B;  1MRP A;  4GLI A;  4LUB A;  4MX6 A;  1R9L A;  4YIC A;  2PVU A;  1LAH E;  5CM6 A;  1B5J A;  3T9U A;  1POY 1;  2HFB A;  3KN7 A;  3FJM A;  3LR1 A;  3EHS A;  4WED A;  1R6Z A;  3O9P A;  4NF4 A;  4X9T A;  1S7Y A;  1D4N A;  4AB6 A;  4O94 A;  4LZ7 A;  2ZNT A;  4GBW A;  2ZXT A;  3U1O A;  1P99 A;  2VHA A;  4OXV A;  1YZ0 A;  1NMU A;  4BDR A;  1DTZ A;  1EZ9 A;  3C4M A;  5I2K A;  1MQH A;  1PEB A;  3FXB A;  2Y5L A;  4FAT A;  4NF8 A;  4LN5 A;  5CBS A;  4UAB A;  5EYF A;  3OEN A;  3TUS A;  3U72 A;  3LUZ A;  3FV1 A;  5I5P A;  1CNQ A;  3D1R A;  4RYA A;  3QXM A;  5DTB A;  3KOT A;  4F18 A;  4EF1 A;  2ANJ A;  2DVC A;  3R26 A;  1US5 A;  1WDN A;  4WXJ A;  1A40 A;  1FRP A;  4MAG A;  1B46 A;  2XD2 A;  4JSO A;  3RYD A;  3U8Q A;  3VDF A;  1B0H A;  4JXI A;  3GXA A;  4PAF A;  3IL1 B;  3MQ9 A;  3RTF B;  1QW0 A;  2DE2 A;  3P7I A;  2V4C A;  2G29 A;  3K2D A;  4R6Y A;  3B7D A;  1NNK A;  2OX3 A;  2F6G A;  4BDL A;  4PDH A;  2ZYO A;  4OHN A;  3BFT A;  2DS9 A;  4MNP A;  1MY1 A;  1B52 A;  3ZKK A;  1A8F A;  3CR9 A;  1MDP 1;  1NUX A;  5ET5 A;  4IY5 A;  4R74 A;  2B3B A;  1GGG A;  3LSW A;  1BLF A;  1I6Q A;  4H5F A;  4BDO A;  2THI A;  3N5L A;  3Q27 A;  1RKM A;  1F9B A;  2I4C A;  5EQ8 A;  2H25 A;  2H9B A;  5I59 A;  4HE1 A;  1VFE A;  3N6U A;  3G3H A;  3VLW A;  3FJ7 A;  5KDT A;  3RPL A;  2DYX A;  1B1X A;  1XT8 A;  1VSO A;  1IZ1 A;  4PBQ A;  2A5S A;  1PBP A;  3PV0 E;  2OWZ A;  1MQI A;  2RC8 A;  2RKM A;  4MLQ A;  4I8C A;  2OBG A;  3O29 A;  1EH3 A;  3MZ9 A;  4QFN A;  3IAZ A;  1FBH A;  2GRV A;  2O69 A;  1B7H A;  3MAM A;  4H45 A;  3S2V A;  4NQ8 A;  3M8U A;  1FBC A;  3C33 A;  2ZYN A;  3S9N C;  3KBR A;  1IMD A;  4KYD A;  1NH7 A;  4PFT A;  3IJX B;  4R2F A;  3HPI A;  1AIV A;  3C31 A;  1QKB A;  2ZYM A;  4N81 A;  4N6K A;  4OYV A;  1MPC A;  2CZK A;  1N3W A;  3SZP A;  4KCC A;  2KQZ A;  1ATG A;  1ZBM A;  4RK9 A;  5ICT A;  3VXB A;  3RPW A;  5EQ9 A;  1LGB C;  4KYE A;  3CHG A;  1OLA A;  1UQW A;  4Q5T A;  1SW4 A;  5AA2 A;  3MVY A;  1NV4 A;  1EZO A;  4QFL A;  4NE4 A;  3T22 A;  4DXU A;  1KA1 A;  5AA1 A;  3EKI A;  4XIG Q;  1XI6 A;  1NI9 A;  3ILT B;  4THI A;  3SES A;  2F97 A;  3UN6 A;  1R9Q A;  5HBC A;  1MXY A;  4M4G A;  4YKI A;  2D21 A;  3SKP A;  4BDM A;  1B05 A;  2XWI A;  4DLD A;  1JVY A;  2WX9 A;  1Y20 A;  2XXI A;  1GTK A;  1SW1 A;  3PGF A;  2Q8J A;  5AE4 A;  3UK4 A;  1B51 A;  3TTR A;  3OEL A;  2RCB A;  1N84 A;  4ELO A;  2Q74 A;  2X26 A;  4P11 A;  1NV5 A;  2FHY A;  3H4Z A;  1JP4 A;  1ZTY A;  2XWO A;  3N94 A;  1H45 A;  1IMB A;  3K0V A;  4YKK A;  2WYP A;  3FVO A;  3O2A A;  3SET A;  2RC7 A;  1XS5 A;  2DWA A;  3N6T A;  1D9V A;  1G0H A;  2Y7P A;  1IMA A;  1FPD A;  2F36 A;  1QGX A;  4MHF A;  3RTW B;  2P3N A;  4YB5 A;  1Y4T A;  2O84 X;  4PGP A;  4LZ8 A;  4IGT A;  2F35 A;  3PUW E;  1B1H A;  2XWV A;  5ICQ A;  4NF0 A;  4KPT A;  2HHM A;  5DYH A;  2O6A A;  5JEI A;  4YZZ A;  3HCQ A;  1MXX A;  