4ER0A

Crystal structure of human dot1l in complex with inhibitor fed1
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
336
structure length
315
Chain Sequence
KLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic site remodelling of the DOT1L methyltransferase by selective inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
total genus 99
structure length 315
sequence length 336
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4er0A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4er0A02
3SXJA 3DUWA 2I62A 5K0FA 3EVGA 5DWQA 1QZZA 4ER0A 2PX2A 2QM3A 5H02A 3UJ7A 3G8BA 2NXCA 1T43A 2FK7A 1JR4A 4C4AA 2UZ4A 3EPPA 2CMHA 1IY9A 4A6DA 4GOND 8MHTA 3MTIA 4YV2A 1IM8A 2I9KA 3FUVA 2F8LA 2IFTA 5EPEA 2B9EA 3EVBA 3OZSA 3PFHA 2XYQA 3KQPA 2P41A 3OU7A 3FRIA 3GIWA 3G88A 4FP9A 2XYRA 3M6WA 2OYRA 1O9GA 1EAMA 3MQ2A 4ER5A 2OB2A 3GCZA 5KS2A 5CUQA 1ZQ9A 3B89A 2IGTA 2AOXA 3AWIA 5EMMA 3REOA 2FK8A 1R6AA 3JWHA 5GIOE 2BR5A 1SUSA 1EG2A 3UJCA 4C05A 1R8YA 1SQFA 2FRXA 2A14A 4DF3A 2ZIEA 3MAGA 3EVAA 3G5LA 4PYJA 2K4MA 2PV0A 4E33A 3IHTA 4A6EA 3LKZA 1EQAA 3UFBA 4IV8A 4LWOA 5EMLA 2Z6QA 3G7UA 2O06A 3DR5A 3ELYA 3P8ZA 3UBTA 3AJDA 1D2CA 1N7IA 3CC8A 3HCBA 3I5UA 3I9FA 3O4FA 2GH1A 1FP2A 2C7OA 4PYNA 3KR0A 3SM3A 4PGGA 5JUWA 1RJGA 3GRYA 3SSOA 3V97A 1NW3A 2UYQA 3HTXA 3P9IA 4V0QA 3HA7A 3R6TA 4BP1A 4F84A 3D2LA 1O9HA 5LQUA 3GNLA 3LBYA 4C07A 1QAMA 4LG1A 3BZBA 5EG5A 1EIZA 3UA4A 5KQRA 2PXXA 1JSXA 2ZZMA 4YV0A 4E2WA 1NW8A 5E8JA 5C1IA 2O07A 1G55A 3FTDA 4HC4A 2EG5A 1XDSA 1ZG3A 2ZLBA 1BOOA 2NP7A 4GBED 3B3JA 3OU6A 2ORED 4RTNA 2ERCA 3C3PA 4HGZA 1X1BA 3DMGA 3A26A 1G60A 2R6ZA 3KHKA 5DRYA 2LD4A 5KVAA 3OFJA 5EGSA 3FZGA 1DUSA 2N47A 4MIKA 1ZKDA 3K0BA 3NVMB 3UA3A 4YUVA 5T64A 4GOLD 2G71A 3BGVA 3PX2A 4X60A 3GGDA 3E8SA 4R8RA 4ZTBA 5GIPE 2EFJA 3ID6C 2OXTA 5BW4A 2PJDA 2YVLA 1KHHA 1MHTA 1V39A 3PT9A 3BWCA 4OX9Y 5ERGB 3HP7A 2ZFUA 3UJ8A 4YUXA 4F85A 2P1DA 1JQDA 5LQRA 2AVNA 3G8AA 2OY0A 1ZGAA 3HCFA 2JHPA 3AY0A 3I64A 3EVFA 2AOUA 4M7RA 5EIFA 1XVAA 2O57A 5EQJB 1NBHA 5DX0A 3KQMA 4M37A 5E1DA 1NKVA 1Q0TA 3I53A 2UYCA 3ELUA 4OA5A 4FSDA 3PFGA 5K05A 3C6KA 3SMQA 4DZRA 2PX5A 4FS8A 4XUCA 3NDJA 4RVGA 4E31A 3DULA 3H2BA 1HMYA 2B3TA 5FULA 3SR4A 3TQSA 4U7TB 3EMBA 2AVDA 3DXXA 5EEGA 4BLVA 5DRTA 1QAOA 1R18A 1X1AA 3OE5A 1L9KA 5E1MA 5DX1A 4RTMA 3M6UA 3GWZA 2ZZKA 3E7PA 1I9GA 3F4KA 3WSTA 4CKCA 2EJTA 3KPUA 4LECA 2FPOA 4K6MA 1EJ6A 1KIAA 2I6GA 3HCDA 1H1DA 2XVAA 4QQNA 1HNNA 5FCDA 1TPYA 3TKYA 3FTCA 5DM0A 3CJQA 2ONYA 3MTEA 3P9CA 4EKGA 5EMJA 4BLUA 1YF3A 5MHTA 4PWYA 5CVDA 3LGAA 5HIMA 4RWZA 4P7FA 3V8VA 5K0NA 3TMAA 2OZVA 3DLIA 2KW5A 4PONA 4C06A 1NT2A 4RTSA 2CMGA 3FPEA 3LHDA 3BGIA 4RVHA 4PYOA 3LDFA 5IKMA 2JHAA 3M33A 1R8XA 5ICCA 3EGVA 3KU1A 3FPFA 1NBIA 3P71T 5FWDA 2AZTA 2G8NA 1OR8A 2ZIGA 4BY9E 2IIPA 5LSAA 3KR9A 5E9WA 3OU2A 2JH8A 3NVKI 1WXWA 3ELWA 2ESRA 2JJQA 3G2MA 7MHTA 5U4XA 3CGGA 3C3YA 4CXMA 3BWYA 5CVJA 2YTZA 5M5BA 5DSTA 3OFKA 4JXJA 1P91A 2OB1A 3TLJA 3X0DA 1D2GA 4BLWA 3Q87B 2NXJA 4X61A 5DXAA 4CWAA 3P2KA 4ATNA 4M36A 4PIPA 4R6WA 3THRA 10MHA 2R3SA 5K03A 4RTKA 2B78A 2HMYB 2IH5A 3B5IA 4PCLA 4CTJA 4PYKA 3C0KA 1BC5A 1M6YA 1XXLA 4PCAA 3MCTA 5IH3A 4PYIA 4KDCA 3B3GA 4KRGA 1G38A 1DL5A 1IXKA 1VLMA 1VQ1A 2YQZA 3HA3A 3KQVA 5FWAA 4XUEA 5E1OA 5ICGA 3BT7A 2HTEA 3DMHA 1TW3A 1N2XA 4BP3A 3NJRA 2Z6AA 2DULA 2BR3A 5KQSA 3GXOA 2IDJA 5DTMA 3UWPA 2JH9A 3M6VA 2AS0A 3JWGA 4DMGA 5FHRA 1F3LA 1VP3A 3FUTA 2ADMA 3KR2A 4QVKA 1JG3A 1RI3A 4R05A 1NW7A 3DH0A 3HCCA 1L3CA 1JQEA 