4EQZA

Crystal structure of human dot1l in complex with inhibitor fed2
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
338
structure length
332
Chain Sequence
LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMEYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
publication title Catalytic site remodelling of the DOT1L methyltransferase by selective inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 115
structure length 332
sequence length 338
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4eqzA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4eqzA02
3BT7A 5DXAA 1N2XA 2AVNA 3KR9A 2O57A 4G56A 1VPTA 2CKDA 5B1SA 2OB1A 5HZMA 3C6KA 4DZRA 5EEGA 3LKDA 1FP1D 5KQSA 5LQAA 9MHTA 1G8AA 3R0QA 3TM5A 1EAMA 1EG2A 1X1DA 2AZTA 2JJQA 5FUBA 4YV1A 3UBTA 3EVZA 4FR0A 3SX0A 3UA3A 3G2OA 3PTAA 5DLYA 4QDJA 3FPJA 1NW3A 3FYCA 1NV8A 3FUXA 3NDIA 4YV2A 3PLAE 4AUKA 1L3CA 2ZLBA 5HIIA 2PT9A 2OPBA 5HILA 3UZUA 4RYLA 5CD1A 5GP1A 1YFJA 2PLWA 5ICCA 3KPWA 4MQ4A 1XJ5A 2ZTHA 5LSAA 5DX1A 3CBGA 3EVCA 3LDUA 2C7RA 3EVEA 2IIPA 4RVGA 3OFKA 4YUVA 4NECA 3FZGA 2PWPA 1BOOA 3FTCA 4RTMA 2IH2A 1MHTA 5K0CA 2WA1A 2HV9A 2QRVB 4YUWA 3G2MA 2ZFUA 1G55A 2ZSUA 3Q87B 4PONA 5K8VA 2Y1XA 4LECA 5ICFA 2PWYA 2AS0A 5EZQA 5FADA 3DOUA 3T7RA 1NW6A 2BM9A 4ER3A 4KRGA 5EHIA 4FGZA 4BLUA 5GIPE 4Y2HA 1G60A 2I7CA 1RI4A 3BGVA 5K0LA 4RWZA 4AX8A 2ZBRA 4R8RA 4YMHA 3UJ9A 4C04A 3UJ6A 3I5UA 3B3JA 2IDJA 1VP3A 4QQNA 4EKGA 2PKWA 1VLMA 1RJFA 4JXJA 5LQNA 3GDHA 1N7IA 1SVUA 5E1BA 4F86A 3KQMA 3FPGA 4E30A 5EKXA 1IM8A 3LPMA 4B17A 1XXLA 5LQUA 5E9JA 3G88A 1NBHA 3FRHA 3G5TA 3FTFA 5FHRA 5E2BA 1EJ6A 1YUBA 3EVBA 2EX4A 2I9KA 2ONZA 1AV6A 2QM3A 2ADMA 4RV9A 4OBXA 5C1IA 4BY9E 5EIWA 1X1AA 5FWDA 4HGYA 4M7RA 1KYZA 4GOND 4RX1A 4U7TB 3P2EA 4Z2YA 3PFHA 3TRKA 4PYKA 4C4AA 2P3QA 1KR5A 2NXJA 4HTFB 4RTPA 2PX8A 3TPZA 4KIGA 1RI3A 1Q0TA 2P7HA 3M70A 3F4KA 2AR0A 2YUIA 4HGZA 1JSXA 3GO4A 5FULA 2LD4A 2ZIEA 5P8WA 4E2ZA 3GRYA 3JWGA 3I64A 3IV6A 3LL7A 5EQJB 4DKJA 3HTXA 1L9KA 5DTQA 5JUWA 3DR5A 3GGDA 5M5BA 2NXEA 2GB4A 3DULA 5T64A 4BLWA 2EFJA 5F2OA 2UYHA 1VP9A 1WY7A 1Q0SA 5H02A 3GRUA 5EOVA 2C7QA 3LSTA 2CMHA 4ISCA 2PX5A 3BWMA 5GWXA 5BW4A 5CCBA 4M37A 1R00A 2AVDA 2IDKA 1KYWA 1BKYA 3PX2A 3TKYA 3FTDA 4U7PB 5EHGA 3V8VA 4KIFA 5CM2Z 3G7UA 1ZGAA 4OQEA 2QRVA 3KPYA 5EMMA 4CKBA 3A25A 3P2KA 3ER8A 2OZVA 4BLVA 3E05A 1L3BA 3OZSA 3D2LA 3SGLA 4HH4A 3TOSA 4F84A 3GNLA 2I6GA 4HG2A 4PYMA 2VS1A 3A26A 4C07A 2F8LA 2YX1A 4GC9A 2P3OA 2ZW9A 3DXXA 3OU7A 3THRA 4ER5A 5EMKA 3R3HA 10MHA 1PJZA 1R74A 2R3SA 1XCLA 4C06A 4XCXA 4GBED 4LWPA 5CVEA 4DCGA 5EPEA 3U81A 2Q41A 4ATNA 4EQZA 2NXNA 5HEKA 1JTFA 2CWWA 2XYRA 3SSNA 2CL5A 2EJUA 3IEIA 3KQOA 5F2KA 2N47A 4X61A 3B3GA 3CJRA 3M33A 3OU6A 5FA5A 4OQDA 4M38A 3G2QA 3HM2A 3ORHA 1MJFA 4CTJA 5E8JA 1FPQA 3KPVA 3A7DA 3OCJA 2G1PA 5K01A 4IV0A 2I62A 4GUAA 4HTFA 1X19A 1Z3CA 3GJYA 2JHPA 3BGIA 4P7KA 1QANA 5EVJA 1RJEA 1FBNA 1JQ3A 2A14A 1EJ0A 2P3LA 3EMDA 3LKZA 1F38A 2PXCA 3DMFA 4OX9Y 1XDUA 4RVDA 5LQRA 2P1DA 5CVVA 5EEHA 2VP3A 3LCVB 1WXXA 4DMGA 1NW8A 1RI2A 2AOTA 3E8SA 5FHQA 5GM2A 5K05A 2AOWA 5MHTA 3O7WA 4C05A 3EGIA 2EJTA 2PY6A 2OY0A 4H0NA 5CIYA 4FZVA 5T6BA 1D2HA 1XCJA 3UFBA 4EMSA 5CUQA 1QZZA 2B9EA 1TPYA 3CVOA 3SSMA 5C9ZA 1M0EA 3M4XA 2AOUB 5CCXA 1V39A 5HIMA 2P7IA 3EMBA 3M6VA 2YXLA 5FQOA 3TQSA 2ZCJA 2BM8A 4PYLA 3R9XB 3KR1A 1SUSA 2R6ZA 2ZZKA 4C08A 3OZTA 2G8NA 3HCFA 5T67A 3CC8A 3V97A 4IKPA 3DTNA 5E8RA 5K0FA 3AJDA 3K6RA 4X63A 2UZ4A 2Y1WA 2YR0A 1ZQ9A 4YUZA 4QTTB 5K0EA 3M6UA 1Y8CA 2B25A 3RODA 4BP3A 3EVAA 4P7FA 2V7EA 2JG3A 4EKIA 5HIKA 5FCDA 1DL5A 2O07A 4IV8A 3UJCA 2GS9A 4YUXA 2B3TA 2QYOA 2BR5A 5F2NA 1ZHFA 5DXJA 1SQFA 3G5LA 2ESRA 1JR4A 1SQGA 2EG5A 3BKXA 5BP7A 5JR3A 4RTKA 4DM3A 4R05A 5DTRA 4XUDA 1G8SA 1H1DA 2PXXA 3LCCA 2FCAA 3B3FA 5DX0A 1I1NA 3C3YA 4A6EA 1VBFA 3BKWA 2BR4A 3REOA 3MAGA 4P7JA 4FP9A 1N7JA 2O06A 2QY6A 5E1OA 3RW9A 4RTQA 2HR1A 3ANXA 5DRTA 4P58A 2DPMA 2QE6A 1UFKA 4IWNA 4KWCA 4RSRA 3TKAA 5K0BA 1I9GA 2FYTA 2ZZMA 5D1HA 3NVKI 3SM3A 3P9KA 4RTNA 5CVJA 1NW5A 4Y30A 3A27A 4HRAA 5G02A 2B78A 4AZWA 1IY9A 4DF3A 2UYCA 5GIOE 1JTEA 5IKMA 3VYWA 1SG9A 3KQSA 3R24A 1R18A 3X0DA 4RVHA 3GRRA 2GLUA 1JQDA 4LWOA 4L7VA 4PGGA 3C0KA 3EVDA 2OO3A 4PGHA 4RTLA 3B89A 2AOTB 4UOEA 2IH5A 3BUSA 4QPPA 3E7PA 1JSZA 3LDFA 3P9IA 2YVLA 4FT4A 4PINA 3H2BA 3HEMA 3HVKA 1QAOA 5LR6A 3FPFA 3LECA 4WVLA 4YUYA 2AOUA 4PYIA 1NBIA 3KQQA 4MTLA 4P7GA 3HCAA 5EC8A 3B5IA 1JG1A 3IYLW 5GM1A 3BGDA 3R6TA 3EEOA 2XVAA 4KDCA 1KPHA 5E9WA 2ZZNA 3GXOA 3BWCA 3Q7EA 3LCUA 2NP6A 3FRIA 3MB5A 3LDGA 1EIZA 4KW7A 3C6MA 3LHDA 4E31A 5LQKA 3HVHA 3G8BA 3VC2A 2ZIFA 4CXMA 3GRZA 4C03A 2ERCA 5KQRA 1R8XA 2PV0A 1WXWA 3PB3A 2PBFA 2PX4A 4R6WA 3KQVA 3PT9A 3UJBA 5KVAA 1KP9A 2AOXA 2GA9A 1NV9A 5K03A 3DLIA 3HP7A 5E9QA 3FPHA 5D1NA 1YFLA 5EIFA 2ZBQA 1NKVA 4LG1A 2IPXA 4R6XA 4ER7A 2IH4A 3DUWA 1U2ZA 3LGAA 3I9FA 3THSA 1P91A 3JWIA 4MIKA 2BR3A 5ICGA 3ELWA 5FWAA 3I58A 1ZGJA 3NTVA 1XDZA 4R8SA 5E1MA 4FS8A 5LQJA 2O0LA 2UYOA 3A4TA 4ER6A 2P8JA 3BWBA 3PFGA 3T7SA 3KPUA 2C7OA 2XBMA 4BP1A 2AN4A 3MHTA 2PX2A 3TR6A 4F85A 2NP7A 1X1BA 1T43A 3TMAA 3S68A 2YXDA 1L3IA 5KYGA 