2OCU A;  1BK4 A;  2QRY A;  3QUJ A;  1OLC A;  1IME A;  3Q26 A;  4P47 A;  3K6W A;  4I40 A;  4GQO A;  2XXP A;  2P0S A;  5A5X B;  4JB7 A;  4PAI A;  2O7U A;  5EHM A;  4QFK A;  4RXL A;  4OVP A;  3TMG A;  1IXG A;  3QYT A;  3FAS A;  3IOR A;  4IO7 A;  1WOD A;  4NF5 B;  4P3L A;  5CMC A;  4GXA A;  2NVU B;  1G0I A;  3CG1 A;  4YU0 A;  1AWB A;  1ZU0 A;  1IIT A;  3CSG A;  4EXL A;  4C0R A;  2X7P A;  1EZP A;  4KYS A;  1B4Z A;  1P1U A;  1B4H A;  3GBA A;  3U93 A;  2P2A A;  5I56 B;  1L5T A;  1NV2 A;  1BKA A;  3FV2 A;  4R72 A;  4XEQ A;  2QS4 A;  5DVI A;  4ESX A;  1O64 A;  3MP6 A;  3FZV A;  2LAO A;  3BKI B;  4C1T A;  3FXU A;  3MW0 A;  5H8S A;  4ELP A;  1D9Q A;  1MY2 A;  5TP9 B;  3SER A;  2FYI A;  1ZIU A;  4MBP A;  4RPN A;  2VT5 A;  4NGU A;  2NOO A;  4G8N A;  1K9Z A;  1N7X A;  3TYH A;  4POW A;  1FBE A;  1MG1 A;  5DVJ A;  5ITO A;  2F6P A;  5H8Q B;  3MZB A;  3OEM A;  1YCJ A;  1NNP A;  1LFG A;  2JJK A;  3C35 A;  1FJ9 A;  1QUL A;  2XWK A;  3LBS A;  2O51 A;  4DI3 D;  1MQJ A;  4DXB A;  1IEJ A;  1A55 A;  2F5X A;  1H44 A;  3QMF A;  4U1Z A;  3KEI A;  1Q1K A;  4OWD A;  2ZZX A;  3E9X A;  1PB8 A;  1OQH A;  3K02 A;  3VXC A;  4F3S A;  4R6K A;  2V84 A;  2Q9T A;  3ZS6 A;  3K6V A;  4HXV A;  1FBP A;  4MH5 A;  1BP5 A;  4RK2 A;  4IR8 A;  1DCU A;  1HSJ A;  3T1B A;  2GFE A;  4O7I A;  3OSQ A;  4DZ1 A;  5K2X A;  1GV8 A;  5JK4 A;  2H4I A;  2GHB A;  5KZT A;  5CMK A;  1NV7 A;  3HHF A;  4N07 A;  3TEL A;  2XXH A;  4OQO A;  2PBW A;  4FEB A;  4PFB A;  1NUY A;  1OVB A;  1OVT A;  3K01 A;  4KFQ A;  1VR5 A;  1N04 A;  1MXW A;  1INP A;  3PTY A;  1AOV A;  2XD3 A;  4P1L A;  2B3F A;  1QKA A;  5IZ3 B;  2HAU A;  1LFI A;  4RPO A;  1NV3 A;  2ONR A;  2AL4 A;  3HST A;  2HEU A;  2R71 A;  1VE4 A;  1CE2 A;  3MC2 A;  3IB1 A;  4L17 A;  2OLB A;  1GR2 A;  4MF3 A;  3T93 B;  4OMB A;  1B3F A;  2KR0 A;  3PPP A;  1FPJ A;  3V5A A;  4O8M A;  1JQF A;  2FBP A;  5H8F B;  1NV0 A;  3LUY A;  2PFY A;  2XA5 A;  4N17 A;  5L9S A;  1LAF E;  3G3J A;  4R9F A;  4OVR A;  3CSB A;  1I69 A;  4TOZ A;  1FPG A;  3H6V A;  3LV0 A;  5H8H B;  3T66 A;  4C1U A;  3H3G A;  1YTV A;  2DWJ A;  4JWY A;  3IOT A;  5A5X A;  1A8E A;  4QHQ A;  4ECF A;  3MYU A;  1IXH A;  1TWY A;  1B7U A;  3BIG A;  2Q88 A;  1H76 A;  2Y7W A;  1SQY A;  4NF5 A;  4QSE A;  4ZEI A;  4PQJ A;  1UTH B;  2XXW A;  4MFI A;  4GWY A;  4I62 A;  3LSX A;  1B5I A;  4KQP A;  1MQG A;  3VV5 A;  4ZZE A;  2B4M A;  1FQA A;  3OOA A;  1YAE A;  2IA4 A;  4G4P A;  1LBY A;  4QSD A;  4ZZA A;  4OFL A;  3JV9 A;  2P3V A;  3S9M C;  1M5E A;  2GH9 A;  5I56 A;  4X1B A;  5AA2 D;  4E0X A;  3O6H A;  4LQ2 A;  3UP9 A;  1LBB A;  3IFA A;  3H03 A;  4GWX A;  5TPA B;  3H06 B;  5DEX B;  3GBB A;  1FPL A;  2I58 A;  5TP9 A;  3ODB A;  2OJT A;  1JW5 A;  3NOH A;  2VD2 A;  4R6H A;  4U22 A;  3TCG A;  4GOT A;  3C32 A;  3PMX A;  3LSF B;  3SDF A;  2AL5 A;  3BBR A;  5H8Q A;  3TQL A;  4O3A A;  2XXK A;  1TFA A;  