3LL7A 4L7VA 5C0OE 3KQSA 2ZBPA 3EVEA 3HVKA 2IDKA 2ZWVA 5EOVA 3EMDA 3NTVA 3R9XB 2C7PA 1O54A 1SG9A 4MHTA 5K01A 4DKJA 4AX8A 1JQ3A 2OBFA 5GWXA 2QRVB 3MB5A 2NXEA 3Q7EA 1SUIA 4QDJA 2ZZNA 5EEHA 1SVUA 1XJ5A 5F2KA 2JHCA 3BGDA 3P2IA 5K0JA 2GS9A 3DLCA 2CKDA 4HTFA 1B42A 1VE3A 4POOA 2BH2A 2VP3A 1KXZA 1PJZA 4RV9A 2IH4A 4M38A 5CVVA 4YV1A 2BR4A 1QANA 2PXAA 4EQZA 1YB2A 1XDZA 4XCXA 1YUBA 3UJAA 4CKEA 3T7SA 5CIYA 5DX8A 1KYWA 5HIIA 5HZMA 3IEIA 3GRVA 2IBTA 2QRVA 1RI5A 4ER6A 2XYVA 3NMUF 3LCUA 1FPQA 1Z3CA 4AZWA 3DOUA 3BKWA 4E2ZA 5DT2A 2AOVA 1WZNA 5CM2Z 3GDHA 2BZGA 3CKKA 3KPJA 3KPWA 3LX6A 2ZSUA 2PSSA 3NWEA 2IH2A 4YMHA 3CBGA 3A27A 3KPVA 1X1DA 5DSXA 3BWMA 4LWPA 1I1NA 2G70A 3G2QA 3KQQA 2H00A 1X19A 3LDGA 2ZULA 5E9QA 1Y8CA 4RX1A 3ER9A 3PTAA 5LQAA 1KYZA 1WXXA 2PBFA 3A7EA 4QTTB 3UJ9A 3DXZA 2C7QA 3OZTA 5T67A 1DCTA 4PNEA 2XBMA 3FYDA 5BW5A 3TOSA 3GRUA 4AZTA 5FTWA 2FCAA 1D2HA 1YZHA 2WK1A 3DMFA 2ONZA 4QPNA 5EVJA 2NNWB 4H0NA 4OQDA 2O0LA 1KP9A 4KDRA 1P1BA 2E5WA 2VDWA 3SVZA 3PB3A 3A25A 2AOTB 4FGZA 2V74B 3BUSA 4GF5A 3AXTA 4PYLA 2P3OA 3GRRA 5HEKA 5B1SA 4DA4A 3TM4A 4QQKA 1U2ZA 4OBWA 3ERCA 4OQEA 4DCMA 3G5TA 5JR3A 1RI2A 3GU3A 1KPIA 5GOZA 3HA5A 3BWBA 4GOOD 3TFWA 1AF7A 1X1CA 3K6RA 4X41A 3SSNA 1M6EX 3VYWA 3DTNA 2JG3A 3S68A 3UJBA 1RI1A 2ZVJA 3TM5A 3HNRA 5K0GA 3EEYA 3RW9A 2O05A 3IV6A 3G89A 5KYGA 5F2OA 1G6Q1 4V0RA 4UOEA 2Q41A 1ORIA 2V7EA 4U7PB 4GEKA 4P7KA 1F38A 3EVDA 3QOWA 2AOUB 3HCAA 4HG2A 5DM2A 5C9ZA 5GP1A 2NP6A 3HVHA 4RSRA 2AN3A 4C04A 2FYTA 3IYLW 4CTKA 1YFJA 2PWPA 1R74A 2PT6A 3KQTA 2QYOA 3KQOA 3ME5A 1G8SA 2PT9A 4DCGA 4GUAA 3PS9A 5D1NA 1XDUA 5E1BA 2PWYA 5DPMA 4HRAA 1FP1D 1KPGA 1UIRA 4E32A 2ZCJA 2PVCA 1XCLA 3TPZA 5E2BA 3TKAA 4KWCA 1RJDA 2QY6A 4RYLA 3VC1A 4ER3A 3LKDA 5ICFA 4PINA 4E70A 4PIMA 4FT2A 4GC9A 4WVLA 2AR0A 2AOWA 4FSXA 4OBXA 3SSMA 3NDIA 3JWIA 2WA2A 3HM2A 2UYOA 3DP7A 3EVCA 2AN4A 2EJUA 4EVIA 4R8SA 1XTPA 2ZIFA 1QYRA 2CL5A 3FPHA 3KR1A 3UJDA 4C03A 1NV9A 1VP9A 2ZWAA 2GA9A 4QPPA 1UWVA 2FHPA 3U81A 5HIJA 3KKZA 3OPNA 4AZVA 1RJFA 5K09A 2YXDA 4P7GA 1AV6A 3M70A 3MCZA 3B3FA 1AQIA 2NYUA 3HEMA 3FUXA 5HIKA 2PX8A 4FR0A 4HSGA 2P3QA 3O31A 4ISCA 4RVFA 4X63A 2YUIA 2ZTHA 5E8RA 4GOMD 3JWJA 3LECA 3OZRA 5FUBA 1L1EA 2HV9A 3EGIA 1KPHA 3VSEA 3CJTA 1JTEA 1JG1A 5K0CA 4AZSA 2B2CA 2HNKA 2VS1A 4DM3A 1JG2A 1NE2A 5FQNA 2WA1A 3TR6A 1ZGJA 4O29A 3T0IA 4RTJA 3PLAE 1P39A 1P1CA 4FZVA 3ER8A 4C08A 3O7WA 2H11A 3BXOA 1RJEA 1ORHA 5EHIA 4YUZA 5HFJA 4B17A 1JG4A 3HVJA 4KVZA 5E2AA 5FA8A 5EIWA 5ICEA 5EZQA 3UJ6A 2Y1WA 5LQJA 5EMKA 4Z2YA 2DPMA 2ZW9A 3MERA 2ZBRA 1L3BA 2YXLA 4R6XA 4YUYA 5DXJA 5G02A 2G1PA 4E2XA 2H1RA 3CJRA 5K0EA 4RTOA 3MHTA 4HGYA 2YXEA 5CVUA 4EMSA 1L3IA 1I4WA 3EVZA 5K0LA 3FTEA 3BKXA 2AN5A 4P58A 5BP7A 3NWBA 2P8JA 3G2PA 3ANXA 2VDUE 3CVOA 3KQYA 4IV0A 5HOQA 3OCJA 5EZSA 2C7RA 1R00A 2PKWA 4G56A 3ELDA 3EGEA 1TW2A 3FPJA 5FADA 5LQKA 4QDKA 4KW7A 3B7PA 1EJ0A 2VDVE 4CKBA 5DM1A 5P8WA 3P97A 2AOTA 2BM9A 4WXHA 1VIDA 5LQNA 2IPXA 2I7CA 3QOXA 1VPTA 3FUWA 3LPMA 3PVCA 2GAFA 4OA8A 3P9NA 5K8VA 1UFKA 3I58A 4NECA 4DQ0A 4RTLA 2PX4A 2P7IA 1MJFA 2CWWA 4GQBA 1WG8A 4FT4A 2IBSA 3TRKA 3UZUA 1VL5A 5K0BA 3GJYA 3LSTA 2IP2A 4KIFA 4KIGA 5GINE 4AUKA 3RODA 1BHJA 4RVDA 3LDUA 5HILA 3THSA 1FJXA 4EK9A 1Q0SA 2HR1A 4GC5A 1INLA 3FRHA 3VC2A 3A7DA 2YR0A 3MGGA 1JTFA 2XVMA 4YMGA 1AQJA 5CD1A 2BM8A 1FBNA 3SX0A 1VBFA 5DTRA 4MTLA 3EEOA 5CCXA 3M6XA 2YX1A 2P7HA 5EC8A 3T7RA 1M0EA 3FUUA 2Y1XA 3FPGA 3KPYA 5EKUA 4RTQA 3E23A 3LCVB 4QVGA 4EKIA 2PLWA 3PX3A 4PGHA 5EHGA 3HCEA 3LBFA 