1TW3A 2XVMA 5EGSA 3HCCA 1JG2A 3OPNA 2GAFA 2IGTA 2PGXA 2OB2A 4ER0A 4PWYA 2B2CA 3PS9A 2NYUA 4PYOA 4PYQA 5DM2A 5E1DA 4RTOA 2PXAA 3CKKA 3OZRA 3TM4A 1SKMA 5K09A 3IHTA 1QYRA 1I4WA 4WXHA 5DT2A 3NVMB 4MWZA 4OA5A 4E2XA 2P41A 1QAMA 2BZGA 2YXEA 3T0IA 3VSEA 1XDSA 1ZKDA 3NMUF 2ZWVA 3HVJA 4A6DA 1WZNA 1AF7A 1XTPA 2FK8A 3GU3A 4PNEA 2AOVA 4PCLA 2ZIGA 3KQYA 1KHHA 1JQEA 2WK1A 4E32A 5FA8A 1YF3A 4CTKA 5DM0A 1G6Q1 2GPYA 3AXSA 3FUTA 3JWJA 3BXOA 4KVZA 4YMGA 2E5WA 4GOOD 3QOWA 3LX6A 3E23A 5DM4A 3AWIA 3ME5A 3SSOA 1KPGA 2FPOA 4QVGA 1EQAA 4AZSA 1UWVA 3KQPA 5E2AA 5K0GA 2OKCA 8MHTA 1PRYA 1KPIA 2VDVE 1R6AA 3BZBA 1O9HA 3ELUA 2IP2A 4OBWA 2AN3A 2PVCA 3DMGA 2NNWB 3GIWA 4E70A 1P39A 3OFJA 5EMLA 2ZULA 4FSDA 2UYQA 5K0NA 3HA5A 4GOLD 5HIJA 1HNNA 3EGEA 2FHPA 1B42A 2JHAA 4PYJA 1DUSA 2BH2A 2C7PA 2FRXA 1JG4A 3FPEA 4YV0A 5ICEA 2G72A 4KDRA 3KKZA 4CWAA 1P1CA 1FJXA 4CKCA 1YZ3A 3GWZA 4QDKA 3KU1A 4QTUB 4RVFA 4AZVA 1RI1A 3PX3A 5CVUA 2VZ9A 3P2IA 5K0JA 5FTWA 2YTZA 2ONYA 5GOZA 3AY0A 4EVIA 2HNKA 2ZBPA 2Z6AA 4MHTA 2ORED 3NWBA 3MTIA 3KHKA 1WG8A 3K0BA 3P9CA 4X60A 5KS2A 5HOQA 1BHJA 3HCBA 1ORIA 5ERGB 3ER9A 4DA4A 1ORHA 1VIDA 3EEYA 3OE4A 1RJGA 2P35A 4E2YA 4EK9A 3TFWA 3KQWA 3CGGA 4E33A 1R8YA 2P40A 2YQZA 4PYNA 3DXYA 3O31A 4GQBA 3PVCA 3I53A 2PT6A 3HNRA 3B7PA 3CJQA 2ZVJA 3ELDA 1KIAA 3MTEA 5GINE 2FK7A 4HC4A 3SXJA 4PIMA 2OYRA 1O9GA 1ZG3A 3FUVA 1M6EX 3HVIA 2XYVA 3SVZA 4DQ0A 7MHTA 5EZSA 3DXZA 3HA7A 1RJDA 1NW7A 2JH9A 3A7EA 1TW2A 3FTEA 2VDUE 3BWYA 4FT2A 1QAQA 3O4FA 4FSXA 2AN5A 1RI5A 3DH0A 1XVAA 3P97A 5DRYA 5EKUA 3UJAA 3M6XA 1IXKA 3UJ7A 2CMGA 5C0OE 5CVDA 5DM1A 3LBFA 2H00A 2G70A 3SR4A 5EG5A 4E2WA 2OBFA 5BXYA 3HA3A 2Z6QA 3MCTA 2PSSA 3P8ZA 1P1BA 3G89A 4HSGA 4V0QA 3AXTA 3M6WA 5IH3A 2XYQA 3LBYA 3T7TA 3KR0A 4K6MA 2H11A 2KW5A 1KXZA 3DLCA 1X1CA 2G71A 3FYDA 3GCZA 3NDJA 3G2PA 3KPJA 3NJRA 3QV2A 1OR8A 3EGVA 3MQ2A 4M36A 1HMYA 5DWQA 5HFJA 5LQCA 3QOXA 2ZWAA 3OU2A 4QPNA 4CKEA 3CCFA 1YB2A 1INLA 1VQ1A 4QQKA 3NWEA 4OA8A 2PJDA 1G38A 3OE5A 3EVGA 2VDWA 5FQNA 5EMJA 3C3PA 4AZTA 3KR2A 3CJTA 4X1OA 4DCMA 3FUUA 3G8AA 4GC5A 3EPPA 5BW5A 4O29A 4XUEA 1AQJA 2IBTA 3MCZA 5DPMA 2OXTA 4QVKA 2HTEA 1YZHA 1FP2A 4RTJA 1VE3A 2H1RA 3TLJA 3KQTA 1NT2A 1SUIA 4V0RA 2K4MA 3HCEA 3UJDA 1AQIA 3GRVA 1D2CA 2JHCA 4X41A 3L8DA 3EVFA 3HCDA 4GEKA 5U4XA 3UA4A 3ERCA 3DP7A 5DTMA 1M6YA 2O05A 2HMYB 3NW9A 3ELYA 1JG3A 1WS6A 2V74B 1UIRA 1D2GA 3P71T 2NXCA 2Z6UA 4PIPA 4RTSA 3DMHA 4GOMD 4GF5A 3JWHA 1NE2A 3MERA 2JH8A 3SMQA 4XUCA 4POOA 3VC1A 4RTRA 2IBSA 2HWKA 5DSXA 1F3LA 4PCAA 5DSTA 1L1EA 3FUWA 3P9NA 4ZTBA 3ID6C 3RIEA 2WA2A 1VL5A 3UJ8A 1DCTA 1BC5A 2GH1A 3WSTA 3MGGA 5DX8A 3UWPA 1O54A 2DULA 2IFTA
chains in the Genus database with same CATH superfamily
1JALA 1SU8A 2C7GA 1Z33A 4BIMA 3L02A 4TV8B 2C2WA 4B3BA 5B1SA 1UK9A 2F9FA 3A04A 4CIBA 3FVWA 1NG1A 1X1DA 3OTGA 1YQWA 3G59A 4IQ0A 4UE2A 4WL0A 4AS3A 5JCOC 2A0WA 4V24A 5DNEA 3T3DA 4BTEA 4HAVA 1FP7A 1CUVA 3L93A 3AOGA 1G18A 4LYFA 1I2ZA 1Y7PA 1TJPB 2PSFA 3B1KA 4XM0A 2XJ4A 2GJAA 4AO8A 4YV2A 1L3CA 1CY2A 5I01A 3TFOA 3RVMA 1Z7EA 1KZ4A 1Y1TA 2ET6A 3DLTA 5KKNB 4K5QA 4IG9A 2D5BA 1GZ5A 5BN5A 4RF4A 5LVAA 5KWEA 2NZVG 1QG6A 4P36A 4IDQA 4MQ4A 4MVJG 3IP6A 1AKMA 1Q1QA 1Z5GA 2EFYA 3I2GA 4M53A 4A8PA 1SBIA 2GVDC 2R84A 3UFDA 1ZM7A 4IOKA 4RSGA 4Y98A 5E6RB 4ZC1A 5TY0A 2H4XA 4INAA 3N07A 4E4YA 2R6R1 2VRBA 4W82A 2WKWA 3NTQA 5GJVC 3E9CA 2VZ8A 3S8MA 4N48A 3Q40A 1I33A 1E2KA 1KL7A 2O5VA 4PO9A 2ZR9A 3LO8A 4H7DA 4XWAA 3FSGD 1UMCA 1S3IA 5FADA 4JLSA 1N7HA 3RQSA 1GTMA 3ONVA 4LY9A 4O0MA 1KE2A 4GPBA 2WVJA 2B1RA 5EIBC 2IXEA 1H3NA 5HYVA 3MRTA 2X14A 4B3FX 4C2TA 4F2PA 3OQMA 3GAAA 4Q7KA 1A8QA 1UBUS 4C04A 2VJPA 3OHMA 5F7XA 3M6AA 4HYQA 2PUGA 4MUJA 5TQ0B 4BMXA 3EDMA 3PXBA 3TR0A 5LQNA 3P52A 1HYBA 1QQ5A 2CNLA 2P5UA 4L95C 2OCLA 4DZTA 2GF0A 3DBVO 3VO9A 1N5JA 3IVGA 4DYDA 1XRPA 4TKZA 3U60B 4DSTA 2ID4A 1I01A 4HXYA 3TQCA 5K4AA 1UJ4A 2OK7A 3OTOB 2HQ1A 1TK3A 1OFTA 2ADMA 1T5TA 4X4EA 1VHLA 2F9LA 2JJ1D 2WSYB 1XROA 1YD7A 1B0UA 4JJAA 5G4LA 3P2EA 3SX4A 4DIKA 4ZV9A 4LWQA 2Y92A 4PRKA 1B8PA 4KWTA 3AM1A 5I51A 1S02A 3ZYCA 1E3SA 3FYUB 2V9PA 5JJBA 5AKXA 3GHHA 4BECA 3Q6MA 2VWPA 1ZK3A 1CUJA 3GMTA 4RQBA 2YJGA 3BXZA 4LVOA 1HK7A 2XKBA 3RC9A 4Y9SA 3MCWA 1Q17A 3VKVA 1U0NA 2CE2X 1SBYA 3WRWA 5CB4B 5BV1A 3EIQA 4YJ3B 5HE8A 4TLMB 3T1QA 1FF9A 3VZBA 1UMKA 3LF1A 1Z63A 2CNWD 1DU4A 2RKWA 2PRIA 3J7TA 3WGGA 3ADCA 1WM1A 1MVLA 3PEUA 2CMHA 1KFCB 1KTIA 2ZM6B 1ID1A 3HZHA 4FFNA 4V3CA 2FH5B 5JSUA 2VQEB 3GNQA 3MNFA 1I2BA 3NZLA 5F9FA 3HJUA 2GQ0A 2MIIA 3LZCA 2VDOB 1GL3A 3SXUB 3SGLA 4IA8A 3MJRA 4HG2A 1XQ9A 2JVIA 5LYJA 3S70A 3VNAA 3WR5A 3ZOZA 2NZWA 1SHUX 4GPIB 1J49A 1ILEA 3ZH9B 5TV2A 4RE6A 1HQCA 1HH4A 3EUSA 4ZOCA 1L4BA 2F48A 1Z7WA 4FJ2A 5FNVF 1GKKA 3S5JA 1KZ1A 5AFSA 1Z4KA 5EP3A 4WOJA 1ORWA 3EGDA 5EZYA 4R9UC 1YVRA 3FKJA 4IUYA 4ZQFA 1X94A 3SSNA 3THWB 4U1RA 1AUOA 4UDYX 1KZ6A 2WKQA 2IZ1A 3KSMA 4YRDA 1ISSA 2NACA 4PIVA 4TTRA 1GCOA 2C57A 1LDYA 3H87A 4M38A 5EWMA 3KC2A 3TBKA 3V1KA 4AXXA 4P1ZA 1HRDA 4YCAA 3A05A 2CUNA 2HK6A 1DRUA 2O2EA 3A7DA 4D8YA 5ALVA 3L5OA 2GM9A 2MYNA 2R60A 4FCTA 4HTFA 5FYQA 2XI4A 1Z07A 2JHPA 1JFTA 1ESDA 3C3EA 5LBIA 2LYLA 