4JWO A;  3OO6 A;  4XKP A;  5I57 B;  4KHZ E;  4YKP A;  4XTC Q;  2XX9 A;  3KGC A;  5T3J A;  3MWB A;  4OEU A;  2REG A;  1T0K A;  4GF8 A;  2UVI A;  2F7C A;  5AA3 A;  2FIE A;  4G77 A;  1B7Z A;  2AIX A;  3JZJ A;  3DEL B;  3G3K A;  3KJ7 A;  3TPA A;  2DSF A;  4XXU A;  2OWS A;  5BWJ A;  2WEF A;  3TTM A;  3ILU B;  3FJG A;  4GWW A;  1FTL A;  1H3D A;  2F78 A;  3A3C A;  3HO7 A;  3CI8 A;  3T9H B;  1PB7 A;  3A3U A;  4PET A;  1SYI A;  2REJ A;  3O28 A;  4XFE A;  1MPD A;  3U92 A;  3MJN A;  4HE0 A;  4DI4 B;  4I3Y A;  3EF7 A;  2FA7 A;  2HQ0 A;  4EQ9 A;  1MXU A;  4PE3 A;  4DE8 A;  3QAX A;  5F1Q A;  4U4X A;  1QJM A;  1B2H A;  3I5O A;  4NED A;  2XXY A;  4RY1 A;  3G3G A;  5IZ3 A;  3Q28 A;  1B6H A;  4EQ7 A;  1B9J A;  4IGR A;  5CI5 A;  5ELV A;  1LBZ A;  2ZMB A;  3MP8 A;  3MST A;  2PMS A;  4ELQ A;  4ZEC A;  4IO6 A;  1QUK A;  5H8F A;  1ZLQ A;  3HFU A;  4PFY A;  2Q8M A;  2R8T A;  4P1E A;  4GX6 A;  1OMP A;  4KD5 A;  4MIJ A;  2BJI A;  4EXK A;  4IO5 A;  3H6T A;  4RA1 A;  3FUZ A;  5H8H A;  3IB0 A;  1RYX A;  4HE2 A;  4PFI A;  2O68 A;  2Z8D A;  3O66 A;  1MXZ A;  3IB2 A;  5LDZ A;  1XOC A;  3DP8 A;  2H99 A;  3IR1 A;  1P1Q A;  3M3L A;  5LOM A;  1DK4 A;  5CMM A;  4U1O A;  4HS7 A;  3ZKL A;  1IMC A;  3W9W A;  2UYE A;  3Q29 A;  4JVI A;  4P0I A;  1UTH A;  2V3Q A;  1USY E;  3TTL A;  1B3G A;  1QUJ A;  4FE8 A;  3JYR A;  2HXR A;  3KZG A;  1N0T A;  4EUO A;  2R6G E;  3CFZ A;  3OO7 A;  3M3K A;  4O3B A;  4JVD A;  5L9O A;  4OAN A;  4H0W A;  2HCA A;  3FVK A;  1FBG A;  3S9E A;  4F3B A;  2QFL A;  1GVC A;  1MH4 A;  4NN3 A;  2ZNU A;  3SEV A;  5TPA A;  4Z7E A;  5FHN A;  3VVF A;  3T9X B;  5DEX A;  4NG7 A;  4DDD A;  1LLS A;  3H6U A;  1AMF A;  5A5L A;  5ITP A;  3S9L C;  3RGY A;  2UVG A;  2XHD A;  1DPP A;  4PFU A;  4TLM B;  4F2O A;  3RUM A;  3ZSF A;  3E78 A;  1SVX B;  2L5V A;  1LAG E;  5FTH A;  1OIB A;  3TCH A;  2Z8E A;  4GD5 A;  2B4L A;  3MBP A;  2QS3 A;  4N15 A;  1FBF A;  2V93 A;  5I57 A;  2XXX A;  4PE5 B;  1NUW A;  4X48 A;  3O6G A;  4R75 A;  1FTO A;  5CMB A;  4NAP A;  2Y5K A;  5HM4 B;  4OZ9 A;  3A29 A;  5CRY A;  3SEW A;  3B6W A;  4ZED A;  5I3S A;  1Y3P A;  1UTB B;  2Y7I A;  4MEV A;  3TZA A;  1D3K A;  3E13 X;  4JSD A;  4F1Y A;  3MVX A;  4FED A;  3F11 A;  3O97 A;  5EQ7 A;  4OVJ A;  4LON B;  3EN3 A;  4G8H A;  4GWO A;  2DE3 A;  3TKD A;  1OQG A;  2VP1 A;  2QJE A;  4N8Y A;  4E0W A;  3BFU A;  3QK6 A;  1RDX A;  2HZK A;  4WEP A;  3RLF E;  4PFR A;  1TT1 A;  5BUU A;  4G68 C;  3TEP A;  1NNF A;  4I1D A;  5I84 A;  5B70 A;  4GVO A;  4U21 A;  4TLL B;  3RNN A;  2V25 A;  2CZL A;  5IAI A;  3CFX A;  3HV1 A;  1LAX A;  3USD A;  4ZDM A;  4OTE A;  3T0J A;  4GWU A;  1HSL A;  1MM7 A;  1FW0 A;  3PPN A;  4EF2 A;  4P56 A;  4U2R A;  4NMY A;  5IM2 A;  5EYH A;  3BIH A;  1MQD A;  3O6I A;  4KCD A;  4GL0 A;  3QUF A;  4NWC A;  3QIM A;  1PC3 A;  1URS A;  4OES A;  4H8J A;  1B32 A;  3D4G A;  3G7W A;  3EPE A;  2E1S