2PXCA 2Z6UA 4P7JA 2NXNA 3LCCA 2GB4A 4PYQA 5DLYA 2GPYA 5DM4A 4F86A 4RTPA 5CCBA 9MHTA 3A4TA 5GM1A 5LR6A 2HWKA 1KR5A 2B25A 2P40A 2PY6A 4PYMA 2OO3A 1YFLA 3OE4A 3ORHA 3NW9A 4Y30A 4YUWA 3P9KA 5D1HA 5FHQA 3FTFA 2G72A 1JSZA 4HTFB 1RI4A 1WY7A 1N7JA 2OKCA 3P2EA 4QTUB 2ZBQA 3HVIA 2GLUA 5CVEA 1PRYA 1QAQA 3E05A 3L8DA 3G2OA 4XUDA 5EKXA 3AXSA 4MWZA 3T7TA 3RIEA 1ZHFA 3QV2A 1NV8A 2PGXA 3GRZA 2EX4A 5GM2A 3M4XA 5T6BA 3R3HA 3C6MA 1G8AA 5BXYA 5F2NA 2QE6A 4X1OA 4IKPA 5DTQA 1WS6A 1XCJA 3KQWA 4MQ4A 1NW5A 5FQOA 2UYHA 1YZ3A 2VZ9A 5FA5A 1SQGA 3FYCA 2P35A 5E9JA 3GO4A 2P3LA 2OPBA 3R24A 5LQCA 4E2YA 4ER7A 3DXYA 4HH4A 1BKYA 4IWNA 3SGLA 1SKMA 4RTRA 4E30A 3CCFA 3R0QA 4Y2HA 1NW6A
chains in the Genus database with same CATH superfamily
4Z7NB 1LPNA 1XZNA 3GJ3A 2F4VB 3RT9A 2YZGA 1XP5A 2NTJA 3DZFA 3J80A 2A6PA 2MTBA 4NXMB 1R66A 1D1SA 1IY9A 3C5CA 1DO2A 1F51E 1E7QA 3CY6A 4GOND 1PT9A 3TB6A 8MHTA 1TYCA 3RCBA 4HWTA 3EJ6A 1EX6A 2E82A 1BQ4A 2IFTA 4ZDKA 5JZOA 1FU8A 1NBME 2JFXA 3IP5A 1YIDA 1SXJA 4RKQA 4JROA 1P2GA 3KAJA 3EZ7A 2P0EA 4FD3A 3S7ZA 1V4BA 3F3SA 4MS3A 1T0HB 5J2UB 3RD5A 2IOHA 2VJDA 2P30A 3D7SA 2IDMA 4LK2A 3V5NA 5KTSA 4AQDA 1DGQA 2BV3A 2HO5A 1ZJYA 1U1GA 3AWIA 3DMRA 3P9ZA 3R1FA 2H1VA 2EFYA 2TYSB 3STVA 4PQEA 1FDUA 1HT1E 1PG0A 1S2MA 2VHJA 3I45A 4MGEA 2A14A 4C01A 3EFOB 4ASUD 3OJFA 3UKDA 3NM5A 1C3OA 1E4OA 1GA1A 1M1YA 5AKZA 1FSZA 1G7TA 1M6VB 1WXFA 2DE0X 2J6IA 2ZRFA 3HDHA 3JASB 1PTJC 1T2UA 4LWOA 1VPVA 4ZCPA 4OQFA 2EGUA 1NHWA 4KIUA 4AJLA 1JHDA 1NSFA 1D2CA 5AI8A 3PRKE 5AD1A 4Q0MA 4B9AA 4J0IA 2A2ZA 1I6KA 2AI3A 3LGXA 1P7WA 3SM3A 2FDCA 1DIAA 1Z5WA 5CXXA 3WQHA 5L53A 3KEFA 1HF0A 3S40A 3E15A 3WQSB 4F84A 4G5RA 3GGSA 3GZCA 2IXAA 1XTSA 2DOKA 2XUGA 4X8HA 4C2UA 1QYXA 4FNMA 5GAJA 1QAMA 1X13A 4LG1A 5C18A 1BDIA 2C0PA 3UA4A 5BN1A 1HLGA 2WWWA 4P4SA 3L4EA 3L5OA 3ZZTA 2V7GA 4WZBB 5CRIA 1G55A 1WDLA 3IRVA 5ALKA 5F5LA 5B37A 4ENRA 2WTUA 1NJ6A 4IDNA 2ONJA 3VNAA 2H17A 2DMRA 4B2YA 4ZV4A 1G60A 3T4XA 3R5FA 2R68A 2ZEJA 3INGA 2EL7A 3M89A 4FEYA 3A9ZA 3S2UA 2IUTA 4EG0A 3FYHA 1OV6A 3WC4A 1P0PA 3IX7A 2ZSKA 3OLQA 4WOKA 3ET4A 1E62A 3EZLA 3ZHQA 1DU4A 1LSOA 1AN0A 4DG9A 5EYPB 1BXKA 3VYTB 1VL0A 4L8LA 5C3MA 1GG8A 5KYYA 3DOHA 4UVHA 3TR0A 3ZHRA 3PR3A 1UODA 4Z8XA 1FYVA 1NDUA 1XQWA 1ZGAA 1YMUA 2G40A 1GAWA 1O87A 3MJHA 2AOUA 2HU8A 4TN5A 5EIFA 1IUPA 2O57A 5JANA 3IEMA 4UJ3A 4MXDA 3KQMA 4JWTA 3SIWA 2ZYVX 4U2BA 2FUG1 2OAP1 2UYCA 1G98A 1Q1EA 2R6GA 3PFGA 4JN6B 2J3EA 4Q82A 3DE0X 2FSPA 2XRFA 3FFWA 2O8DB 1I80A 1QHNA 1VYUA 2AFVA 2C07A 5DBIA 3DNMA 3GA0A 4NOMA 3WDKA 3FGNA 3TF5A 1YZUA 5ED4A 4D4GA 3KVVA 4L95C 2V4UA 5BUZA 2Z8XA 3X2SA 1ZR2A 1V6AA 2LIVA 4DVJA 1IY8A 1DEHA 1GEGA 1SBHA 5IJXA 1JXQA 5F1KA 4B8ZA 1F2DA 4P31A 4MGIR 1DEXA 1X14A 4UTRA 5JDCC 3WFIA 5E38A 2FW1A 4C3VA 3L1HA 4O1MA 3MOIA 1Z6PA 3EUAA 1I4DD 3MLAA 4M76B 4QARA 4M89A 3OQMA 1EJ6A 1R4NA 3BILA 3EC1A 3JW8A 4FYJA 1E89A 3LL4A 4AF6A 4JWKA 1XMJA 4DTIA 4TMVA 4OQNA 5EMJA 2NUAB 3ON5A 1QP0A 1B7GO 4MR8A 4YJFB 4DNPA 3G7NA 2XJ3A 4G0PA 2LP4Y 4Z59A 4PR0A 1H8HA 4LJ9A 2H1LA 3N76A 1IQPA 3VAZA 1S96A 1JYSA 1NQUA 5CNKA 3WQRA 1YCDA 2WIGA 1DAGA 4UEQA 3A8TA 2HT6A 5JYBA 1MDFA 4S1VA 1Y4UA 3IH5A 1I32A 4J7XA 5FPHA 1PL8A 3M33A 3VXKA 4EA6A 1L4MA 5IAJA 2AEJA 2FMFA 1D2RA 4D56A 1Y48E 3PXCX 1X1RA 1EIWA 4IQ8A 1ID1A 3G0GA 2VBIA 1YL5A 3KSMA 4OOEA 1AGPA 5EKSA 2VSNA 4XVRA 5JH7F 5SZKB 3A3OA 2OGWA 4FGSA 3NVKI 3ELWA 2HCBA 1KVTA 4P0PB 4EJFA 2PIDA 3G1UA 3I52A 4LY9A 5KOYA 2WZQA 3SFVA 3BFJA 5FV4A 1IK4A 1UPFA 3B1XA 2OA0A 1A9ZA 3UHOA 4ZI7B 