1VPWA 4EG4A 2OZEA 3NYWA 3QW2A 4MCTA 1NUSA 3ZDCA 2ZE6A 4WOBA 3LK7A 5CURA 2I6XA 4GBJA 4FNGA 4RHXA 5BSWA 2CDNA 3QUAA 2D7CA 2E6UX 2RJOA 5C81A 4AMGA 5CFOA 1IC8A 5DYGA 2PXDA 1V5WA 3FVVA 4U2DA 4FCVA 3U9SA 3WLOA 3ZZNA 4C4OA 4PN7A 3I8SA 3R3WA 4XW2A 3ZCRA 5JYEA 1K2WA 4XCVA 2HDNB 1N2BA 1ZNYA 4MRRA 2C4TA 2VSNA 2VWHA 1EFLA 2HF7A 3PE4A 4N4AA 1K6JA 1MXFA 4UTNA 3V5NA 4KR3A 5FQOA 3AJRA 2BHTA 4OJMX 2NO5A 2QMZA 2X0IA 1NBMA 1SUSA 3KJHA 1I4TD 2R6ZA 4JELA 4WOPA 1T5IA 2JGIA 1TVCA 1WXEA 3JAKA 3AKDA 4KAXA 4MW6A 3F98A 5BVHA 2FOIA 3ROGA 3GLRA 4CNBA 1FFGA 4YUZA 4JT9A 4B7XA 5FLYA 4DBZA 3T8YA 4HL6A 5IARA 1MD9A 4M1TA 1NNUA 2PANA 5B4UA 5JD3A 1SXIA 4DLWA 4DSAA 4TVOA 4KH1A 3DEJA 1LI7A 4DV1B 1W96A 3IEMA 3B9BA 5JAUA 2VP4A 3A1UA 2BGMA 2ZANA 1BEEA 2OO5C 3H4IA 3JQ8B 2D8MA 2IPLA 3ONDA 4JHLA 1H2AS 4EABA 1R6XA 4MVXA 1J8YF 5DHPA 2EG5A 2Z4SA 2C1EA 2JGJA 1X7YA 4DM3A 2VUHB 2R00C 3PXUA 3LCCA 2PZ8A 3D3QA 4XGQA 3WRXA 2E5FA 4QOSA 3V1NA 5DX0A 1QB8A 1IXYA 1SCQA 3ETCA 2CV0A 3PI7A 3NP9A 5JO9A 1A95A 1E6UA 3BD8A 4WNAA 3MAGA 5TNXA 3K0CC 3IPYA 4RTQA 2A33A 3ZU3A 2X9GA 1UZLA 2PUTA 3MPOA 3WXMA 4JP1A 2PR7A 4M7PA 2JPDA 2Q0SA 5JE8A 4GX2A 3RJ9A 2IV2X 821PA 2P2LA 4NV1A 3OCZA 2WF5A 4QJ4A 4C4YA 2JIPA 1H1LB 4F97A 2DWOA 2ZSDA 4XYLA 3BK7A 4JS0A 1Z5UA 3HB7A 4FC6A 5F12A 2RGRA 5C3UA 4KREA 5KAMA 2B0CA 4ZDWA 3VR2A 3PV0A 1NNI1 3MT8A 4BE4A 1ZVMA 1AU7A 1PP4A 1JQDA 4ZVOA 2CJWB 2XAUA 4BNGA 3H17A 4CKZA 2HDWA 2YVLA 1OX4B 5DTEA 3EODA 3IQGX 3M5PA 1JW9B 1NBIA 2G4LA 3HKEB 5FORA 2UZ1A 1TYBE 3LA6A 3T61A 2GPAA 3R0JA 2J31A 3DLBA 4JI3B 3UB2A 4FIDA 1DBQA 2C9OA 3P45A 3ADPA 3CSSA 5ISMA 5TPWA 2C9DA 1N9KA 4XDYA 1PAUA 1LZLA 2OHJA 2WZQA 4OB4A 3B7HA 3LHDA 1U2PA 3IP1A 4ZQIA 2QRLA 1XG5A 3RSCA 4W1RA 3DF9A 3KFLA 1XA0A 1D03A 3OFNA 4LF9B 3STHA 3JQ6A 4Q34A 3IAFA 4J1XA 4PQFA 1TUGA 4QU5A 4DN6A 3C97A 3NVAA 3FPHA 4PRZA 1AGPA 3EMVA 1NI4B 4NNPA 1XVUA 1D6NA 3FFWA 3NOOA 3Q8XB 1T4CA 5ELLA 5AR1A 4N47A 3TH5A 4EGAA 1P8JA 1A9XA 1FEZA 2L17A 4W6QA 5HCNA 1E3IA 4YNBA 1HQ1A 1D0SA 4A1FA 2XOKD 3RVPA 1F6WA 4GOJA 2LDBA 2NG1A 3WK5A 4JZKA 3UAXA 1BA2A 1DEHA 1OV4A 2ZI5A 1Z13A 4KBGA 4ZEMA 2XCTB 2A7XA 3EUFA 3VR1A 2QRJA 1JEYA 3BRWD 1O0SA 1V9LA 2HHAA 1GILA 3C3MA 3SKVA 4I2VA 2PPXA 3Q9LA 1JHOA 2XQJA 1T91A 3UB3A 1C1DA 1H2EA 6REQA 2GKOA 4ND1A 1KY3A 2ZG6A 5BWCA 3IB3A 1S1CA 1OBVA 2FEWB 2PVPA 4E94A 1VE9A 2OB2A 3DC2A 4D0RA 1AH2A 1JIQA 4CQLB 1VI5A 2P4QA 2ZWIA 3CKKA 1E4VA 4JA0A 4MW1A 4TROA 1P80A 4ETIA 3D5TA 3HWWA 4P3YA 1SG0A 3HYNA 4D74A 4E09A 4MKRA 4TXMA 3DDCA 3T6KA 2XIQA 4R1QA 1II9A 2H3HA 2OVFA 3CRQA 4FUQA 4OB7A 5GONA 5IXYA 3U9LA 3NC4A 3X1WA 3NMUF 1I14A 1J23A 1AF7A 2OQRA 3NYIA 5HJ7A 2Z58A 1XRLA 3IBFA 4HH0A 3WDKA 2WK1A 1DBRA 1KSGA 4R8KA 3HWX1 1GNTA 1TO2E 2YN4A 2SKCA 5DM60 3FBTA 4OJQA 5K6TA 4EAQA 3MRVA 4D92A 4PR3A 1X7HA 2FSFA 2V7TA 3X44A 2VJAA 3QEMA 1UAYA 2H7XA 4Q4JB 3WB0A 1PG5A 5JALA 1MRSA 1U3VA 2BEJA 1KRWA 2J33A 4G0XA 2Q0HA 3K4PA 3PENA 4NL4H 4MPJA 2NVUA 3KAKA 2ZJZA 5A7FA 2HIAA 4E70A 4ZZ3A 4DR2B 2EWTA 2E87A 1P39A 3GH1A 4GM1A 4R5MA 4TTAA 1M0SA 1COZA 1ONSA 4HQOA 3URMA 2O8CB 5E2IA 5IAEA 2O8EA 4BAUA 4RV4A 2JHAA 5B30A 1VBNA 4QOIA 1N2CE 3CH4B 3NGXA 4QUBA 4UAUA 4OXXA 5ICEA 5BRJA 4TTJA 1XPRA 4BQOA 2ODTX 4ZC8A 5J40A 2G06A 3WWOA 3A2NA 1TAQA 1FJXA 2JI7A 4DB2A 4OL0A 2WJPA 4QFCA 1BX1A 1ENPA 2XUIA 3T94A 3WWZA 2FN8A 3UIEA 2ZQ5A 3HG7A 3KLOA 2ZRHA 1I2DA 2ZS9A 3CIFA 3MT9A 4H9GA 5FTWA 1CF4A 4KIJA 4I50F 1Z16A 3TRBA 5EUCA 3QWBA 5BO5A 4A91A 1GADO 1G8MA 4L6AA 1L7EA 2I29A 2NO1A 3KOYA 3GA7A 3AP2A 3E9ZA 1XU7A 2EJVA 4WXRA 3VAAA 3JD1A 2ZS7A 3UUFA 1TYEB 3E6AA 4RHCA 3BB4A 4CG1A 4E2YA 1GNVA 2IYPA 5LMCA 3OKAA 3ZDDA 3DXYA 4XASA 2JAWA 4LYDA 3WK4A 3NM5A 2PT6A 1YRBA 2QY9A 3JALA 4L72A 2R8EA 3ELDA 4OHBA 4PZ9A 3W34A 4D81A 4UNRA 2COUA 4ZYXA 2Z1MA 5JSZA 4V0NA 1E0KA 2GESA 4G09A 1DBWA 3TN7A 2P1ZA 4IFIA 1TM2A 3KLBA 1P2SA 1NOIA 1RW4A 2XWSA 4DQ0A 1QO0A 1IE3A 1C9EA 4GR5A 3TRFA 1TW2A 3FTEA 2MU1A 4Z3DA 3K9QO 1UP6A 4MDHA 4Q15A 3VAYA 1IXKA 1DX9A 2FW1A 2BMFA 3EGWA 4LRSB 1QRDA 1U7PA 2BMVA 4ND2A 3QEOA 4AWXA 3VPFA 2OBFA 5EJ9A 1NEQA 3KYCA 1M6NA 2CKMA 4JASB 3AXTA 4US1R 2IVGA 4V0QA 5F1YA 3VKUA 4UUPA 1AKUA 2O49A 5K3BA 5A2QA 1JIVA 3GJ0A 2H11A 1SQ0A 4LXIA 1X1CA 2G71A 1OYWA 3I6BA 4P7JA 3T3HA 5G3YA 1NVBA 3AO0B 1OR8A 3VK0A 1RT9A 2FNAA 2UKDA 4HGPA 3JAWB 4LVCA 1ORDA 2CHGA 4WT7A 2LKDA 3CCFA 4FWTA 1VIAA 1G6HA 5D7NA 1XMVA 4BMPB 4Y2YA 1EHCA 2VHCA 2IU0A 5AVVA 4LOLA 4AB1A 3K9CA 4TZ0A 3H2HA 5FAXA 4JD5A 2O2XA 1YTUA 4HNGA 1KK1A 4MUEA 3TMKA 3EFEA 1Q0UA 1TEXA 4P34A 2GM3A 2IITA 3EUAA 4X9XA 4Z1MD 4AM8A 3O90A 4N0MA 3SU8A 5KDDA 3TG8A 1SUIA 4DV0B 2AG0A 3DD5A 2K4MA 3TSAA 3UJDA 3Q1LA 4OPMA 1D2CA 5HNKA 2FAXA 2ZXUA 4FQ5A 3TRIA 2C2MA 4BUCA 2QLBA 4C0HA 2GPWA 1QIIA 3OX1A 3IUNA 1SUWA 2G9RA 2VBFA 4RFLA 3RJ5A 3SPXA 5L7WA 1C0IA 3BE6A 2P2DA 4LISA 4NQZA 2R85A 4QDUA 3MELA 4MI1A 1U80A 2NSHA 4KFSA 3ZNQA 1GGFA 3MERA 2JH8A 4I6EA 4CF7A 3PHJA 3V2UA 3GEIA 2C5FA 4BFWA 5LWQA 4MAFA 4RKFA 3WA7A 2W9XA 3PIIA 3DZHA 3EXIA 3VZSA 1C7ZA 3DT6A 4B9EA 5IU6A 2Z6VA 1L8QA 1SCUB 4TVBA 2UZIR 3WSTA 3PDWA 1LEHA 4LSZA 3U16A 2R1ZA 3GCXA 3IC5A 3C3BA 4C5AA 4CRWB 5KCMA 4HS4A 5KDOA 5TJHA 1FXSA 1LLIA 