A;  4X04 A;  1RDZ A;  3B6Q A;  2PYY A;  1B40 A;  1MM6 A;  4RNS A;  4NWD A;  4PFW A;  5IKB A;  2F7A A;  2M8C A;  3FGS A;  1PDA A;  4N6D A;  1NV1 A;  2B65 A;  2Q89 A;  4YAH X;  1KWH A;  1II5 A;  4RJZ A;  5F24 A;  3TFL A;  4XKR A;  1Y3Q A;  2P1S A;  1LBW A;  3N26 A;  3VE1 B;  3V8X B;  4MNC A;  4KXP A;  1P1N A;  2DXY A;  3UIF A;  3CG3 A;  3TOD A;  3K6U A;  2CZH A;  1FQB A;  4LZ5 A;  1N3X A;  2ONK E;  3EHT A;  2XX8 A;  1N7W A;  5ET6 A;  3OXN A;  3C36 A;  4Z0I A;  2CMO A;  4AQ4 A;  3PMV A;  4ZE8 A;  1TXF A;  1SDX A;  2Y7R A;  3IOW A;  2DOJ A;  3RN8 A;  1JW1 A;  5DT6 A;  1NUZ A;  3C34 A;  4P9K A;  2FNC A;  2DXR A;  2NXO A;  1UIU A;  1FTJ A;  3B6T A;  3R7X A;  2WKY A;  3MVW A;  4ISU A;  1LEV A;  1A54 A;  1FJ6 A;  4H67 A;  1FTK A;  1WVJ A;  3L6G A;  2HZL A;  1JEU A;  4NF6 B;  4BDN A;  4YB6 A;  3UOR A;  5CC2 A;  1FQE A;  3GYY A;  1FPI A;  2VPN A;  4N91 A;  5L8D A;  2QVV A;  1IXI A;  3WAE A;  4YMA A;  1DOT A;  3K6X A;  2DQV A;  4IO2 A;  4OFJ A;  3IJO B;  1M5C A;  4PBH A;  1PBQ A;  5ISU A;  3CRB A;  3T9V A;  4KR5 A;  1D9Y A;  4PAK A;  3C9H A;  2OWT A;  1IUD A;  1UTB A;  1YXI A;  4M1V A;  3FXR A;  3K1M A;  2XXR A;  3DLN A;  2BJJ X;  3ISP A;  3E79 A;  2VD3 A;  3RY3 A;  3KFM A;  5FBP A;  4XKN A;  1B3L A;  5EHS A;  2A5T B;  3VFJ A;  3FD3 A;  4G68 B;  4PC9 A;  4H1X A;  1LCT A;  1HSE A;  5KCJ B;  5AA4 B;  1A7L A;  2ABH A;  4YMB A;  1B0L A;  4QSC A;  1XVX A;  3PUX E;  3OD7 A;  1IMF A;  2HXW A;  3QSL A;  4G61 A;  1IQ7 A;  1JVX A;  1P1O A;  1QUI A;  2QPQ A;  1DMB A;  2QS2 A;  3MVZ A;  2H98 A;  4GFR A;  2VGQ A;  4LA9 A;  3R6U A;  4HTG A;  2GHA A;  3B8B A;  4MCO A;  5L9M A;  3PU5 A;  2ZZW A;  1AL3 A;  4OVT A;  3OSR A;  3KBZ A;  5HPQ A;  5TU0 A;  2DE4 A;  5I58 B;  2I4B A;  3KSX A;  3PMW A;  1LBV A;  2X7Q A;  3V89 B;  3LSL A;  4FOR A;  1YPN A;  2WBD A;  4GBV A;  2W7Y A;  3GLB A;  4O3C A;  4ESW A;  4F31 B;  4GX3 A;  5DVF A;  4LAT A;  2DWH A;  3FBP A;  4PCD A;  3DM0 A;  3MP1 A;  5IZZ A;  2ESN A;  1NH8 A;  1B3E A;  4P8B A;  1AH5 A;  5JTY B;  4GX4 A;  3PPO A;  4Q30 B;  1LBC A;  1R1N A;  5I7I A;  1NV6 A;  1FTM A;  2ALU A;  1XC1 A;  4UAC A;  4QFO A;  1FCK A;  3VLU A;  2GQ1 A;  1MXV A;  2NWJ A;  1DTG A;  4OVQ A;  1NNT A;  3W15 C;  3WAF A;  2UVJ A;  1KA0 A;  4IO3 A;  3K1N A; 
#chains in the Genus database with same CATH homology
 1ZKB A;  2F34 A;  4YB7 A;  1Q35 A;  4JDF A;  2YLN A;  4F3G A;  3LC8 A;  1ELJ A;  3KN8 A;  4F19 A;  2YPN A;  4FEC A;  2PT2 A;  3K4U A;  3FVG A;  4LQ5 A;  4FIM A;  1JEV A;  4FJP A;  2VOZ A;  4H6D A;  3UGW A;  3TQW A;  3OO8 A;  3DP4 A;  3FVN A;  3SEY A;  3OO9 A;  1Y4C A;  3T96 B;  3I6V A;  1FQF A;  2I48 A;  1N76 A;  4EQB A;  4F1U A;  3EHU A;  1TFD A;  1SW5 A;  2D3I A;  1M5D A;  3V83 A;  2RCA A;  4NF6 A;  4UA8 A;  4WKM A;  3DP6 A;  1MY0 A;  1LB9 A;  5K2Y A;  1URG A;  1I6B A;  1M5B A;  4HW8 A;  1BTJ A;  3PPR A;  3AXF A;  1NL5 