3KM0A 3OOWA 4QBTA 3SSAA 2CNWD 2Q4RA 2XNCA 4EJ6A 2JL1A 4URVR 1KY4A 1Y42X 3ET5A 3H8VA 1A8UA 4MUNA 5HFNA 4CDNA 2EDCA 4UMDA 3UK6A 2WHYA 1ZY2A 3PCTA 4YCDA 2BGKA 4CKBB 2ID4A 2YQZA 5H16A 3NBXX 3QF4B 5ICGA 5HMMA 4DEYA 4J4TA 3SHFA 2XE7A 3IALA 1J25A 4CT4B 3QEAZ 3UHPA 3A3YA 4NEQA 2A9RA 2JA2A 2LCIA 2OG2A 4JP8A 4NDAA 4NYIR 4BVAA 4LWQA 4PQYA 5FJIA 1O6FA 3NQ41 3K0KA 1KQFA 1W29A 2HIMA 3RGWS 4OHPA 1NPTO 2WTXA 1GQFA 4DC9A 7MDHA 1HTBA 2VBCA 4UQOA 4N5IX 3LRTA 1Z6GA 4L5IA 4E4YA 1EINA 1E3QA 2LUOA 4V0ME 4CI0B 1IY1A 1QFJA 3WJAA 1VLVA 2GVDC 3KC2A 4YECA 2D5BA 3H2JA 1Q1ZA 4QBHA 4PM4A 4FOLA 4D9HA 1N6KA 5GJCA 4LY3A 1XZ8A 4PX3A 4DCCA 2B20A 2WPNA 5K0JA 2W70A 2D5IA 4YRCA 5K4HA 3IPXA 2DLDA 1KI2A 1PT8A 4ZAZA 2EZ4A 3IEKA 2J9XB 3A6FA 3SOZA 1CHNA 3COVA 4X3OA 3S8EA 3WLLA 4JJEA 2XIJA 2WM2A 3ZHSA 3MCWA 4KV7A 3UCEA 1ZUHA 3WOHA 1BGVA 1E6CA 2D1YA 3CR3C 4F8EA 2VAVA 1X74A 4XVHA 1E2JA 5CLFA 5HIIA 2W2MA 1M2OA 4X92A 4HXEB 5A7GA 3TAUA 4IDBA 3V2HA 3FVRA 1VRVA 3HLKA 4C21A 5IWCA 4M99A 4FGLA 4KBGA 4OP3A 2PSSA 1YJ8A 5ILGA 1ATZA 4ZCQA 4BO8A 2H8GA 5A03A 2AJLI 2X7XA 3ESCA 3WJ2A 3WLKX 4AIIA 3IELA 4AYXA 1EHYA 1J5EB 3QMVA 3AR9A 3L4SO 4ESHA 1N92A 5C4GB 1SXJC 2BKUA 2GN2A 3PTAA 3QXHA 2C57A 4NMXB 2NV6A 2OP0A 4N41A 4B3XA 2Z83A 5L3QB 1ISHA 1XZGA 1GZSA 1Z6ZA 3FDIA 3R5HA 4JLSA 2YDYA 3NAQA 3AFIA 4HBGA 1JUDA 1EK0A 5DYGA 5EVJA 1NVGA 5TIIA 1O94C 2O0LA 2O1WA 4HPWA 4BCDA 4ZT4A 2GM5A 4DRXA 1CKEA 1Z18A 2DJIA 3A25A 4DAOA 1DCFA 1U2TA 1IEWA 2HHCA 3BSFA 3HYCA 1I2MA 4X4GA 5BSUA 1CY1A 3RT1A 2Q4BA 1OD6A 2Q4EA 4UFNA 1EUQA 3ZTYA 1O6GA 3G5TA 1RI2A 2RHGB 5K3DA 2J3DA 4BB9A 4BX2A 3BGSA 1CUEA 3IUYA 2V4MA 2R6JA 3MBOA 1KMNA 5AKGA 2A5FA 1F60A 4RH1A 1NTOA 3KTFA 4E22A 1P7YA 2Q3CA 2RH8A 3C6QA 3K8OE 3RUDA 3S68A 1Q0LA 1T2DA 1ZRMA 3N7AA 1U0NA 4Q4JA 4AICA 3TQQA 2ID7A 1ZGBA 2BMAA 2XCLA 1GZDA 2FEWB 1Z82A 3E3AA 1Y8RB 4M9ZA 4N12A 4A1FA 3LZDA 5CDYA 3G8YA 2WM8A 5TT1A 4XRGA 3PE6A 3SE7A 3L6CA 2HMAA 2Q4TA 1P5ZB 1CF9A 4I55B 4ETWA 5ECWA 5AW3A 5FNVA 4HG2A 1T0JB 2IHKA 1HDGO 5C9ZA 4H7KA 2H2HA 4XM0A 2NP6A 2ZI4A 2HFKA 4RSRA 1QGAA 4PANA 4UXHA 4Y7CA 3G2JA 3WYAA 3TTXA 2Q0HA 1SD1A 2V9CA 3MWKA 1XPJA 4O0MA 1XQXA 5INTA 3DP9A 1W4CA 2PRYA 2WIUB 2WD9A 4HRAA 1Z0DA 4N65A 4Q7EA 2O6HA 4AXBA 5COBA 4YPOA 2X19A 4TT3A 2C78A 4ALMA 2BGGA 1Y6QA 4KVAA 1K4MA 4D4LA 5CJJA 2DWCA 4IXMA 1RWXA 3V32A 3FIJA 3FOWA 5KTOA 1E0SA 4Y1RA 1Q2XA 5F7ZA 1ZH2A 5HRAA 2DFVA 1UT5A 2QAJA 5CA1B 5AICA 5EWJA 1NX6A 3ZVKA 4QUJA 2ZYRA 5JPDA 1PJSA 2HNAA 5EN4A 3V48A 2FMXA 1G42A 4IOLA 2AUWA 3FPHA 2A3RA 1QXSA 2BEJA 2VAWA 3M1AA 1WA5A 2VH1A 1NATA 4TUYF 2WF9A 1U3CA 3F7NA 4UHCA 4EPXA 1QF6A 2W71A 1S3SA 2V45A 1N25A 1UT6A 4BJ5A 4XDHA 4LNUA 4RV5A 4C0JA 4UUOA 1TVCA 1V8ZA 4ILKA 1XJ0A 3LRPA 1F6DA 5ADHA 1W48A 2XSDC 4D9MA 1EQUA 1VE1A 1PD1A 2GR9A 3FCUB 3N2NA 4OI1A 4CQMD 4RS3A 2WG1A 5CNJA 4W82A 5T3UA 4F7DA 5EJ8A 2OPHA 5EQFA 5BRAA 4UHJA 4TZ0A 1OI4A 2XJ9A 4UNSA 5DEOA 1T2NA 1QG0A 1VOTA 3EAQA 4WUTA 1X57A 4JLPA 1SPXA 4B43A 4L27A 3VDQA 4D7AA 2ZS9A 3ZE2B 3G79A 4UATA 3SJ7A 4TVKA 4NE2A 2TSYB 2FQYA 1XPUA 2CSXA 3TX6A 1US8A 2RGRA 3B53X 3MERA 1QX4A 2V4ZA 2HZ7A 2VJQA 1ZZ9A 4E2XA 3L1KA 2BCGY 4TWJA 1P31A 4ALIA 4O59O 3K9HA 3FMPB 4O0LA 1Y3IA 1I4WA 3CM0A 2M1XA 3G2KA 2CNLA 1ZI8A 1MAAA 2H7YA 3GT4A 3ZQ4A 4NOKA 3ITDA 5IBPA 3TQCA 4DMKA 3CN7A 3SS8A 3FCOA 2UZAA 3KDAA 1I0IA 1FY2A 4DMCA 2VP6A 3KG2A 2RKBA 9GPBA 2FNAA 1DAIA 3GCDA 2VF4X 2YZ2A 3FA2A 4FNGA 4KTTE 3LWZA 1D0IA 4KH1A 5CGQB 3V34A 3E4DA 2VDVE 4CKBA 4L4UA 1H69A 1WE2A 3DFMA 1J2RA 5TQVA 2IX3A 