1NQTA 1ZR2A 3EBOA 3L8FA 4YCSA 2W6ZA 1RDFA 5JQGF 2XY4A 2OGZA 3QE0A 3V46A 4R16A 3A70A 2P6RA 1U0HC 3QX8A 4HNTA 1JIXA 4HQFA 3NCHA 1YC2A 1SWVA 3OP9A 1ADYA 2HPVA 4MJLA 1L4MA 1N2IA 1AKVA 2BSAA 4O6VA 1NW3A 2ISCA 3NDIA 4X3OA 2YRWA 1CB7A 5AM3A 5L4NA 2NSDA 2IZ0A 1XXHE 3BS3A 1GFIA 5LDHA 3UGJA 2ZIUB 4FKMA 3V4ZA 4LGMA 4JUCA 2OWEA 2XTAA 2J0UB 4HMPA 4Q3AA 3I2JA 1EFVB 4A8TA 4BFVA 3G9UA 4DWOA 1SXPA 3RJZA 4Q37A 2B83A 5BW6B 4N7JA 4CGYA 4A26A 5KDLA 1D0IA 1Q3KA 4IFBA 2BE7A 3RCBA 1DXYA 1K8XB 1LLUA 2PWPA 2QOEA 4UNNA 4Y2QA 1X7ZA 1TK9A 1VA5A 1Z5WA 4HDRA 1E9RA 3QFCA 2XOEA 4D8TA 1G16A 3ZWYA 2QB5A 3GVHA 3RS4A 1I5EA 3OMTA 2I67A 1KU6A 1HT3A 1RAFA 2PXEA 2AS0A 2E9SA 2PWYA 1WVGA 3LX5A 4QAQA 5LA6A 3LV8A 1C7IA 3E81A 3HY3A 3NAZA 3PYMA 5JT1A 3EHEA 3IQXA 4KBYA 1NVVR 5GIPE 2CLCX 4IX9A 1ZEMA 5CX1B 4S05A 4NZOA 1B43A 1IAVA 3BGVA 3N8HA 5DFAA 3B7WA 3EXG1 4MVJA 3QVMA 5TX7A 1L5NA 2O8EB 5F7OA 5K1ZA 1TADA 3ZDYB 1VP3A 1H5NA 2AF4C 3B9QA 4ZDIA 5CFZA 3T3MB 4TMZA 2WUFA 3WDMA 4DSOA 3GFBA 5EJ6A 5DNDA 1N0UA 1KMHA 1IM8A 3B1YA 1YZGA 3VPXA 1XU9A 4G25A 3UC9A 1TJNA 4DLRA 2XMCA 1H3EA 5KTPA 3EVBA 4ITUA 4HGOA 4HGYA 3U7GA 2BI8A 3ZDZB 3QK7A 2BEVA 3IURA 1KR5A 2QW1A 1RWBA 3KD3A 2PX8A 2RGNC 2WYOA 3JQBC 1COWD 3RK0A 3KJGA 1U3UA 4AJ2A 1XJQA 1WEKA 4JR2A 1Y6QA 3SWWA 3AINA 4PCVA 3TSYA 2XUJA 2PAAA 1EDDA 2V4MA 3KZVA 2DHRA 3L1JA 1L5KA 2QF7A 3C8UA 3VBCA 3G49A 1HDYA 3GGDA 4LHSA 3A1SA 1UF9A 1ZWLA 1MB4A 1XA3A 1ZISA 2UYHA 4LBWA 4OY3A 4XB1A 4BYMA 1V8DA 2HQBA 4Z7NB 1OJ7A 2FN3A 1S1MA 4G8DA 1GPWB 3OEWA 4UBOA 4WV3A 3VVBA 4AJOA 2WFLA 3AY6A 1YRLA 3ZY5A 3BWMA 2KM1A 4KLZA 3O7MA 1ESZA 4S0XA 5CBKA 1BKYA 3KAJA 5EXTA 2W4QA 3FXAA 4GBGA 4BLTA 2L18A 4UU7A 4ARIA 4AK9A 2EZ8A 2IUSA 1L4UA 1K97A 4FR2A 4D82A 4FDLA 3OOSA 3C8HA 4JLKA 2J8ZA 5D85A 2PO5A 3PGJA 4I2NA 3OZSA 2WJJA 5BWNA 2HLNA 5AO9A 4DUYB 1O6ZA 2NTVA 3GNLA 2AV6A 2I6GA 1U0EA 3B6MA 3C7CB 3F5SA 3GJXC 3JARA 2ODQA 2WU8A 4KYUA 4OHCA 4D4JA 3TRJA 3A1WA 3F7OA 2PGLA 1ZHOA 2V3VA 1GQQA 4PLYA 4AC9A 3UOWA 3OU7A 3K15A 5G2OA 1CJSA 3PWKA 2D0OB 3SLGA 1US8B 4DEVA 4GGOA 2GTPA 2D1TA 5KYYB 5IEBA 3TRDA 4D4HA 4D0GA 4C06A 1H0HA 3LC7O 3RYCA 2GNPA 3H84A 3Q8WA 3A9TA 1HF3A 4DCGA 2FSVC 4ATNA 5I6DA 3CH7A 4IIEA 1FS6A 1D4AA 2JKVA 4RMGA 4QUKA 2XYRA 4WESB 4NFYA 1CEQA 4ZOLF 4PFSA 3OU6A 2OZPA 5KYWB 1CUAA 3ZGYA 2FE1A 4LQLA 4I1UA 1TCBA 4CEJA 4WCFB 1FLAA 2YN2A 3V00A 4CT5A 2UVDA 1T0PA 1VMKA 3OQHA 2AEJA 3F73A 1RM4A 2J4CA 1QF9A 2QS9A 1JYSA 3QYFA 3OIUA 4KE9A 3UQYS 3VHQA 5ELXA 3I2HA 4JU9A 5B6JA 2HKIA 4F2DA 1KMIY 4I08A 3S7ZA 3U6KA 2VJLA 1MJGM 1JHAA 2RG7A 1E3TA 2IC5A 3GVXA 4KXFB 3JU3A 2EW2A 3VH2A 2GN2A 3E7FA 2WIJA 3HDHA 4O4JA 1D7AA 4ROSA 4M99A 4CIDA 1Y6GA 2P2SA 2VP2A 5GOTA 1B73A 4CM6A 3EXAA 1Q0RA 2OBMA 4WZAB 2R7LA 4JNCA 4TSFA 1V7CA 3WNCA 3WLLA 4JLAA 4IQFA 3SBEA 5A6SA 3DDNA 2XR1A 2X0KA 4XIYA 3EISA 3CEMA 4WZBB 1TZ2A 1ZI9A 1X14A 5C9ZA 1D6SA 2FMKA 5J47A 4HAOA 3RT1A 3SQXA 1YJ5A 4FTWA 2QLFA 4I4IA 2BM8A 5KCZA 4FYHA 4LMAA 2ZRCA 3IDZA 4DXDA 2R7MA 3EZ9A 1G9SA 1M2WA 3E1SA 1E4EB 2P5SA 5D3MB 3DAYA 1DO0A 1P31A 1YS7A 3FB4A 1FW6A 2VWGA 1OWOA 3VA7A 4AN4A 4FHGA 3WLAA 5BSHA 1K4YA 2OPHA 1NLZA 3JR7A 5KHAA 2XUKA 2GJKA 2C7VA 3W6OA 2BFWA 1HI9A 3OJFA 4QICA 4ZQEA 3S2UA 1I6WA 2DT8A 1PHRA 3DOEA 1KVTA 3KZOA 4EENA 3MWEA 5FH9A 3G7DA 1JDZA 2HEGA 2ZYSA 4QO8A 1U0SY 3ABQB 4C5BA 1G98A 2QUJA 1JWBB 4KI7A 1W5SA 2IYLD 2IU6A 4ZEWA 3DVAB 4AF6A 4YALA 3REQA 5CDHA 2B36A 1YQQA 4Y1FA 4BO6A 5HKKD 2BR4A 1G21A 1PZGA 4L4RA 5CEFA 2VKQA 1N7JA 3NUGA 3PNYA 3RW9A 1PGNA 1ZBDA 3ICWA 1FQJA 3ANXA 4G5OA 3DOOA 4JKOA 1XQVA 1XF9A 1JDBB 1JXMA 5AM5A 4CF6A 4TYNA 1EFPA 3OURA 1XWFA 4XYMA 4DQXA 2IEZA 4BFLA 1M1YB 1E2LA 3C8DA 3FCOA 4GI7A 3V2IA 1JLLB 3KWLA 4D4LA 1W85A 1IQ0A 2W7TA 3DUFB 1P6UA 2X40A 3IVRA 1HPLA 1Q0LA 2BE9A 4KJXA 1H8HD 3CPEA 4DF3A 1XL1A 2RD2A 3R24A 5JWOA 2XWJI 2W71A 4IILA 2PRSA 3JATB 4FGUA 1USKA 1IN1A 3HUTA 2GFHA 4L7VA 3TIVA 3RO7A 2X3FA 1ZXBA 2W8ZA 4HAYA 3B89A 3BFVA 1N33B 3E7PA 4FT4A 3O6VA 3WY9A 1L8OA 1CJKC 1H2BA 1DKQA 4N3AA 3TJRA 1TIBA 4WZ6A 3T7KA 4ZRMA 2XJ9A 1EVQA 1CYEA 3KZCA 4EMBA 4B33A 5TVKA 2EX1A 3HR4A 4Y2GA 3WADA 5BWBA 5D01A 5ENVA 2HJSA 4EBBA 1OV6A 1R50A 5EE5B 4B0PA 4I1VA 2WSLA 1C80A 1YRAA 2NXWA 3FZEA 2O52A 4KW7A 2FKNA 4QFDA 1JB9A 1DV1A 4M9SA 5AIAA 5DULA 5FNVA 3ZNOA 4C7MA 2ZIFA 2F59A 1B1AA 1KFEB 1YU6A 2R7KA 3W78A 4BQRA 1P44A 2BFEA 3X1JA 4QDXA 3USZA 2XRZA 1NVFA 1NT4A 2Z2KA 3HLKA 3G6WA 4KCGA 3OZDA 4FFDA 3TYXA 1VRWA 2SHKA 1IBKB 1CD5A 1EDEA 3DLIA 4FIZA 2VXBA 1MABB 4NC9A 4CU2A 5AW3A 2OC9A 1T8TA 2PL5A 4U5XA 1QR6A 3VTZA 2IS6A 4TPKA 1JHPA 3CQ9A 3MINA 4L51A 1ZRNA 4D46A 3NHJA 1DWPA 1M8GA 2EFEB 4D6XA 1V2HE 2QLNA 4AKEA 3DWGA 2HJVA 4OQ4A 4IUCS 2AX3A 4WLOA 3WTBA 4D8VA 2AFIA 1S4MA 3JD4A 4MV9A 5A5DA 4WLFA 2B92A 3ANLA 4GRAA 1OMOA 2Q1SA 4Z6KA 3MHTA 2NP7A 4BZQA 3OAAA 5TGDA 2YXDA 1CFJA 3PWZA 3N9IA 2GDJA 4GRIA 4IEIA 3L0OA 5SYMA 1JG2A 3LNCA 4GVLA 4P4TA 4NKRA 5EE3A 3T3EA 2VL7A 4ZYLA 1RPNA 4E7PA 1HDOA 2DH6A 3H2ZA 4GOKA 5LOVF 1PIWA 2BELA 2ZRPA 3LFPA 1I4WA 1KY4A 4L5JA 2OXEA 4MR8B 4HZGA 4PVDA 4RVNA 3LQQA 2ZYUX 1BFDA 5G0SA 1LMB3 1ZW1A 2Y0CA 4WNIA 5CG1A 4B3TB 3PEVA 3FHTA 4O2BB 4INZA 4JGIA 2VHJA 1BE1A 