A;  3IOV A;  1SW2 A;  4G2Z A;  4H65 A;  2I3W A;  3KN3 A;  3TAJ A;  4DIG A;  1ANF A;  5M2V A;  2I0C A;  3PUV E;  1IXC A;  4I9D A;  3IO4 A;  3S4U A;  1BIY A;  4AB5 A;  2I6E A;  3SEU A;  4F39 A;  2G93 A;  2O1L A;  3E3K A;  4JBZ A;  1XHY A;  3D4C A;  3K00 A;  3KSJ A;  1UIV A;  2QS1 A;  4U4S A;  1A99 A;  4H5G A;  5H8N B;  3FAT A;  2Q2A A;  4PP0 A;  2A5T A;  4ZEB A;  2RIN A;  5CBR A;  1H43 A;  4R73 A;  2UVH A;  3VLV A;  4G68 A;  1MDQ A;  1Z7M E;  1RYO A;  1SD3 A;  4P0G A;  1O63 A;  5KCJ A;  5AA4 A;  2RF1 A;  1FQD A;  5B7D A;  4GIZ A;  1JET A;  4F1V A;  1QVS A;  2I3V A;  2D5W A;  4ZEK A;  3IX1 A;  1Y9U A;  4OEN A;  4F29 A;  4KI0 E;  2ZYK A;  5I2N B;  2DVZ A;  1B58 A;  1VFD A;  3ONM A;  1SYH A;  3CIJ A;  1JW4 A;  2DWI A;  3MPK A;  3VVD A;  5J1D A;  4ZS9 A;  4F2Q A;  2Y7K A;  3KG2 A;  2PX1 A;  3RT6 B;  5I58 A;  3Q25 A;  1LCF A;  4Q8R A;  2QL3 A;  4QRZ A;  2YJP A;  1Y1M A;  3U94 A;  2O7I A;  2R9J A;  3HN0 A;  2KLF A;  1URD A;  2IEE A;  3TTK A;  1NKX A;  3OEK A;  4BLA A;  3E4R A;  2RC9 A;  1B5H A;  3PUZ E;  5JTY A;  4ELR A;  3IOU A;  3FIR A;  1B3H A;  1US4 A;  2F8D A;  2F7B A;  3HHG A;  3W9V A;  1MY4 A;  1MY3 A;  4GRK A;  4DCY A;  3FXQ A;  2UXA A;  1XVY A;  1Z7N E;  2NUV A;  2UYF A;  1MPB A;  4NF4 B;  1PB9 A;  2QMX A;  4N13 A;  3SEX A;  2Z22 A;  4DXC A;  2Y84 A;  4N6P A;  5I2K B;  2Z8F A;  4ND9 A;  4NF8 B;  4ZEF A;  3M3F A;  3EQ1 A;  1SI1 A;  4G8M A;  4GXS B;  4DCX A;  1CB6 A;  2PT1 A;  2AYS A;  2XXT A;  4YKJ A;  2I0B A;  4BDQ A;  3PUY E;  2ZNS A;  1SI0 A;  4R2B A;  4Q0C A;  3IO6 A;  4QF9 A;  3PD9 A;  3RQT A;  3OMB A;  4MLV A;  1IIW A;  1I6A A;  1O7T A;  1J1N A;  4NTL A;  1Y3N A;  4X1D A;  4TQU Q;  1S50 A;  1ZJL A;  2ONS A;  1DPE A;  3G3F A;  1P1W A;  3PD8 A;  1MS7 A;  2Q2C A;  4LVQ A;  4OFO A;  3UA8 A;  3MZ1 A;  4K3F A;  3IK6 B;  3MPL A;  1LB8 A;  3MUQ A;  4EDP A;  4ZE9 A;  1MH3 A;  3KJT A;  1NFT A;  3ECR A;  2XXV A;  1JNF A;  3TCF A;  1EU8 A;  2O1M A;  5FHO A;  3TTN A;  1USY H;  1SBP A;  5I59 B;  1DSN A;  5H8N A;  3GZG A;  3H7M A;  2DP8 A;  2H5Y A;  4LP2 B;  2V3T A;  3G3I A;  2XX7 A;  4H8I A;  3RT8 A;  5KDT B;  4IO4 A;  4IY6 A;  2V3U A;  2XXU A;  4F3P A;  1ZMG A;  4HCY A;  3I3V A;  3A09 A;  2OK2 A;  2I49 A;  2QMW A;  4IB2 A;  4JWX A;  1POT A;  4QFP A;  5FTI A;  4U23 A;  4OER A;  1M5F A;  1FQC A;  5I2N A;  5F7V A;  3K1P A;  4HCW A;  3CFL A;  2Z23 A;  2OZZ A;  4OET A;  4POX A;  1Y1Z A;  2QSX A;  3CVG A;  3KOS A;  4GL8 A;  4FAJ A;  4OEV A;  1LST A;  3H6W A;  3L6H A;  1S9T A;  1LFH A;  2E0S A;  4XKQ A;  3VVE A;  4F22 A;  2XXQ A;  4R9G A;  3PPQ A;  4ONY A;  5FHM A;  2HAV A;  3THI A;  3TDJ A;  5AA2 B;  1MRP A;  4GLI A;  4LUB A;  1R9L A;  4YIC A;  2PVU A;  1LAH E;  5CM6 A;  1B5J A;  3T9U A;  1POY 1;  2HFB A;  3KN7 A;  3FJM A;  3LR1 A;  3EHS A;  4WED A;  1R6Z A;  3O9P A;  4NF4 A;  4X9T A;  1S7Y A;  1D4N A;  4AB6 A;  4LZ7 A;  2ZNT