1IBLB 1UK7A 3GGPA 2P1RA 1CJGA 4DDVA 3MLEA 2YJ6A 3GC6A 1QGDA 3N7TA 2DY0A 3EQ9A 3OE1A 4QU8A 4CEHA 4ZI7A 4QOEA 3VTAA 6LDHA 2G0AA 3U26A 5BSGA 2Q6IA 1Z7YA 1WW3A 1SCDA 5I9NA 1N0UA 1Z5GA 4G1VA 4PGAA 3C43A 4RZUA 2PV7A 3HWX1 3PHBE 3SE0A 1YSCA 3LDUA 4WD3A 1RWKA 3S1AA 4EK9A 1Y9ZA 2ZU6A 4YMGA 2X7HA 2BM8A 4BFCA 3JQ6A 1NI4A 3UAGA 1S3GA 2IHNA 2I3BA 3RSLA 2HREA 4NAUA 4CM8B 4EG3A 4YWJA 4IF6A 2R44A 2TMDA 3FUUA 3LF2A 2Y1XA 1LB1B 4F5EA 4DOMA 3LO8A 1RZ3A 1TAHA 1OWMA 2O20A 3EZ2A 1WV1A 2NYVA 3WKCA 2GB4A 1IPHA 2QX4A 2PXPA 2YFHA 3OD1A 2VEDA 2PMEA 3ZJTA 5DNUA 3A4TA 1CNMA 3C97A 4CT0A 4B7UA 5EUBA 2PY6A 5CX1A 1KDOA 2IV7A 1Y33E 2W43A 2AC4A 3ZLTA 4XSHA 3K15A 3RVDA 5HCIA 4OU4A 3O75A 2FSUA 4Q9AA 1QTIA 4MWEA 1DXYA 2A0FA 2D2EA 2JEZA 4QATA 4YLEA 3VZPA 4DCNA 2REQA 4IDDA 1OU4A 3NAGA 3TTUA 3ZN2A 1D1QA 2A4MA 3P4UA 4EF4A 4QD3A 4MQMA 5U1PA 3G13A 1W76A 4FHFA 4OLHA 4I3HA 1OZHA 4CHTA 4B7AA 4ECAA 3E1GA 3ZU6A 2I3AA 2QRQA 1XO1A 3AUKA 3C6MA 3FF1A 2VT3A 4MVYA 1PS0A 4A23A 1HNZB 4YCNA 1XCJA 4OG2A 3W2TA 1JJAA 1WHTA 3IEVA 1Y0BA 4JU9A 1YS7A 1DBWA 221PA 3U4CA 4QG3A 1KZHA 1XCGB 3JVEA 3GFQA 3BVPA 3H05A 3PWZA 4MV5A 1FBTA 5G1NA 3FF4A 4RW0A 1U98A 1T0BA 3TFQA 5IZCA 2C3PA 5FFFA 4E2YA 1CB7A 3IUJA 1YQ9A 3EZ6A 3H86A 4Y30A 4L3VA 1Z2PX 2EWWA 5EUMA 3VHQA 4CUJA 1IH8A 1EFPA 5H59A 1UBHS 5TF0A 4D3DA 2P62A 4P35A 2JJ2D 3DUWA 5D3ZA 1N8KA 2COUA 4DSTA 4TS4A 3DBIA 1EP9A 4N3AA 3K4QA 5HTKA 4ETIA 1L5NA 4X1IA 5MN4A 3NYWA 3CFYA 3E7DA 4LOAA 1H6BA 4K5QA 4RSMA 3QIVA 1QJ4A 5CCDA 5C5IA 3FUVA 3W2HA 2B9EA 3CR8A 2ZVDA 1CUBA 3O4GA 3AK4A 4ZZ0A 3HFSA 1DWPA 3WRXA 2HYDA 1SHUX 1YBFA 4RC9A 3GZ4A 3D43A 1GNTA 1NF9A 3GCZA 1ZXBA 3RE1A 5EIXA 4UBMA 3AJ9A 4WZBA 5FTMA 1LJ8A 3R7WA 3DGEC 4MWSA 2ZUCA 2ZT8A 1QVVA 2QRJA 5EE3A 2O7NA 1SUSA 3GA5A 3DEJA 3P9PA 3DPUA 3UJCA 3NM6B 2ZAIA 4CMCA 5BQXA 1EFDN 5I7UA 2ZIEA 2DQYA 1EXVA 3RVRA 3KL4A 3BK7A 2WAXA 2CDNA 13PKA 4PY2A 2B21A 1DPFA 1ONBA 1WULS 3FDZB 3JAWA 4EJ0A 1W7AA 4CEJB 3MWEA 1QIJA 3D8SA 3P8ZA 4LI0A 7REQA 1DT5A 2GJKA 3K0EA 2ZTMA 1MEJA 3WHPA 4LWZA 1RYZA 4MVJF 1VL8A 2GH1A 4Z7QB 2QVCA 3LLSA 3WKAA 1LGYA 1C80A 2VG8A 3SIRA 3V97A 1E5QA 1KJ9A 2HPHA 3VWSA 2DPLA 1FSPA 3BE5A 3CA8A 1E2DA 1NOIA 1KQ3A 3N75A 1ADRA 4LZOA 4P36A 5B1YA 3NOQA 3RS8A 3DTVB 4WZAB 1QBKC 5C1IA 4JUIA 1PFQA 2ZLBA 3AI2A 5J2UA 1PDOA 5ALEA 4IQ0A 1V47A 2I4MA 2XMRA 3B3JA 4GBED 4B4KA 5TMPA 2CLCX 2ERCA 3C3PA 3MT8A 5ALQA 3EE6A 2R6ZA 1XNRB 1NVUQ 2CYBA 1ELOA 3PYXA 3URMA 2RI6A 5IT5A 5B3KA 3ZJUA 2R62A 4HDAA 1EBBA 3ANLA 4MJLA 4IXDA 3CUTA 2GPAA 4EM6A 1GVNB 5GTDA 3E8SA 4R8RA 3IKJA 1OH8A 3QBVA 2PLFA 1S8NA 2HL6A 4WLNA 5A6VA 3WLJA 5CW1A 2JVLA 4CEIB 3IAFA 1QM5A 1DEKA 1JPUA 1L4UA 2XQFA 2YHIA 3DZKA 5C8DA 1A2BA 1XYVA 4LJ4A 4LV5B 4AUNA 5BWBA 1SPBS 2B69A 3JXBC 1TJ4A 4DT1B 3F74A 5GONF 3DL0A 4LF6B 4ZAGA 1JGTA 2D0OB 2I2XB 4MAMA 3HFJA 4XSGA 1ZVQA 1XF1A 2PNFA 5CT6A 1A71A 2JLBA 4LJKA 1ZOLA 1JLLB 2PX5A 3M4YA 2I4OA 3O1IC 4HNGA 4YWHA 3NTRA 4X00A 3DULA 2IHBA 3KKOA 4E31A 2HK9A 1V16B 2FAXA 4BFZA 3OLCX 4DQVA 2IEAA 1QG6A 3W5IA 4HWGA 1EFTA 4ZTZB 2XAUA 2Y1GA 1AKQA 1KDRA 2OHJA 3Q3IA 4FIZA 5LB4A 1W5FA 2LYKA 5DMXA 4N5LA 5HQ3B 5DSZA 2AWNA 3MWEB 4BVFA 3UMCA 3JAMA 2VSXA 4DDTA 3F4KA 2VJBA 1I9GA 2EIXA 2WICA 4FKMA 4FN3A 4KQMA 5HDQA 3TVDA 3U4HA 8OHMA 2XDYA 3JZMA 4RVSA 1UBSB 4X4FA 2XVAA 4HSEA 4UEOA 4PHHA 1TPYA 3A6EA 1BAPA 1L5VA 3H0EA 5AKYA 2UUOA 5AJUA 1ICEA 5A02A 5MHTA 3D1LA 3OIDA 4CV1A 5EESA 3ZE7A 3X2EA 2ZRCA 1L5LA 4S1PA 3QFTA 4TL6A 4IHQA 4IOMA 5F3DA 1E92A 1E9EA 1QZTA 3WGYA 4QQRA 2G3YA 3UPDA 3ZUPA 