5T4BA 1MJ5A 1S5PA 1N3YA 1JN0A 1KO4A 3TTYA 1FCJA 5SYAA 5H3HA 1M34B 3ZGXA 2C2KA 1KU0A 1BAPA 3JTEA 1Y9DA 1NJ2A 2SICE 4IXDA 4QEDA 2DUJA 4W8HA 3N0VA 3JVUA 3DW1X 4TV9F 4F2WA 4XFKA 2PYZA 1K2VN 3IQDB 3HPQA 3DS8A 4PC2A 3BFXA 3IIMA 3QUQA 1G41A 5LZ9A 4GP6A 1WXGA 2NU7B 1EQAA 2ZJ0A 4YK7A 2BI7A 2AR9A 3PNLA 1BW9B 3FOFC 4MJ7A 3TQRA 5H81A 3ZU4A 2PVCA 1OI3A 4BNTA 5BUSA 1YDWA 5K3CA 3KYDB 2GTHA 4FSDA 3MAJA 2ZRKA 3VU9A 4COOA 2WSBA 1XTBA 2XITA 1AQ6A 2XE6A 4US2R 4UDOA 1Y5RA 2FZLA 5LXTB 1UFQA 1Y4UA 1TOAA 3GDGA 5I3ZA 5ARCA 4JENA 2G72A 1J97A 1K5PA 2G82A 1A5ZA 3HZZA 2VDQB 2PA3A 3PNSA 5H3LA 3ZJTA 3SE0A 1PERL 3IKLA 1GTZA 2PSEA 1MFQC 2J0EA 3AX6A 1KO7A 5KAPA 3EVNA 4N5IX 3OQPA 1BRMA 1OLUA 5DCWA 4N8EA 1GGMA 2XZOA 1MAUA 2Q8PA 4KZPA 5K0SA 3WK8A 1HUQA 5FI1B 3LYHA 4LY6A 4DIOA 3WGYA 3WNBA 3DTVB 2X41A 1QTRA 2FEPA 4XFDA 5L3RA 3S2YA 2SCUB 5JD4A 3I73A 1RJGA 5DLDA 3AM3A 2QN9A 4ZCSA 3I3OA 1TLTA 3CGGA 3KQWA 4ARZB 5LQMA 1JA1A 1WUJS 4ZCRA 3WWDA 3ITKA 3Q2KA 5C52B 4ZTZB 1G3MA 1MGPA 1DBIA 4ND6A 1EWRA 4Q4AA 5CM9C 2Z5FA 3AIOA 1T6ZA 1T5OA 3B7PA 5U1PA 4Q3CA 3V55A 4J0FA 2FZGA 1W8DA 4D9JA 2G0TA 2JK0A 3PDUA 4W5NA 1KAGA 4Z3KA 1ZZ6A 1Z2DA 3K9BA 2CDBA 1PF7E 4FB4A 3E5HA 4WK2B 1UAGA 3SVZA 1U8YA 1SU4A 2C8JA 1DQSA 3N70A 3HA7A 1ISHA 4UEKA 2M98A 3UHOA 4C7KA 1X1RA 4DJFC 1P3DA 3T1HB 2RHRA 1I32A 2AN5A 4GKJB 3UJAA 3ZHBA 4AF8A 1E61A 3HCNA 4ZREA 1PGQA 4BNUA 1XI2A 5BR7A 1OX5A 3MEQA 2MTBA 2BNOA 3S2IA 3VUEA 3P8ZA 2WOJA 2NQTA 1UZNA 3D31A 3QKRB 3M6WA 2IZZA 3QPDA 4Q3KA 5ALWA 3EF1A 5DU2A 3UBMA 1OBFO 4LJ4A 5HVNA 3U4MA 2H5JA 3NDJA 3ZEIA 4N54A 4I8IA 1VE7A 2NO9A 2Y27A 4F1WA 4G0NA 4M36A 4XQGA 4MAAA 1E94E 4BKOA 4FFMA 1W1WA 3CLTD 3EQ7A 4I3GA 4QYIA 1GIAA 2BNMA 3RS0A 4DCUA 3QBTA 1N8KA 4NV0A 1ZONA 3W79A 4RFSA 1FVOA 2FQXA 3GJTA 3ITNA 4K9QA 4AZTA 2EIXA 3LUFA 3WWPA 3HKCB 1C0LA 2Z8YA 3TJMA 1SM4A 1LXCA 3QVUA 4Q1FA 2TS1A 3IHKA 3DEIA 2J48A 2EV9A 3B60A 2XNSA 4OJYA 4MYTA 3TTVA 2QROA 3F1LA 4EARA 4MTCA 4FSHA 5FBZA 4HN4B 3UO8B 3GRVA 4QNMA 1BFUA 1H3FA 1CZUA 3IE2A 2E55A 4OI4A 2C9YA 3GLFB 3LY7A 2OR1L 3B6EA 2VJMA 4QXPA 3AUAA 4TL9A 3F90A 1G291 5JOQA 3FMYA 4J4BA 4B3GA 3K96A 5HWSA 2D3WA 2OENG 3OX3A 3TFLA 4OYRA 4BLOA 2AI2A 2QP4A 3JWHA 3PR3A 1LS6A 3C1UA 4XWGA 4BZZA 1UODA 3DZ8A 2O1WA 4H17A 1S8OA 1FTWA 1M5RA 5CX4A 1F3LA 1K1EA 3ICCA 1L1EA 3FUWA 3H3JA 4PCAA 3ID6C 4A27A 1NPTO 1VL5A 1PGPA 4BFUA 1ZCZA 4L5CA 5CW1A 3VSBA 4L16A 2DULA 1EIZA 1NJ5A 1Z35A 4BMNA 5KSOA 2BCGY 5CYFA 4O2AB 4C78A 2DU8A 3H5RA 4M0UA 2DFVA 2PLRA 4OUDA 2P69A 3PWSA 1CT9A 1TCCA 3R5SA 4F4DA 5HJ5A 1XWWA 5ANRB 3O8NA 2R79A 2AZTA 4MO9A 3VR6A 4ZHQA 1YJCA 2V45A 3BM5A 3KAQA 3I28A 5LKRA 1FSSA 2BEWB 3GPBA 5IKPA 4UTPA 4FHEA 1EDOA 4TQ9A 5D00A 1G63A 4QDJA 2CXQA 4Y2XA 3SC2B 3GN5B 2EP5A 5EWJA 2XVYA 2OFYA 5BORA 1UCFA 2ATIA 3NV7A 2HXGA 4NZZA 4PFJA 2VHVA 2OPBA 3GI1A 1QHHB 4PZPA 4RJ2A 3C41J 5TARA 1SFRA 4EHNA 5JH7A 3AVXA 2I4IA 3PD0A 5GP1A 2PQ0A 5CD1A 1J39A 1VA4A 4H35A 4KGXA 4DA6A 1CDOA 1RKBA 2IXDA 3TI9A 4LOIA 1GSIA 2JFYA 2JIDA 3DLAA 2NU8A 3O8LA 1FSZA 3CLTC 1DOHA 4U7FA 4BAZA 4WNYA 4E08A 1BOOA 3KSAC 3DBLB 5IC6A 2B9VA 3W5CA 2P9EA 2RG1A 3P32A 2Q5CA 3BQNB 2BFNA 5AKHA 1Z12A 4YRPA 2PE5A 1FSPA 1C3EA 1V25A 1ZY2A 3GLUA 4JI5B 4YDRA 5EZQA 1QIMA 1UBTS 1L7NA 2JARA 3AR2A 3OWOA 3IUQA 3PHCA 4PBRA 3TEJA 4DW8A 3NPAA 1Z6QA 1LFAA 3DPIA 3E7WA 4QYSA 3UF0A 6LDHA 1JX6A 1UIMA 3KOMA 4MGKR 3WWEA 4EPVA 5ALSA 4PHHA 4QOJA 5GQSA 4ZWNA 5I9TA 1LBEA 2BAGA 3E3MA 3R9WA 2JIQA 2Q4BA 1W46A 1M2HA 4KWIA 3F74A 3T9EA 3GDHA 3H11B 1HZJA 3ZHZA 2ICAA 3FMGA 1LRKA 4YAIA 3TCXB 4E30A 3EDOA 1YAHA 1E4OA 1JAZA 2R751 2VRCA 3KJIA 2C3YA 3R7AA 4C2AA 4CCYA 1Z25A 4BWGA 3K0HA 4PZLA 1UM9B 3JPWA 5FHRA 4JU8A 5JNUA 5CLQA 4I3HA 2JBHA 2I9KA 1JXOA 1EP2B 4NCNA 2J67A 2O8CA 3BB1A 3TRKA 4M7WA 5AW7A 1EXDA 2HSDA 1U8XX 4ZO9A 1EVEA 1IB6A 2I66A 3WYCA 4C7OB 3AR5A 4C0BA 3B1JA 4ZVNA 4O8BA 4LFCB 1Z2OX 2DUMA 3F4KA 4G4GA 2JS7A 4RO0A 2BD0A 4W99A 4PN3A 1C8BA 2P6OA 1V96A 3BSWA 4PZEA 3UYKA 4YRTA 2VCYA 3MGKA 1CX9B 2L42A 3JWGA 3ZW8A 2VTDA 3ULKA 1U5CA 2D1QA 1J20A 4OVKA 5EQJB 1U5AA 3TQTA 1MH1A 2Y1LA 4A8JA 2FPPA 5TC4A 4EW2A 2CV1A 2GZ2A 4K6KA 1W36D 1TKCA 2X58A 1U7HA 1FNNA 3LT4A 3JYNA 5I7SA 3DYBA 1VP9A 2IHTA 3JQEA 4CM4A 4DEYA 3O8CA 2EL7A 4RCYA 1RHMA 2XH8A 5EOVA 5TPZD 1JHXA 1P7WA 1S8FA 5BQXA 5L95A 1OWNA 1Z0UA 3A6KA 4O1MA 5BOSA 1W5AA 5FIUA 4X00A 3AJAA 3LPCA 5EHGA 1ULSA 2JD2A 1K8ZB 2JI8A 3EXHB 4CIYA 3UY4A 1HDZA 2VHWA 1WQ4A 4BRWA 3A25A 3M81A 1L4HA 4R2KA 1Y5MA 1GCUA 2Z9CA 2JAOA 3A26A 4H3VA 3RUDA 3EWNA 3W8RA 2GEFA 2QMUA 4EBFA 4Y6LA 2DF8A 5HPYB 2ZW9A 3SP1A 2BFFA 1MTOA 2HMUA 1BS2A 1JTVA 4YJDA 4XR4A 2AYZA 2EKDA 5ALIA 1J25A 1JPNA 1UMDA 2P6UA 3ER6A 2IEGA 5C4IA 3IRUA 4GBED 4H08A 1OILA 1ZLYA 3QE3A 4C3ZA 1P9NA 1EVLA 4XSGA 2H2IA 2UXDB 2ZUUA 1DUIA 3LWDA 4B0OA 4CJXA 3U44B 3W90A 3RVJA 1E58A 1HLPA 2EJUA 2QZJA 3ABZA 1A76A 4ZI7B 1ZI8A 1IZ7A 2FE4A 1NNSA 4RM3A 3NXSA 1SB9A 4O4IF 5JQGA 1E9CA 3NBKA 1TC1A 1F6BA 5IYZF 4H7EA 2M32A 5E8JA 4DCSA 3UOGA 4DMCA 2BKAA 1ZCJA 3IQIX 3OUTA 4UHHA 1BU8A 3CVJA 3ZQUA 4IINA 5DWVA 5AWFC 3TVTA 2FFBA 5GMOA 3BGIA 3LQYA 2V7QA 4XJVA 4JWTA 16PKA 3IS3A 5CVTA 3V9AA 3DMFA 2CN1A 5BN4A 1O77A 2A5JA 4GMDA 