A;  2ZXT A;  3U1O A;  1P99 A;  2VHA A;  4OXV A;  1NMU A;  4BDR A;  1DTZ A;  1EZ9 A;  3C4M A;  5I2K A;  1MQH A;  1PEB A;  4FAT A;  4NF8 A;  5CBS A;  5EYF A;  3OEN A;  3TUS A;  3U72 A;  3FV1 A;  4RYA A;  3QXM A;  5DTB A;  3KOT A;  4F18 A;  4EF1 A;  2ANJ A;  2DVC A;  3R26 A;  1US5 A;  1WDN A;  4WXJ A;  1A40 A;  1B46 A;  2XD2 A;  4JSO A;  3U8Q A;  3VDF A;  1B0H A;  4JXI A;  3GXA A;  3IL1 B;  3MQ9 A;  3RTF B;  1QW0 A;  2DE2 A;  3P7I A;  2G29 A;  3K2D A;  4R6Y A;  3B7D A;  1NNK A;  2F6G A;  4BDL A;  2ZYO A;  4OHN A;  3BFT A;  2DS9 A;  1MY1 A;  1B52 A;  3ZKK A;  1A8F A;  3CR9 A;  1MDP 1;  4IY5 A;  4R74 A;  2B3B A;  1GGG A;  3LSW A;  1BLF A;  1I6Q A;  4H5F A;  4BDO A;  2THI A;  3N5L A;  3Q27 A;  1RKM A;  1F9B A;  2I4C A;  2H25 A;  2H9B A;  5I59 A;  1VFE A;  3N6U A;  3G3H A;  3VLW A;  3FJ7 A;  5KDT A;  2DYX A;  1B1X A;  1XT8 A;  1VSO A;  1IZ1 A;  2A5S A;  1PBP A;  3PV0 E;  1MQI A;  2RC8 A;  2RKM A;  4MLQ A;  4I8C A;  2OBG A;  3O29 A;  1EH3 A;  3MZ9 A;  4QFN A;  3IAZ A;  2GRV A;  2O69 A;  1B7H A;  3MAM A;  3S2V A;  3M8U A;  3C33 A;  2ZYN A;  3S9N C;  3KBR A;  4KYD A;  1NH7 A;  4PFT A;  3IJX B;  4R2F A;  3HPI A;  1AIV A;  3C31 A;  1QKB A;  2ZYM A;  4OYV A;  1MPC A;  1N3W A;  4KCC A;  1ATG A;  1ZBM A;  4RK9 A;  5ICT A;  3VXB A;  3RPW A;  1LGB C;  4KYE A;  1OLA A;  1UQW A;  4Q5T A;  1SW4 A;  5AA2 A;  3MVY A;  1EZO A;  4QFL A;  4NE4 A;  3T22 A;  4DXU A;  5AA1 A;  4XIG Q;  3ILT B;  4THI A;  3SES A;  2F97 A;  3UN6 A;  1R9Q A;  5HBC A;  1MXY A;  4M4G A;  4YKI A;  2D21 A;  3SKP A;  4BDM A;  1B05 A;  4DLD A;  1JVY A;  1Y20 A;  2XXI A;  1GTK A;  5AE4 A;  1SW1 A;  3PGF A;  2Q8J A;  3UK4 A;  1B51 A;  3TTR A;  3OEL A;  2RCB A;  1N84 A;  4ELO A;  2X26 A;  4P11 A;  3H4Z A;  1ZTY A;  3N94 A;  1H45 A;  3K0V A;  4YKK A;  3FVO A;  3O2A A;  3SET A;  2RC7 A;  1XS5 A;  2DWA A;  3N6T A;  1D9V A;  2Y7P A;  2F36 A;  3RTW B;  4YB5 A;  1Y4T A;  2O84 X;  4LZ8 A;  4IGT A;  2F35 A;  3PUW E;  1B1H A;  5ICQ A;  4KPT A;  5DYH A;  2O6A A;  5JEI A;  4YZZ A;  3HCQ A;  1MXX A;  2OCU A;  2QRY A;  1OLC A;  3Q26 A;  3QUJ A;  3K6W A;  4GQO A;  2XXP A;  2P0S A;  5A5X B;  4JB7 A;  2O7U A;  5EHM A;  4QFK A;  4RXL A;  3TMG A;  1IXG A;  3QYT A;  3FAS A;  3IOR A;  4IO7 A;  1WOD A;  4NF5 B;  5CMC A;  4GXA A;  2NVU B;  3CG1 A;  4YU0 A;  1ZU0 A;  1IIT A;  3CSG A;  4EXL A;  4C0R A;  2X7P A;  1EZP A;  4KYS A;  1B4Z A;  1P1U A;  1B4H A;  3GBA A;  3U93 A;  2P2A A;  5I56 B;  1L5T A;  1BKA A;  3FV2 A;  4R72 A;  5DVI A;  2QS4 A;  4ESX A;  1O64 A;  3MP6 A;  3FZV A;  2LAO A;  3BKI B;  4C1T A;  3FXU A;  3MW0 A;  5H8S A;  4ELP A;  1MY2 A;  5TP9 B;  3SER A;  2FYI A;  1ZIU A;  4MBP A;  4RPN A;  2NOO A;  4G8N A;  1N7X A;  3TYH A;  4POW A;  1MG1 A;  5DVJ A;  5ITO A;  2F6P A;  5H8Q B;  3MZB A;  3OEM A;  1YCJ A;  1NNP A;  1LFG A;  3C35 A;  1QUL A;  3LBS A;  2O51 A;  1MQJ A;  4DXB A;  1IEJ A;  