1ZQ1A 1RAEA 4N49A 5BVHB 4RVHA 4N82A 3E8MA 5BN3A 1NXQA 3AU9A 3BXZA 4FHGA 4I50F 4LXXA 4Z4QA 3EEFA 1LRJA 2PAFA 3Q1LA 2ZKLA 2ZIGA 4B2PA 2UDPA 3V4SA 4HVCA 4TLBA 5A4MS 4J0CA 3N8GA 5ALTA 3UMJA 1T6BY 1B1CA 3I2KA 3OOYA 2XQJA 1ZZGA 1ECGA 3HE3A 1YZYA 4G09A 5JCPA 4RFSA 2I6UA 2B4YA 1U4SA 2YYAA 3D3KA 1Z28A 1FVHA 3H75A 2EQBA 2PJUA 3L01A 3MAAC 3OFKA 4H6VA 4OIMA 4DNOA 1M8JA 1EFCA 4OFWA 5DXAA 4EGJA 3W90A 2FU5C 3WYGA 5KHOC 2W6IA 1M8FA 4INJA 5BN4A 1J20A 3PK0A 3LPCA 4PYKA 3KUKA 4S1TA 4XWKA 3U4QA 2PLAA 2FZKA 1TPZA 1JE0A 3RSGA 2YJ5A 3NHZA 2P27A 4HQ6A 3E3OA 4D3FA 1XGKA 5CEFA 4NJEA 5B4VA 2HJ9A 4ITRC 2WB4A 4QHTA 4BWFB 3DMHA 2A5JA 4LA4A 2P77A 1POXA 3CVYA 2BKEA 2BR3A 4YG7B 4I4CA 1BCSB 1PFWA 4FE3A 4AY5A 3HVUA 1YWGO 4JNCA 3VX4A 4YRGA 2G88A 4ZYUA 2EBHX 4QUAA 1ZD1A 3ZH2A 2QTCA 4FUTA 2R8PA 2W2KA 4KK3A 1L3CA 4MYSA 3LL7A 4DJDC 3MWFA 2CNBA 1YRBA 3BDVA 1Z7GA 3I6IA 2RK3A 5EJMA 4HBZA 3ADBA 1XE3A 3NTVA 3R2JA 1I3LA 5M7EA 1DADA 1F2VA 2ZAGA 3SHVA 2ZU0C 1JQ3A 2XRMA 4JLJA 4LE1A 2H57A 1G9TA 4KGVA 3QE2A 5JZMA 4FZRA 2VP4A 4X4IA 2ZZNA 4B3RB 5AIBA 1MUUA 3HCOA 2DRIA 4J76A 1BMTA 5KNLA 3RTGA 1M2VA 1E63A 1BQEA 1ML4A 1UM9A 2ZAYA 4LSGA 4JZKA 4R84A 5CTJA 4CGYA 4JVLA 3TDNA 3RUEA 4J1TC 3E4CA 4Q01A 3PT5A 5IJ0A 3D1NI 1WW2A 3ZE0B 1WXGA 3O6VA 5DO9A 1QK5A 1YHYA 4HAWA 2HV8A 1Z56C 3JZFA 3ZHYA 5IRCD 2GM4A 1Z6TA 2ZSDA 3QU4A 4IIDA 5CT9A 1X15A 3DHVA 2XWPA 1E9BA 5CIYA 5DX8A 3CROL 2FWBA 5EMNA 4D6PA 1ILEA 2OK8A 3WL8A 4PLCA 3GB9A 5G0VA 1PFVA 3GG9A 3PXAA 1U2DA 1D8AA 4NH0A 3DT9A 5CM2Z 2ORWA 2JAOA 1THTA 1H2EA 1T9DA 1JIKA 1QFMA 4U7HA 1YD7A 2JGNA 3A27A 3DZCA 1EDZA 3FWZA 4YRFA 1X1DA 4LWPA 4DSAA 1FU7A 3C6XA 1I1NA 1SC9A 3G2QA 4JSRA 5H80A 1Y8CA 1L5OA 2QPOA 3E2PA 2A0YA 4OMCA 2PZJA 1DW9A 2PBFA 3L0IB 4B83A 4PN3A 1YJAA 3WWEA 1N7GA 3LDHA 3ZNPA 3LP6A 3PUIA 3TRJA 3PEYA 2VF7A 1UXDA 2ILTA 2DKOA 1RHMA 2PCJA 2R86A 2BTQB 2VYND 1ZNQO 3FGPA 3NYQA 3QQ5A 4HLUA 4QPNA 3L6BA 1DPGA 1RYYA 2P8SA 3N7UA 4RAQA 2HUPA 3H8WA 3NHLA 3ZHXA 2MSKA 3IMCA 1P1BA 2BFFA 1EMDA 1G5QA 1ZN7A 4I4LA 5PNTA 1Y6FA 4RA6B 4RL6A 5DI3A 1TCVA 3OEHD 5HEKA 4BUJA 4E4TA 4I19A 3JQQA 3VV3A 4IGKA 4B6RA 4OXIA 2O19A 1S2OA 1UPUA 1QV7A 5IMBA 2QTNA 1JDSA 1UF9A 5B58T 2GPJA 5T8KC 1AF4A 3LX5A 4UARA 1Y9QA 4DLZA 1SCQA 1SO8A 2R00A 5E7JA 2Q1XA 4OK6A 1V1RB 2QMHA 2Y0PA 1NXSA 5AM4A 3P9QA 3HJTA 4NU5A 3UOWA 5JDCA 1UEIA 3ZDYB 2WMYA 4PLVA 4CJXA 5CB4F 4NY1A 1JKFA 3G0TA 4LHYA 1G3UA 4L78A 3RTCA 4BWYA 3AHDA 1EUDA 1CY0A 1MJGA 2HK6A 2XBUA 3B13B 3FTNA 3D3WB 4XGQA 4FLEA 4CG2A 4YT4A 1U8YA 3TBFA 4ZK2A 1SXHA 2IU3A 4JD5A 3SAJA 4L0MA 4PN7A 3RRBA 4MI3A 4XB2A 1DOZA 3A1TA 3U7QA 4BGIA 2PIAA 5K20A 1MVNA 1S89A 2Y4NA 1QH8B 1NBOA 4P7KA 4QFMA 4RPJA 5FLYA 3DHYA 3RFCA 3ROPA 2F62A 3EPHA 2MIIA 1Q22A 4CQLA 4NJMB 1AXGA 2XYPA 2AYYA 1PHPA 1OLXB 1IZYA 1T3ZA 5D3QA 4E15A 2ZYUX 4XIIA 1OILA 1CULC 2VUUA 3GPDG 3CB4A 1K2WA 3VR5D 2PYZA 5LXTA 1GUBA 3OM1A 3ZLBA 2JGLA 2QQEA 2XMCA 4Q4CA 1UIRA 2QTLA 2DEUA 1GAQA 1SCAA 1Y9DA 3DDZX 3ZV4A 1YB7A 5A7LA 1Z6YA 3H6GA 3KAQA 3AR2A 1WKBA 4IZOA 3CLRD 1N5KA 2ONCA 3F51A 4QBGB 3TQOA 3N3AC 4RPHA 1FFGA 3FJYA 5GZ6A 2AHRA 3SYLA 3URKA 2QVGA 3ZLJA 4CKWA 3I2JA 4AJJA 1VCMA 4Y6LA 4BOYA 3QLVA 2Q2NA 1GGVA 1TJPB 3DO6A 3IAHA 4DABA 4YLYA 3B1KA 3KR1A 1H2AS 2CL5A 1Z25A 4IRMA 5DNYB 4QTYA 2J85A 2AW6A 4ZD6A 1NOJA 3UXEA 2IU4A 3W7BA 3D2CA 2J33A 4EO7A 3KTAB 2GA9A 2XE4A 1PYOA 1XEXA 1E9SA 1YIAA 5AXBA 3WDLA 1RJFA 2G9UA 4P7GA 1U02A 3K9QO 3RC8A 3BICA 1WZIA 2PXQA 3A3NA 1NDQA 2BFPA 4HSGA 5LQSA 1SELA 2J5QA 5C8YB 5A62A 1TUIA 2WE8A 