4XJTA 3OZWA 3SS9X 1LF5A 1XDGA 2Y1DA 3NTUA 3ROXA 2C1XA 4F6RB 3S27A 5JYBA 1J9EA 1GL7A 1NRXA 1M0WA 1WP4A 1C3JA 1CRZA 4H1UA 2ZJ6A 5T6BA 2AWNA 4EP1A 1XDDA 1TGYA 3KNZA 1GYRA 3MBIA 2CHEA 1FZQA 4XARA 3LVFO 1KAHA 1W36C 1TPYA 3PLRA 3P96A 4XVHA 4IDEA 3RRFA 2ZCVA 3D3WB 4K2HA 1QPZA 8GPBA 1JQKA 4A03A 5BMVF 3MLFA 2O6LA 3PF9A 3V97A 4CR6A 1QZXA 2Z98A 3KJXA 1G3IA 2IYVA 3G82C 1KI7A 1DFIA 4KGDA 1M2GA 2WLTA 1HT1E 2DHQA 3I9JA 5JV5A 4UCWA 2ZRIA 4CLOA 3T3OA 1KBOA 1JLRA 3TNYA 1GKUB 1HLGA 2GBCA 4B3SB 3MMNA 1MP0A 2CNOA 1I4EB 2FHSA 1KR2A 2VPYA 3ESZA 3IKJA 4UULA 3GF4A 3BG5A 3AM4A 1OZGA 3D7RA 3FNRA 2ZSFA 5FXMA 4RPJA 2VPQA 2J6CA 3OJWA 4OBBA 1HSOA 2IELA 5TS3A 5MN5A 5FBHA 3OE7D 2H7CA 3PFCA 4G07A 4IL5A 2OSVA 3UMJA 4JGGA 2VTEA 5LZ4A 3C6QA 2DB3A 1U1GA 4LCBA 3IUSA 3NEJA 1QFSA 3V8BA 1IRIA 4EAAA 1ADCA 1HZZC 4US0R 3BKWA 1GEEA 2ZYIA 4MRPA 4LY3A 3VR0A 3W1VA 4IKOA 5E1OA 1YZNA 2NNLD 1E2FA 4IOMA 3NJ8A 1J8MF 1MU0A 3RBAA 5BN3A 1I9GA 3UPTA 2B20A 2EKBA 2EZUA 2NUBA 2F55A 1XWRA 2ZZMA 1XZ8A 1CXZA 4I8XA 4OQPA 2C0PA 4R2HA 1EGMB 3P9KA 1ACLA 1K4KA 1PBTA 2QDXA 4Y30A 1PLJA 3QV1A 5HQ3B 4GYKA 3AK4A 1MQSA 3WKBA 1X9IA 3K4QA 3JSAA 2RH8A 4ITVA 2HDOA 3T4UA 4FU0A 2GZHA 1WCYA 2OCPA 5L8VA 1BHSA 1HETA 4J9VA 4OGFA 1Q3TA 3ESYA 2BGJA 1VI2A 2WM3A 2H29A 4TRJA 2YXNA 4RTLA 4J0IA 1ZKMA 3QMMA 3Q3IA 4PZYA 2GM4A 2C61A 1MZVA 2MR5A 1L7RA 3S6JA 5KNCD 1JSZA 4ABTA 2VPIA 2XGGA 4F72A 2QNRA 1QAOA 1R9JA 3FCAA 4I1YA 5LR6A 4KMOA 3T1YB 4MTLA 2CBXA 3OVMA 1F1BA 1LQUA 1WF6A 2QG9A 4YJGA 3EEOA 3JTMA 3W9YA 2YWFA 4EX7A 1PWZA 2M9MA 3DB1A 4BBZA 2P62A 5E6UB 2X9VA 4JYPA 5B3AA 3MJVA 3THXB 1CR1A 2HU2A 2UUOA 1DAHA 3OWHA 2Z8XA 3ONNA 4ND8B 1LLQA 4S04A 2D7DA 5DBEX 2GSWA 1UJCA 4R54A 5A3JA 1YQXA 1ZW6A 4E5KA 2JVKA 4F46A 2I91A 2AUTA 3IPXA 1R8XA 4YV1A 1CP3A 2IHUA 2XNDD 5UKDA 2PX4A 4M21A 2PN1A 1W88A 4R3WA 3HC7A 3K9LA 1XD8A 4YRRA 4ZOLA 1NV9A 1Q50A 5K99A 2HPAA 5EI5A 3HXOA 1LK7A 2XHZA 3BJRA 3IOMA 2ZBQA 2ZJYA 4OQMA 3NBXX 5EIFA 4A23A 2PKRA 5L3ZA 2BONA 3DUWA 4QXOA 3M9LA 5IC5A 3JWIA 2AMYA 3ND7A 1FNCA 2WIKA 5ITWA 4U3JB 5F77A 1EB8A 1SXJD 2HLPA 3IPCA 4I5DA 2JHGA 4ZO6A 2OD2A 5HM8A 4Z4HA 2X5OA 3F8SA 4E13A 2DE0X 2ENWA 2VJDA 2HJ9A 1E79D 4ZV4A 4MQ5A 4RF5A 1U2GC 4Q7QA 1PTJA 4RMHA 4BKRA 1QYXA 2GF2A 5JCPA 3U13A 3U4QA 3ICEA 2X0FA 3TMAA 3AEKB 4V03A 3SCFA 3BMNA 4M6WA 1ZD2P 3KT6A 3UXHA 4YPVA 4I3FA 4S2EA 3DWFA 3HH8A 4CUJA 2XQGA 4BLSA 4TTTS 1QHGA 4PYOA 1VE5A 3HYLA 3BRQA 2HYIC 3LHIA 4LZJA 3C39A 1H8ED 3ETEA 2WI8A 3FI0A 4L0CA 2OQVA 1T0BA 5FBLB 1WZIA 3K0AA 3U3DA 4C7VA 5COAA 5JWHA 4O3MA 1CQIB 5I9LA 4UFPA 4YG7B 3HFGA 3PCXA 1NUAA 1PZEA 5ESWA 5IWCA 1ECGA 2ZJAA 3BXFA 3M1LA 3UV6A 1MC4A 1Q84A 2ZJBA 2ZWVA 2C5EA 2ES4A 2G8LA 1RRKA 2JKYA 4IDDA 4N6NA 4DRZA 2YCBA 2JANA 3TW6A 2OV6A 4E32A 1JQEA 3A4NA 3UPUA 2E4UA 3HR8A 3H6GA 4AJKA 4G5FA 1ADBA 3KKEA 5A03A 1G0NA 4YRIA 5HJEA 4JLVA 1QB2A 1PBNA 3E23A 2K2QB 4E4TA 2NVWA 1RRFA 5E4JA 1SCJA 4N3NA 4HAXA 1P5JA 2WVHA 3PITA 1I94B 4GI5A 1PT8A 2HTFA 1S2LA 3GP3A 4DIMA 1MXHA 4I6TA 1XZJA 2WJWA 3MWYW 4JI0B 1Y9JA 3A6PC 2ZIXA 5DM70 1IATA 3TD2A 2G67A 3EK2A 3HA5A 2P9YA 1FNMA 3O21A 3QLEA 3VO1A 4BAGA 4TM8A 4BNIA 3Q7PA 2D2FA 1FDOA 4GICA 2C4NA 4CHTA 3ANYB 3EZ2A 2HW8A 3RGWS 5DOVA 2AW3A 1OBCA 1FP4B 4WFQA 2NO0A 4LN1A 2CD7A 3GEGA 4XIGS 3KU1A 1PI3A 4L6IA 5FBWB 4X1IB 1KFKB 2E0IA 2IUEA 4JZYA 1JAXA 4PLTA 1UOQA 4Z9YA 4RLFA 3VKHA 2P77A 1RYEA 2R6JA 3AUJB 3ETLA 5DNWA 1RRVA 1XCOA 2J9GA 1KI9A 2LR0A 1DAFA 2YHBA 4DOMA 3IL2A 5KOYA 4QBIA 1WG8A 1AMOA 3HYRA 2KEJA 3P4YA 2CLDX 4GLFA 4IS3A 1EHYA 3FNIA 5ERGB 3KKPA 3OP1A 1JFSA 4HBZA 4M0PA 4DA4A 3QMVA 3H8VA 4B6QA 5HQJA 4QPCA 4WD3A 1WBDA 4ED9A 3K20A 2GPBA 2CVHA 2ZS8A 2G6TA 4PG4A 1FDWA 2JEYA 3I53A 3F5MA 4PU3C 2DR2A 2V54A 1I51A 1LVHA 2PO7A 4I55F 3V4OA 1EFRD 1R6VA 1DIOB 4QAJA 4CMIB 1OH8A 1UTXA 3I1YA 2Z5LA 3DFIA 2UVPA 1EFHA 1XAJA 3BMOB 1GZHB 1ZG3A 5CPFA 5SZHB 4PS1A 1R8SA 3U1VA 4YYZA 3RFVA 3BL6A 1SBQA 2QL5A 2R2GA 1N9GB 4DY6A 2WF6A 2AEMA 3LUKA 4YAOA 1V4NA 4ND4A 4N0QA 3RHZA 2Y4NA 3E2PA 3RC7A 5AHXA 3VC3A 3D1JA 4OP3A 4BVKA 5KU7A 4I7EA 3WBBA 3KZKA 3M6FA 3PRHA 1POXA 2QI9C 5DNCA 4F4CA 3AONB 3EH1A 2EJCA 2Z5GA 4K3VA 1XB2A 2PSSA 2H92A 2W11A 2QTCA 2QRKA 4XUGB 3HBNA 1D04A 3N2IA 5F1KA 5TEWA 3HUEA 2AW6A 3KSUA 5TT0A 2BGWA 1P1RA 3H7AA 3KXAA 5J2UB 4AIIA 1KXZA 1SURA 3D0QA 2QX6A 5HBRA 4CG3A 2C31A 2CE7A 4GGMX 4AUEA 4JV5B 2VPTA 3D43A 3KJNA 2GK4A 3ZDEA 4EGJA 5I9SA 3QMPA 3WGOA 2H1HA 3FVRA 3UB4A 1XF1A 2Y9PB 1RXYA 1EVKA 4UPVA 5G4KA 3JQPA 4XYGA 2OV4A 2D59A 2GBGA 3D7KA 3EVGA 4EG8A 1RZSA 3KR2A 4Z49A 3CJTA 3LFTA 4C6TA 1DRJA 2AI3A 1AQJA 3UMGA 5LMUB 1ZCFA 4DDVA 4TKUB 5D84A 5H16A 3H9QA 3H2IA 3QVXA 4NBUA 5J5VA 2C8LA 4BGEA 3MJTA 3FMVA 3EDRA 1U81A 1ZICA 4YCMA 1WKBA 1M10A 3C6ZA 4JSTA 1N25A 1L7XA 3K1TA 5JI3E 5LOVA 3BXHA 3T5GA 1VSVA 3ZE2B 3H8WA 5G0WA 2UYGA 4E5NA 2FKAA 3DP7A 3MMPA 3OIVA 3R3UA 1EXVA 3IBGA 1LV8A 2PXBA 3KSZO 1IHUA 2VEDA 2QQ0A 2JRLA 3G0TA 1Y7YA 4NOLA 4YTEA 5A3SA 3TFQA 5IFKA 5J4HA 4GOMD 4A36A 2R1TA 4KQEA 2GZ1A 4BV8A 2QUBA 5ILGA 3WIEA 5JZ9A 2HQSA 4HGRA 4TQUS 1E1NA 4KLAA 4I6JA 2IF2A 3QI7A 4BBAA 1JFFA 1ISIA 3A3PA 3AFNA 3B85A 1E3MA 1ISJA 4B3MB 3ENNA 1MO5A 1R6TA 3P9NA 4G0PA 