1A55 A;  2F5X A;  1H44 A;  4U1Z A;  3KEI A;  1Q1K A;  4OWD A;  3E9X A;  1PB8 A;  1OQH A;  3K02 A;  3VXC A;  4F3S A;  4R6K A;  2V84 A;  2Q9T A;  3ZS6 A;  3K6V A;  4MH5 A;  1BP5 A;  4RK2 A;  1HSJ A;  2GFE A;  3OSQ A;  4DZ1 A;  5K2X A;  1GV8 A;  5JK4 A;  2H4I A;  2GHB A;  5KZT A;  5CMK A;  3HHF A;  4N07 A;  3TEL A;  2XXH A;  4OQO A;  2PBW A;  4FEB A;  1OVB A;  1OVT A;  3K01 A;  4KFQ A;  1VR5 A;  1N04 A;  1MXW A;  1AOV A;  2XD3 A;  2B3F A;  1QKA A;  2HAU A;  1LFI A;  4RPO A;  2ONR A;  2AL4 A;  3HST A;  2HEU A;  2R71 A;  1VE4 A;  1CE2 A;  3MC2 A;  3IB1 A;  4L17 A;  2OLB A;  1GR2 A;  4MF3 A;  3T93 B;  4OMB A;  1B3F A;  3PPP A;  3V5A A;  1JQF A;  5H8F B;  3LUY A;  5L9S A;  1LAF E;  3G3J A;  4R9F A;  3CSB A;  1I69 A;  4TOZ A;  3H6V A;  5H8H B;  3T66 A;  4C1U A;  3H3G A;  1YTV A;  2DWJ A;  4JWY A;  3IOT A;  5A5X A;  1A8E A;  4QHQ A;  4ECF A;  1IXH A;  1TWY A;  1B7U A;  2Q88 A;  1H76 A;  2Y7W A;  1SQY A;  4NF5 A;  4QSE A;  4ZEI A;  4PQJ A;  1UTH B;  2XXW A;  4MFI A;  4I62 A;  3LSX A;  1B5I A;  4KQP A;  1MQG A;  3VV5 A;  4ZZE A;  1FQA A;  3OOA A;  1YAE A;  2IA4 A;  4G4P A;  4QSD A;  4ZZA A;  4OFL A;  3JV9 A;  3S9M C;  1M5E A;  2GH9 A;  5I56 A;  4X1B A;  5AA2 D;  4E0X A;  3O6H A;  4LQ2 A;  3UP9 A;  1LBB A;  3H03 A;  5TPA B;  3H06 B;  5DEX B;  3GBB A;  2I58 A;  5TP9 A;  3ODB A;  2OJT A;  1JW5 A;  2VD2 A;  4R6H A;  4U22 A;  3TCG A;  4GOT A;  3C32 A;  3PMX A;  3LSF B;  3SDF A;  2AL5 A;  3BBR A;  5H8Q A;  3TQL A;  4O3A A;  1TFA A;  4JWO A;  3OO6 A;  4XKP A;  5I57 B;  4KHZ E;  4YKP A;  4XTC Q;  2XX9 A;  3KGC A;  3MWB A;  4OEU A;  2REG A;  1T0K A;  4GF8 A;  2UVI A;  2F7C A;  5AA3 A;  4G77 A;  1B7Z A;  2AIX A;  3JZJ A;  3DEL B;  3G3K A;  3KJ7 A;  3TPA A;  2DSF A;  4XXU A;  2OWS A;  5BWJ A;  3TTM A;  3ILU B;  3FJG A;  1FTL A;  1H3D A;  2F78 A;  3A3C A;  3HO7 A;  3CI8 A;  3T9H B;  1PB7 A;  3A3U A;  4PET A;  1SYI A;  2REJ A;  3O28 A;  1MPD A;  3U92 A;  3MJN A;  3EF7 A;  2FA7 A;  2HQ0 A;  4EQ9 A;  1MXU A;  4DE8 A;  3QAX A;  5F1Q A;  4U4X A;  1QJM A;  1B2H A;  3I5O A;  4NED A;  2XXY A;  4RY1 A;  3G3G A;  3Q28 A;  1B6H A;  4EQ7 A;  1B9J A;  4IGR A;  5CI5 A;  5ELV A;  2ZMB A;  3MP8 A;  2PMS A;  4ELQ A;  4ZEC A;  4IO6 A;  1QUK A;  5H8F A;  1ZLQ A;  4PFY A;  1OMP A;  4KD5 A;  4EXK A;  4IO5 A;  3H6T A;  4RA1 A;  3FUZ A;  5H8H A;  3IB0 A;  1RYX A;  2O68 A;  2Z8D A;  3O66 A;  1MXZ A;  3IB2 A;  1XOC A;  3DP8 A;  2H99 A;  3IR1 A;  1P1Q A;  3M3L A;  5LOM A;  5CMM A;  4U1O A;  4HS7 A;  3ZKL A;  3W9W A;  2UYE A;  3Q29 A;  4P0I A;  1UTH A;  2V3Q A;  1USY E;  3TTL A;  1B3G A;  1QUJ A;  4FE8 A;  3JYR A;  3KZG A;  1N0T A;  4EUO A;  2R6G E;  3CFZ A;  3OO7 A;  3M3K A;  4O3B A;  5L9O A;  4H0W A;  2HCA A;  3FVK A;  3S9E A;  4F3B A;  1GVC A;  1MH4 A;  2ZNU A;  3SEV A;  5TPA A;  4Z7E A;  5FHN A;  3VVF A;  3T9X B;  5DEX A;  4DDD A;  1LLS A;  3H6U A;  1AMF A;  5ITP