3NALA 3UT5B 5J4YA 1QBGA 4GOMD 3LD9A 3NEPX 3ZS9A 4E5MA 1VMAA 2OCPA 2XWBF 4G86A 3QFRA 2D1TA 4EI9A 2IZ0A 5A4IS 2FW9A 2XSZD 2HNKA 1PZXA 1F0KA 4YRIA 5I9BA 3IAS6 2VDPB 2VT7A 3O84A 3OKFA 3GLFB 1V6CA 2FN7A 4QPJC 3AZQA 3I5XA 1E69A 4XYLA 3O8LA 1A3CA 1N5OX 4Q4JB 3KQNA 1SJ9A 4PG8A 2AFIB 1ZPQA 3RSZA 1ORHA 1S3IA 4E4RA 2YMQA 3AJAA 4F4JA 4B17A 4E3WA 4RHUA 2I1WA 1UMCB 2VN8A 2VP2A 5DBEX 4DPLA 1EVZA 3KUUA 1BXZA 4EY7A 4E12A 3S81A 4Z4CA 2HCRA 2I3GA 4QUGA 3IB3A 4L4SA 4KFTA 2QLNA 2X0DA 2QMQA 1SKYE 1BH6A 1YXMA 3HB4X 3ZDBA 3GJZA 2WUFA 1J1IA 4F2GA 3P0EA 3PQEA 2WSIA 3DF7A 5FAXA 4CQJA 2QD3A 4KAFA 4ENTA 1PWEA 1Q95A 2IZZA 4INAA 1SCNE 4JLDA 5BRNA 2YNMA 1J00A 1Y81A 3F73A 3U7FB 5JJKA 2FWNA 4ZFNA 2JLAA 2HWXA 3BK2A 3I01M 3CVOA 1RQXA 2QE7A 2D7JA 3DWEX 5FR1A 2J4CA 1IC6A 3FPJA 3K73O 4NQRA 5K3EA 2V1UA 4BO5A 4QDKA 1KJWA 4KW7A 1GZ3A 4EI2A 5ESWA 1UJMA 3MB8A 5DM1A 1T5TA 3SLRA 4CNBA 4Z5CA 4BX8A 4H0CA 1F6BA 5CA0B 2GPNA 3HO6A 4WXHA 4UHBA 4C7OB 1VL1A 5K8IA 4C0LA 4NMLA 1S2DA 4D4IA 2I7VA 3WBFA 1ZCAA 4DM7A 5B6JA 1XQ1A 3TJMA 3OZIA 1Q1GA 3KCNA 4LZPA 1V0JA 4OA8A 2Y76A 3GJ7A 3L84A 1UTXA 3EY4A 4KFRA 1OMOA 1OI3A 5J5VA 4NABA 3EZ9A 2DJ5A 1HR0B 3GJTA 4MVJA 4C0QC 4QYWA 1SBCA 2VJYA 2XMDA 4QJ5A 5IC6A 5IT0A 5LJLA 4PRKA 3WGNA 4LFAB 1VE9A 3LP8A 4K9KA 2RGGA 4ZRMA 5JOQA 1S7CA 3B20A 4XWGA 1Q0SA 1ZSNA 4OFXA 1JEDA 4PPYA 3VC2A 3DMDA 4NK5A 1C3XA 3MGGA 2XMSA 2ACKA 5FBHA 4PWZA 3FAZA 3SDZA 3BM5A 4IRXA 2TMKA 1M0EA 2PH3A 5H70A 2WIFA 1K3UB 4FW9A 2DFDA 4HYTA 1VTKA 3PX3A 4REQA 5IVKA 3F6YA 3FXAA 1AY0A 1D3AA 1M72A 3GEEA 3MJSA 4OFBA 5KJEA 3VR5A 4RSHA 3WRYC 1C8VB 1QHFA 5ELMA 4R2KA 3BF7A 3FOBA 4BV2A 2CLIB 5CHYA 4YRSA 2AIRA 3TJRA 1TD1A 3CPSA 4CM4A 2ZUUA 1T1JA 1IHYA 3ORHA 4EB6B 1XZKA 3VDXA 1LI7A 3T0FA 1GQOA 2Z9CA 3DKKA 3DG9A 4C30A 3H2HA 2O0KA 4DVGA 3U7IA 3ZBUA 2R48A 2MXDA 1B2LA 1PHRA 2C2GA 2WILA 1C1DA 1BSVA 1RWBA 2G04A 1F9AA 1QHSA 3G2OA 4OQYA 5KTKA 2JJYA 3QXXA 4C4TA 2CSUA 1CUFA 2QVLA 2QN9A 3KL2A 1JKMA 2WJZB 3MD9A 1M5TA 2XYGA 3QKRA 4HEA6 2BD0A 4C43A 1M33A 1ZMRA 4ZEMA 1GTSA 1PJTA 2X8LA 5BPHA 1U5BA 2NTYC 1THMA 2EBUA 2F1IA 3A2MA 4WCFC 5JQGA 4X1OA 1TEZA 4R40A 1IONA 1G18A 1HRKA 4YRLA 1JKXA 3GZNA 1Z22A 1FTGA 5CDTA 5LQCA 4B7CA 4JIMA 4CRWB 1W2GA 5I5EA 4MR7A 2YJZA 2GRMA 3OHMA 2X3FA 3QENA 4NS1A 3HCPA 1WW8A 4O4HF 3IXMA 1NW6A 3OQHA 2B6NA 2I5PO 1DINA 1ABBA 1VPEA 3CTPA 4Q02A 1KJNA 2J87A 4RS4A 4UUMA 2IV2X 5JD6A 3RLFA 2P6RA 3MT7A 2OCAA 3OJ0A 3X43A 1VI6A 4ZVNA 3F9CA 1BTOA 3PC7A 4NAHA 3EQ8A 5B7PA 2FW6A 4HB2A 1E20A 4TL9A 4ZN6A 1SKYB 3JPWA 4C76A 4RJIA 3GA7A 2BOVA 5KCZA 2I9KA 1LY1A 4F5ZA 3JARA 2PGOA 4P4LA 3TWOA 2A3NA 1JFTA 3KKPA 4R1MA 1PFUA 1W4RA 4L5AA 2LNMA 2I6FA 4JCOA 1FRFS 1L1QA 3ZU4A 5JHHB 5FPYA 1WVMA 5ALRA 3UYKA 1MJGM 4KVGA 2EAUA 5KOHA 2E48A 1R4MA 1T9AA 1VECA 3VKGA 1KQNA 3T41A 4TSFA 3FPSA 3PNLA 1MX1A 4QGAA 3UCXA 2CB9A 5IVPA 2WYHA 1R4NB 3O9MA 2E89A 1YC5A 1JLRA 1L5FA 4L3WA 4XDYA 3PKZA 2F9MA 5BQ3A 1C5KA 1X3LA 2VHVA 1WP4A 2QJWA 3OQVA 4G0XA 3D8RA 3KHSA 1HFEL 1UC9A 4KE6A 3LPDA 1V2HE 4ZGGA 2GZMA 4DA0A 1J2YA 3S99A 3DW1X 1XD2A 3WMGA 3QYXA 1HT2E 3MF4A 3QH4A 2PT5A 5EE9A 1MJHA 2XMPA 3WV5A 3IAXA 1H05A 1E9AA 4X8OA 2ZRLA 2CLDX 3H2ZA 3RHSA 3LC2O 4KV9A 3KXPA 2XAAA 2G83A 1BWQA 3K5HA 3HA7A 2REXB 4RHFA 3VNBA 4IHJB 1O9HA 3ZGOA 1ZH0A 4UTNA 3UQZA 5JW6A 1H5QA 2YC2C 4GBGA 3HSKA 4YP9A 5LP6C 4G65A 2RAPA 3MQFA 3R3ZA 3GH3A 3AG5A 2P5SA 4NDNE 1AK9A 4NJMA 4OREX 4PC2A 3U17A 1BN7A 2GO7A 3F90A 3T9EA 3VO9A 1JXAA 3LHIA 2GFHA 2R5NA 4KSYA 4C2BA 5HF9A 4Q7MB 4GLFA 4BNWA 4WN9B 4V3CA 