1KMCA 4N8DA 3ZV6A 4BQFA 4DQVA 1DCTA 2DUNA 1CJGA 2RHBA 4Q6BA 4TV9A 1CJTC 1XWIA 3LRPA 4BQPA 3COYA 4IF6A 4D2IA 4CIWA 1GCIA 1LPMA 2WJ3A 2XSZD 2Q3MA 5H5JA 1QIGA 4G56A 2JBAA 1R4MA 3EPLA 2F67A 1MG0A 1JQAA 1LJUA 1RLOA 4R81A 4ZAZA 4N3CA 5EKTA 3TLBA 4A92A 4YPOA 1QOQB 1V9CA 4Y6QA 2QX7A 3V3KA 2PRYA 5JU6A 1EG2A 4PLCA 4RIHA 2DSNA 2R96A 1T2NA 3QYPA 3IAS1 1CULC 1GAWA 1ETUA 3PDHA 2OG1A 2HU8A 1SD5A 3BEDA 3L4SO 5DLYA 1AGXA 3S1AA 4MWGA 1VCNA 4DLLA 3D6HA 5DLEA 3CG4A 3AZPA 3DLHA 1V43A 2NYAA 2VG8A 2KYRA 5E4YA 4BRUA 2VA9A 4K9DA 4L0DA 3A4YA 1U2SA 1PG2A 1V5FA 4Z5CA 1XKTA 5ABPA 2AK2A 2LTAA 5JANA 1XJ5A 4I4CA 4WIAA 3W5VA 1QRSA 2AQHA 3EVCA 1UKAA 2LCFA 5NULA 1Y9AA 3BILA 2XMSA 3FZGA 4C6HA 2BHRA 4FCWA 2PIAA 1Z6TA 3AKCA 3G1TA 4UBIA 3CA8A 3D4OA 3QHQA 2B1IA 2DG2A 2I3BA 4HQLA 1VDZA 4PONA 2ZSUA 3PUZA 1HFJA 2O2YA 1DMRA 2QD5A 4X6YA 1MTZA 3EA5A 3HV0A 3CWQA 3KKMA 4U4AA 2ODRD 1Y82A 2WVAA 3WXBA 3AILA 4CL8A 4MYUA 1PD1A 2YOFA 4XTCS 4ER3A 4K40A 1WA5A 1RAHA 5HUQA 3HADA 3GT4A 1UQUA 3H5WA 1GKIA 3KHSA 4BVLA 4ZCTA 3H6KA 1PL8A 3WLIA 2HHHB 4KQCA 4M9CA 1CUGA 1RE1A 1WWKA 3CN9A 2CFRA 4Q47A 1CWUA 1KF0A 3LLUA 3AHFA 5AUPB 4TVSA 2GWRA 1VLMA 1C14A 4JXJA 1LBQA 3KUXA 4V0SA 1ZOLA 3UHJA 1LSJA 1XD2B 4S12A 3X1XA 5LQUA 4R5HA 1Z5VA 1U8ZA 2RGAA 2MDTA 4RSHA 4LDQA 4KVAA 4MS3A 4B1FA 3AVWA 1FVHA 4BWFB 4QOHA 1S3SA 2QMQA 3H2YA 4ECAA 1M2OB 2HK9A 1IZ8A 4CM9A 4O1HA 1WCIA 2UXCB 3EDYA 4M7RA 4MKHA 4RX1A 5FNZA 1TYCA 4UTXA 2YNMD 1PT5A 4W7HA 1ZCAA 3KTDA 2RGGA 4A9AA 4J6EA 2G7ZA 1ZD8A 4CVNA 3TTXA 3HSSA 4EMTA 2P7HA 5KZMB 1QFYA 1Z29A 5KTTA 4P84A 1DAKA 1EUCA 2LD4A 3KJZA 1PYDA 4LC1A 1GLNA 4E4RA 1JP7A 3CINA 2FMFA 2EF8A 3Q8KA 4EZBA 4AL4A 4UCFA 5ENZA 4UTVA 4XGIA 3KV1A 4ZVTA 1IUOA 2E4XA 4IHJF 4BMZA 5TR9A 1KO1A 2GBPA 1VE1A 3FPKA 5JJLA 5KJEA 1XJWA 2XTMA 4NP6A 4OAQA 4ZZ1A 1DPGA 2AJBA 5JCOA 4E5DA 5JMOA 1WY7A 3X3HA 5FTJA 3DFUA 2G0AA 3ZY3A 3ROFA 5BW4A 5BN5B 1BJRE 2LIVA 1E7RA 4FYVA 3R9XA 1KYWA 3TKYA 1YOVA 1PGOA 1Z2NX 5KNDH 4JJ7A 3H5OA 4MUNA 3B52X 1NJGA 1DAGA 3VZDA 1TVEA 3TB4A 1NLUA 5IJAA 4N0EA 3T1VA 2WP0A 4OHKA 1JEQA 1V3VA 2ADFA 4D3XA 4DSNA 5KTYA 1JE1A 4CMBA 5EXEA 4HH4A 1N32B 4IGAA 3KTFA 5J59A 3MQ4A 3K0SA 3DCIA 3A4VA 1N2SA 4E5SA 2P3OA 2IWHA 3JQGA 2AJ8A 2VUIB 3K09C 4J9UE 4WK6A 5F1PA 3TG2A 2LCQA 1UJ6A 5JFTA 2Y2UA 1DJQA 1QNLA 1K7CA 4M1SA 3JPYA 1BD3A 4NK4A 4MJXA 1GNRA 3OX2A 4OHVA 1NKSA 4URHA 4E0BA 1B6RA 2OORC 4FYIA 4IGEA 1JDUA 2XQVA 3B13B 1KNXA 2BSQA 1EVZA 4TVKA 2CLMB 3QELA 1RNLA 3P0HA 1YWGO 5DGHA 1FPQA 4RLQA 1JJIA 1Z6ZA 4PSDA 4JUIA 5C3MA 5K01A 4E11A 2C3PA 3KE9A 4HB0A 4BGVA 1Z8DA 4J4TA 4KZKA 1RJEA 2Q3LA 1PNQA 2ZXEA 4OHPA 4YAKA 2QD1A 4PW0A 3RV3A 2FJ0A 1TM7E 4X8OA 3FMIA 2BP7B 2Q5LA 3O92A 1OH7A 1GO2A 4N49A 1STOA 2B3DA 1JMYA 1TMYA 4NMWA 2QW8A 1J8DA 3A3KA 4RVDA 1YVUA 1HR0B 4NE7A 5J4LA 1JJFA 1M7GA 5KTMA 4AFNA 3I4LA 4C05A 2JGDB 3KB1A 4OU4A 2FEKA 3MAAC 4P3OA 2ECOA 2PRZA 4IJUA 1NYRA 2WTNA 3H42B 2HNAA 2C2BA 2YN0A 3BSFA 3QPAA 4FWIB 4HWSA 4RPGA 2AFHE 3KKKA 1EJBA 1HFWA 2X7XA 1G4HA 1PFQA 4WOKA 3O3MB 3IDQA 1IG3A 1YDHA 2PIJA 2YXLA 2Z56A 5CLLA 5FUYA 3WL6A 5KYNA 1ZM4A 1IOVA 1QOPB 3K92A 4KJZA 4OQQA 2CEAA 4C08A 5LSAA 1R5BA 2OV1A 3TSZA 5JNTA 3DEFA 3U0VA 3I9KA 4INJA 3D2BA 4UDNA 1QU2A 3HJCA 1FTYA 2EJWA 3KCNA 3VHXA 5BNWA 2VDKB 2JLXA 2HH9A 2FFJA 3I5MA 1L9XA 3ASZA 4H15A 4B40A 3FNEA 5LYJB 1J5PA 2OHXA 1JT9A 5GZ3A 4LRWA 3U3MA 2HJWA 2QP3A 2XYHA 3PXEA 3TZ6A 2QYOA 1YB4A 2DOKA 1NG9A 2HA2A 3F6BX 5IJ9B 3HN7A 3EXFA 3EWIA 4IIDA 1PDWA 1Z6AA 3ENWA 2P2YA 1HLDA 2ZE5A 4FN4A 3QHPA 4JVOA 3GLIB 1P2GA 1J0BA 3LUDA 1ODKA 4YARA 1R9NA 3EGDB 3NNDA 3CUKA 2OHIA 1Z06A 3FIJA 1JNXX 3N3AC 1MIOA 3PK0A 5EZYB 2C3MA 4EHJA 1QH1A 4KB5A 1GN9A 2JFUA 1YZVA 4MI3A 5EWMB 3UJHA 4AQDA 3KEGA 4H1TA 1J22A 3MZ0A 4MWSA 4BFXA 4A6XA 4P58A 1KSJA 2DPMA 1QHEA 1RLTA 3TKAA 5BQFA 3RAPR 4Z54A 3QNWA 3ABOB 3N3BC 3NGMA 2L19A 2G0NA 1UPCA 2BGKA 3FOAA 1ZMRA 3EGXA 3OZVA 3QVTA 4X93A 5CB6A 2BUCA 1YBMA 3A27A 1E1LA 4DT1A 1N6NA 4HYEA 5EXSA 2VPPA 1U5BA 3M1YA 1YKSA 3ORFA 1PR4A 5IKMA 1TQ2A 2IW3A 1P6QA 4DV2B 2FGKA 2JJYA 1EQ2A 2W6JA 3L4BC 4D0LB 1FFWA 3GRRA 1ZJ4A 2F4NA 1QCCA 5KJ6A 5A0TA 2Q5JA 2E1RA 1GGHA 4KFUA 5FV7A 4UOEA 1JVBA 2O54A 2J1LA 1XZIA 4JIMA 4QPPA 1E2UA 2XUDA 2PTHA 4XOUA 3WLEA 1NATA 3AERA 3H2BA 5LBTA 5JC8A 2VNHA 3IDSA 3K9FC 1GRCA 1NUPA 5AVUA 4CNQA 3HGMA 1O4XA 4JOQA 3B78A 4AG6A 1XMIA 3ITEA 3K2EA 4YT4A 2RI1A 2B4TO 4U63A 1CRWG 4DUPA 4PS0A 1LBTA 4OGGA 2J08A 4QGHA 2QV0A 1E7MA 2APJA 3MB5A 3VYTB 1PWXA 5B58T 3FH0A 1QLWA 3IMCA 1XQ6A 2MYPA 4Q4DA 4IIYA 1UR5A 2W00A 4NDAA 1AXRA 2BZ0A 4FCCA 4HAWA 3TNDA 3GRZA 3TOVA 3OEEA 4NBRA 3VC2A 3WMGA 3RE1A 4C03A 2FOXA 2OFXA 2VSXA 1E4YA 3P0FA 3HB5X 5KVAA 2ZM5A 2BFAA 2J5KA 1WKCA 3C5HA 3EEQA 1M5UA 1HO3A 3X1MA 2F90A 3D8NA 1XCGB 2L0XA 5IYZA 5AI4A 2M6LA 3QF3A 3SJ7A 1OIWA 1Y6RA 1ECJA 5L9AA 4OXKA 1F2UA 1JI0A 4LJRA 3KHUA 1X7YB 1GJRA 3OI7A 1MV5A 2OTCA 3IV9A 3VYSB 3WA6A 4GSKA 3KTAA 3KO8A 2OO5A 4AICA 1PVVA 4HRVA 1XD9A 1ZX1A 3O95A 3K8OE 4IHQA 1VJTA 4GZLA 2WSIA 1KAEA 3SN6A 5KVCA 2BYTA 1QONA 3IJPA 5EHQA 2EDAA 2XVMA 3BTOA 4L02A 3LHSA 2J6IA 4UVEA 5AJUA 4AXBA 1AURA 2WFMA 3IUMA 2XUHA 4LDRA 4PF1A 3ZHTA 4PWYA 1GAXA 4F5EA 