A;  3S9L C;  3RGY A;  2UVG A;  2XHD A;  1DPP A;  4PFU A;  4TLM B;  4F2O A;  3RUM A;  3ZSF A;  1SVX B;  1LAG E;  5FTH A;  1OIB A;  3TCH A;  2Z8E A;  4GD5 A;  3MBP A;  2QS3 A;  2V93 A;  5I57 A;  2XXX A;  4PE5 B;  4X48 A;  3O6G A;  4R75 A;  1FTO A;  5CMB A;  5HM4 B;  4OZ9 A;  5CRY A;  3SEW A;  3B6W A;  4ZED A;  1Y3P A;  1UTB B;  2Y7I A;  3TZA A;  1D3K A;  3E13 X;  4JSD A;  4F1Y A;  3MVX A;  4FED A;  3F11 A;  3O97 A;  4OVJ A;  4LON B;  3EN3 A;  4G8H A;  4GWO A;  2DE3 A;  3TKD A;  1OQG A;  2VP1 A;  2QJE A;  4E0W A;  3BFU A;  3QK6 A;  2HZK A;  4WEP A;  3RLF E;  1TT1 A;  5BUU A;  4G68 C;  3TEP A;  1NNF A;  4I1D A;  5I84 A;  5B70 A;  4GVO A;  4U21 A;  4TLL B;  3RNN A;  2V25 A;  2CZL A;  5IAI A;  3CFX A;  3HV1 A;  1LAX A;  3USD A;  4ZDM A;  4OTE A;  1HSL A;  1MM7 A;  1FW0 A;  3PPN A;  4EF2 A;  4U2R A;  4NMY A;  1MQD A;  3O6I A;  4KCD A;  4GL0 A;  3QUF A;  4NWC A;  3QIM A;  1PC3 A;  1URS A;  4OES A;  4H8J A;  1B32 A;  3D4G A;  3G7W A;  3EPE A;  2E1S A;  3B6Q A;  2PYY A;  1B40 A;  1MM6 A;  4RNS A;  4NWD A;  4PFW A;  5IKB A;  2F7A A;  2M8C A;  3FGS A;  1PDA A;  2B65 A;  2Q89 A;  4YAH X;  1KWH A;  1II5 A;  4RJZ A;  3TFL A;  4XKR A;  1Y3Q A;  2P1S A;  3N26 A;  3VE1 B;  3V8X B;  1P1N A;  2DXY A;  3UIF A;  3CG3 A;  3TOD A;  3K6U A;  1FQB A;  4LZ5 A;  1N3X A;  2ONK E;  3EHT A;  2XX8 A;  1N7W A;  3OXN A;  3C36 A;  4Z0I A;  2CMO A;  4AQ4 A;  3PMV A;  4ZE8 A;  1TXF A;  1SDX A;  2Y7R A;  3IOW A;  2DOJ A;  3RN8 A;  1JW1 A;  5DT6 A;  3C34 A;  2FNC A;  2DXR A;  2NXO A;  1UIU A;  1FTJ A;  3B6T A;  3R7X A;  2WKY A;  3MVW A;  4ISU A;  1A54 A;  4H67 A;  1FTK A;  1WVJ A;  3L6G A;  2HZL A;  1JEU A;  4NF6 B;  4BDN A;  4YB6 A;  3UOR A;  5CC2 A;  1FQE A;  5L8D A;  1IXI A;  3WAE A;  4YMA A;  1DOT A;  3K6X A;  2DQV A;  4IO2 A;  3IJO B;  4OFJ A;  1M5C A;  1PBQ A;  5ISU A;  3CRB A;  3T9V A;  4KR5 A;  1D9Y A;  3C9H A;  2OWT A;  1IUD A;  1UTB A;  4M1V A;  3FXR A;  3K1M A;  2XXR A;  3DLN A;  2BJJ X;  2VD3 A;  3RY3 A;  3KFM A;  4XKN A;  1B3L A;  5EHS A;  2A5T B;  3VFJ A;  3FD3 A;  4G68 B;  4H1X A;  1LCT A;  1HSE A;  5KCJ B;  5AA4 B;  1A7L A;  2ABH A;  4YMB A;  1B0L A;  4QSC A;  1XVX A;  3PUX E;  3OD7 A;  2HXW A;  3QSL A;  1IQ7 A;  1JVX A;  1P1O A;  1QUI A;  2QPQ A;  1DMB A;  2QS2 A;  3MVZ A;  2H98 A;  4GFR A;  2VGQ A;  4LA9 A;  3R6U A;  4HTG A;  2GHA A;  5L9M A;  3PU5 A;  1AL3 A;  3OSR A;  5HPQ A;  5TU0 A;  2DE4 A;  5I58 B;  2I4B A;  3KSX A;  3PMW A;  2X7Q A;  3V89 B;  3LSL A;  4FOR A;  1YPN A;  2W7Y A;  3GLB A;  4O3C A;  4ESW A;  4F31 B;  5DVF A;  4LAT A;  2DWH A;  3DM0 A;  3MP1 A;  2ESN A;  1NH8 A;  1B3E A;  1AH5 A;  5JTY B;  3PPO A;  4Q30 B;  1LBC A;  1R1N A;  1FTM A;  2ALU A;  1XC1 A;  4UAC A;  4QFO A;  1FCK A;  3VLU A;  1MXV A;  2NWJ A;  1DTG A;  1NNT A;  3W15 C;  3WAF A;  2UVJ A;  4IO3 A;  3K1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...