4NZYA 5THQA 4QPJC 3QXSA 4N01A 5E7QA 2CMDA 3ZHXA 3QYAA 1DEXA 1SKMA 5LIPA 3FOWA 2E4AA 4WN3A 3IFSA 3CFYA 4OXQA 2LUOA 2W98A 4IWXA 5A3VA 4OA5A 5C8YF 1K68A 2H63A 3I1IA 2OV2A 4AZ3A 1GLVA 3TLGA 3JSXA 2GBLA 4B6PA 2ZSAA 2HT1A 2G40A 1WZNA 2EERA 1SEPA 4CMJA 5JXHA 3GU3A 3NEAA 3B8HA 3QXXA 5BMVA 4H31A 4JI6B 2VJYA 3E58A 2GJ8A 3DMTA 3O75A 1KHHA 4KWHA 3V4LA 1M76A 1T2UA 4KC0A 4FYXA 2SECE 3GLHA 3P2JA 4RY2A 3ILVA 2QTAA 1XYYA 2Q1XA 2UZ1B 3D8SA 3W7VA 4W9NA 2WMYA 2RHCA 3DB2A 4O59O 3JVVA 1AU9A 4J0CA 4YMGA 4I8TA 2D5AA 3AWIA 4FDVA 5TPWB 1CVRA 3V1UA 1NF8A 4NH0A 3I92A 2ABWA 3TO5A 8MHTA 1VBMA 1AUVA 4PC6A 1Y3CE 3FPBA 4EUKA 5CA1F 1B6GA 1ABFA 2BDEA 3L0SA 4MRVA 4EG5A 5EJ4A 1HNNA 3G23A 5EJMA 3D64A 4E12A 2CNBA 2E2WA 1WOYA 3O2QB 1Z08A 2FRXA 1JG4A 2XWQA 3DVSX 1LPPA 3FRJA 4G0OA 4TXHA 1DS6A 4WACA 5K3DA 3WOVA 4BN5A 4QU9A 1QTIA 4B73A 1APBA 4FE4A 2GYWA 3KKZA 4WVFA 1T4CB 4UEQA 4IW3B 4J0EA 3W8NA 1RRCA 1A9XB 5C80A 1N6LA 2DM6A 2H0QA 4J91A 4OSEA 3D0RA 3KS9A 2A5FA 4EJ2A 2VCEA 2FLKA 3COZA 3PIDA 5A1JA 4L57A 2QV7A 3OCXA 1E1RD 3AY0A 2CHVA 4PC7A 1OZAA 4NESA 1THGA 1H4TA 1P9RA 4UTRA 1Z26A 3FE2A 2NO4A 4JBWA 4HN9A 1VCIA 1JEYB 1PR3A 2G76A 4G97A 4QUDA 5LUBA 4R0NA 3MM4A 1WD7A 4N3GA 1C1DB 1T1SA 2O23A 6REQB 3AOEA 3GJSA 1TL7C 4TX1A 2F64A 2EZTA 3HU5A 1VGQA 4BN0A 4GQBA 1T5SA 3FDJA 5ADWA 1KP3A 5LWHA 3CROL 4IAOA 5KPDA 1CIVA 1CDEA 3DBHB 3OFSA 3X43A 1TAUA 2FN9A 3GB9A 1EFTA 1NXOA 3T95A 3TW8A 4FZRA 5GONB 4MUAA 4KAJA 3EA0A 1XCBA 1GAEO 4O3FA 1QVZA 3RYHA 4KXUA 1L5OA 1NW7A 2WT8A 3A7EA 2EIHA 3EBLA 3SNKA 4LQ4A 4UHFA 4JLNA 3VPGA 2RB5A 2YYZA 3BEOA 1HDGO 1IBSA 2I78A 1RI5A 1UXJA 2MSEB 3P97A 2VYVD 4MQEA 5EJ5A 3UJ7A 4JMLA 1ZAKA 1JLSA 2WPDD 1XLUA 2DR0A 3AUKA 3DWIA 4JROA 4Q16A 5DM1A 3QU2A 4D9IA 5HJ2A 3QEMB 3GAMA 4ADSG 5B36A 2Q5FA 3MCTA 1TRKA 1G5PA 3N05A 4EUHA 1VI6A 1B93A 4QQFA 4ZVUA 3LBYA 4HPWA 3T54A 1GGEA 4A0GA 1REQB 3GCGA 3LBIA 3LT0A 2ACKA 2NVUB 3G2KA 2I1LA 2CLLB 2OG2A 1KI1A 2J7UA 4CEHA 3BMCA 2M6SA 1TVKA 3U6BA 3MLEA 3B6JA 4OYYA 1MUUA 1U1CA 3N0WA 4PNPA 1J8VA 1NQWA 4NE2A 1E7WA 2DKNA 3R5JA 4NAHA 1U4OA 1CCWA 3FHLA 4RIGA 3UAOA 2NUAA 1CR4A 1T4GA 2VUTA 2XBUA 2XF2A 5FFNA 4RDXA 8OHMA 5KHLB 2YDYA 4I81A 1K4MA 3ZI4A 4F5YA 5D6NA 5BRAA 1AKEA 3A6ZA 1PR9A 1J06A 4RD2A 5ALEA 2HTEA 3CPHA 2XCIA 4C30A 1FP2A 1POWA 1M3SA 2COKA 3OTWA 4XSVA 2A7QA 3O73A 1D6JA 3TLJA 4P22A 1F8GA 3T5TA 5F52A 2RAPA 2A59A 3UCEA 1DBVO 4WLUA 2OZLA 5LCXA 1B14A 1M34E 2G04A 2HSJA 5AHRA 1N5LA 1Y4DE 3R4CA 1M6YA 4KSBA 1WLSA 2HMYB 2O2SA 4UOQA 3U7EB 3QF4A 1I4DD 1UIRA 1VLHA 4MIEA 4PIPA 4PO1A 1U4SA 2P79A 3AESA 4MKIA 2E4VA 2ERXA 4MRMA 5JJKA 2F3TA 3I34X 3SMQA 1SN7A 1YJAA 1A7AA 1ZZ8A 2FMIA 3JWEA 3OPYA 3HBJA 3JALB 4R2XA 3H9BA 3K2IA 1Q3HA 1WMSA 3PHGA 1Y5LA 5DHSA 1P1HA 1QYCA 4TTIA 2FI1A 2JDID 1U3DA 3CZ4A 4KOAA 4UD6A 4UXIA 5A5GA 5JSZB 3OHSX 1SOUA 3AR8A 2XMGA 5DLQC 3AB3A 4LFAB 1OAOC 5HUHA 2XMZA 3CRVA 4G67A 4JLBA 3VR4H 1DG3A 4KXLA 4Y3UA 4JYZA 2P2CA 4DUZB 4RL6A 3LGSA 4IMPA 1DWOA 1MC1A 1UJ2A 3TM5A 3DDOA 4Y2JA 2DERA 4G41A 2QTBA 4EHKA 2W6OA 5CTAA 1U8UA 4J2HA 5JCJD 3SX0A 5CAEA 1ECCA 3KM0A 4KTVE 4KLNA 4CEIA 4BNZA 3K1ZA 4C29A 1N9ZA 2A9FA 2JLBA 2PBLA 3NBAA 3UFXA 1PKEA 1CJVC 1ONOA 1YI8A 1JIKA 4RWEA 2FWNA 2RBGA 1VKOA 4Y1RA 1VCHA 1ORVA 2EQBA 1TNDA 2J9XB 2QX9A 3ZDFA 2AEEA 4GXRA 4M83A 4EF4A 3EXEA 5HKLA 3KT0A 4M86A 2KPOA 3DQPA 4UE6A 4PLVA 4QBTA 2GUWA 1K86A 5ALPA 4BGUA 221PA 1WF3A 2IH2A 1T6XA 1XVTA 1ESEA 4DNPA 1G42A 1T5LA 4KITB 3INNA 5B2ZA 1FY2A 4A73A 1N77A 1G55A 4IMJB 4K3UA 1ULUA 2PZAA 3ISJA 4NZMA 1K89A 1E77A 1WMEA 3ST7A 1R0SA 3E0QA 3CLRD 1SH7A 2FUCA 2B34A 4I55A 5EHIA 1CNFA 5KWVA 1CPYA 4TMYA 1MNQA 4QT4A 2NVOA 3AH8A 1RR6A 2F6RA 4Q4LA 2CXXA 4MCAA 3S1SA 1ZJWA 2ZBRA 3FCSB 3UJ6A 4HVCA 4P5EA 1GNQA 1WB9A 4TMWA 1GYPA 4QQNA 3SC4A 2PKWA 1RJFA 1DKUA 4GYJA 3T9AA 3MJ4A 1UADA 4RZXA 4LF6B 3TLYA 3L1IA 4EVRA 2ATEA 3UMCA 3QBEA 1Z7YA 3FSRA 1Q14A 5GGYA 1QGAA 5ENDA 5F9HA 3GLQA 3S2GA 1PZHA 1AV6A 4A10A 4YX9A 4BY9E 3VJKA 4LEIA 4KR7A 2GN6A 5EPOA 1TUBA 1YACA 2VJOA 2AIRA 3O4JA 3MQFA 2QE7D 4MGIR 5LC1A 1SIBE 3TIXB 3TAXA 2G4VA 1Q0TA 2HJRA 2VHYA 1Q83A 4M0CA 1FRZA 2YV5A 1JSXA 4IDAA 5FULA 5BV7A 2MXDA 2XDAA 1W0KD 5ALTA 3VZRA 4XVQA 3QNUA 4TWIA 1ZAYA 1FDSA 2XMRA 4BEBA 1I4OA 3IV6A 5FOUA 3TIIA 4MSUA 3QJ5A 1Z7BA 2XT9A 3KLNA 2C00A 2XD9A 4DTCA 5BSKA 1ZP6A 4I1OA 5T64A 2ZEJA 5TVGA 3RF7A 1VYVA 5EIOA 4XIFA 1OLXB 4M1YA 5HW0A 3FZQA 1BN7A 5H02A 1XJ0A 3DOJA 5EHNA 3WLNA 2HI0A 1DP4A 1QG2A 3QXJA 2UUBB 1ODTC 4O2LA 4B4WA 3UW3A 1KK0A 5AIBA 2O8DA 3ZZTA 2OOKA 1KOGA 2W83A 3IERA 1YE3A 3NHBA 4FI3C 1RYFA 3Q7QA 3ZS8A 3RT7A 4BJHB 3SKYA 3OQBA 5EN4A 5FI0B 5TE9A 1Y1LA 2X15A 2Z2IA 1XPUA 1GM5A 2WF8A 2QVLA 1L5YA 2AUWA 2O6HA 1X7ZB 4HDRB 3A37A 4HQ0A 5GADl 1OLSA 4Q9IA 3GP8A 2BI4A 1WSWA 3LY5A 1C8KA 3D7MA 2MMGA 4FX5A 1QE3A 2DQKA 4QGAA 3T5AA 2ZT8A 1NL3A 2C2YA 3KSDO 3MGAA 3RVQA 2ZJ8A 4REQA 3PQ3A 4MGYR 1F2TA 1N0HA 4WCFC 10MHA 1P19A 4M9QA 4EX6A 4XWKA 3MW8A 3PC3A 4RHTA 1BWSA 5HR5A 4PX5A 5CB0A 1V26A 3UCFA 1DXQA 1ADRA 2VFAA 2QLTA 4JQSA 4QHSA 4GX5A 3BMQA 2HA3A 3RFCA 4BMVA 3IMKA 5BV2P 5HEKA 1JTFA 3O4HA 4HWOA 4F3CA 1J8FA 5EMNA 1HYEA 5BSUA 5CBPA 3U39A 1N0IA 3SVLA 1BVRA 3ECSA 5LMNB