2AJBA 3BRQA 5HF6A 3R8XA 4F9EA 1DKLA 2A9OA 4BMVA 4BZQA 4G4IA 2H48A 1QH9A 3M3PA 2Z2IA 4QXPA 1SWWA 4CMEA 3SCGA 1DV1A 3JAKA 3OJEA 2MCFA 4AZ0A 2II6A 1YH3A 3ZBTA 4GL4A 4LXQA 3IIMA 5AKXA 2EL9A 3QJGA 2PNJA 4D46A 3DVRX 1GG9A 3P9RA 3GF4A 2B94A 3OIGA 421PA 4RM3A 2FX5A 3AHHA 1XUOA 3JALB 2AKAB 4UMEA 1PJ2A 1W36D 4WXEA 1BXRB 1Z0UA 2VHWA 4CM5A 2VPQA 4GKAA 1GLNA 4YONB 1X7YA 1YONA 3AY0A 2C97A 5CNMA 3SI7A 2FPGB 3DE3X 1NW4A 2DFPA 5DX0A 1FMLA 4CV3A 4P1ZA 3BERA 4D5EA 4MCTA 2NO4A 2X42A 3I53A 2OYCA 3GPLA 1LTHR 5K8CA 4WXPA 2WFZA 4PZAA 4Y2TA 1DP4A 4LDZA 5JFOA 3SDSA 1X38A 3EXFA 3WWOA 2L17A 2YY7A 3NTUA 1XU7A 1JXOA 3EZYA 3KYCB 5DGXA 1W5BA 2G9ZA 1N3LA 3HKEA 4YRMA 5C2JB 1GQQA 3NXHA 2Y9MB 1H0HA 2Q2WA 3JQAB 4JYPA 2H4ZA 4RVGA 4BYGA 4CFYA 2FRDA 3Q0IA 3PWTA 1Z47A 1H0SA 1OFIA 1RAFA 4KOAA 1LFAA 1I13A 3BEDA 4F71A 5JRZA 1YA8A 4B3HA 1PZHA 2BKVA 4I8DA 5PGMA 3LDAA 4KGXA 3AVXA 5IDXA 2IYOA 3GWZA 4ZP1A 4R1NA 1FDWA 1VL6A 2FJRA 2LDBA 1M6WA 2P2NA 2Z04A 1Z2CA 2BEVB 3O2NA 4D6XA 3FOZA 9MHTA 2VLIA 4WK6A 3HXKA 2P9TA 2WU3A 2J0QA 1GPLA 4H7HA 4NPCA 2PL9A 2EHJA 1GL9B 2F9LA 4K3VA 1SZDA 4ISBA 4LJ7A 2W6JA 2JFGA 1SULA 1LEHA 3T5MA 5HUQA 3ZIAA 4BAGA 4JJIA 2PFSA 2UZ1B 1EQ2A 4FEEA 3U13A 4B48A 4KFUA 4UM9B 4C06A 4YP7A 3BWEA 4M0PA 4X1YA 2RBGA 1FUUA 2YIDA 1MOQA 3LHDA 1ENOA 3NUZA 4KLAA 4CMIB 5BY2A 5JXHA 1PT5A 4GIBA 1W6RA 2V7TA 2V7WA 3E81A 2O4CA 3OM9A 4GI2A 4IH1A 4RU1A 1JBEA 3GFGA 3SOPA 2WOJA 1USKA 3L1VA 5CLHA 2UZ3A 2J3IA 4RQUA 2QUKA 1DJOA 4KMRA 4DDUA 1NNEA 2ZI3A 1QIIA 3EXAA 1V9SA 4TLAA 3BPSA 3KALA 3CGGA 5DLPA 5ECDA 5LBUA 3BCUA 2NU9B 4FU0A 3PP8A 4P7BA 1X70A 3NKFA 4IO0A 3JZDA 1QCZA 2E3JA 1E3SA 3FNFA 3IP9A 3NBAA 2CHEA 3LC1O 2HMVA 1IWBB 1XXLA 3GCWA 3WNCA 5FPKA 5IUJC 3HDQA 1V3TA 2DB3A 1IXKA 1DTWB 3E1KA 3O5AA 2FWPA 2XMQA 4W9NC 4FUQA 4NG4A 2GCIA 3VUEA 2DULA 2QN7A 4U2DA 3NBFA 4WZBE 5AK5A 1QZXA 2ZRHA 3GXOA 3K5WA 1ILWA 1Y80A 3D6NB 1HDOA 2OGUA 3IV7A 3L02A 1UEJA 4YC7A 4FNAA 1OKKA 3V4FA 3U4QB 3C15C 1X39A 1QTRA 3WAGA 2OUIA 3REGA 3KR2A 4QVKA 3LYUA 2JIQA 3NKVA 1EHCA 1CR1A 2WWRA 4L6AA 3TIIA 3RTEA 5C0OE 3EXIA 3EVEA 4UOZA 3PPIA 3C7TA 5FLKA 3JYNA 4JLOA 4UE3S 3KJFA 3W6PA 1GTZA 3ZNNA 1NVTA 1AGNA 2ODEA 4UVIA 2A7QA 1GCAA 3S44A 2DUNA 3CYFA 3A4IA 3VO1A 1YR9A 5HKOA 3BG5A 1EM6A 1L6IA 3NONA 4C4YA 3E6AA 1Y3BE 1TI7A 1B14A 1BX1A 3KS9A 4QO8A 4XJXA 3RAGA 3QKSA 3QWAA 4ZVOA 3RU3A 2B99A 3L8CA 4TL7A 2XSZA 2PZBA 4Y42A 3NWOA 3WNZA 1KI6B 2WTMA 3AYXB 1Q3KA 4ZALA 5E4YA 3Q7TA 5KVVA 4QXRA 4OGWA 3OESA 4MQEA 4XCXA 4CKEA 5KVSA 3F2IA 5E7IA 1ODCA 4BLRA 5FBQB 4YB8A 3DYBA 1RI5A 4ZAWA 1KAHA 2R4QA 1Z3CA 4MARA 2OZEA 3KO8A 4I9GA 4AZ3B 3WB2A 3USCS 1OBOA 2SHKA 3W5BA 3NIDB 2I8CA 3WQQA 4N48A 2WSLA 2Y1FA 5DSXA 4HXFB 3VX3A 4KDFA 1RQ2A 3KJXA 1BYUA 1G2QA 5AI5A 3VDNB 4E1BA 4CE6A 4V39A 5DOVA 3RS7A 3BCRA 3SD7A 4QJ3A 2RGXA 3P4XA 4QTTB 3AI3A 3HJGA 1DJPA 4K6CA 4DEXA 4G4JA 1M1UA 4EZIA 3PQCA 2FPLA 3ZWNA 4KOEC 2B7BA 5TX7A 1G9SA 3E9DA 1MTZA 2NNWB 4K26A 3E18A 4N0PA 1VJGA 3UK1A 1T4CA 3TSZA 3OCCA 4FYMA 4KSCA 5BSFA 1LH0A 2HMUA 4OQLA 3DVSX 4BJHB 1C9YA 1JR6A 3NJ8A 4FHZA 4I1PA 1SB9A 4R2MA 2HA4A 1E9FA 3I8OA 1E2HA 2WJ3A 3IIEA 3JTEA 3DDOA 4C7XA 4YT2A 4C7MA 5IT9A 1DC4A 3P2OA 4BNIA 5EQDA 5J2TB 1D07A 1FK8A 4BZPA 3GEMA 4IJWA 1E3TA 2GM9A 3MIIA 4E2WA 4FB4A 2F8SA 2HN9A 1T3TA 1ZJ4A 2JFOA 1UEXC 2VKQA 1VKNA 5BN5A 3ZLVA 2WD7B 2SKDA 3IT0A 4MMZB 4OTZA 3Q41A 5CK5A 2IY7A 1QLWA 3C3DA 3VZSA 5C53B 3EPJA 2XHEA 3C4QA 3N8IA 1KA9H 5J1SB 2AI2A 2GZUA 3WGKA 1WOYA 5UKDA 3WIBA 1TYBE 2O05A 3JY6A 4ZOBA 1H2ZA 5LWQA 3W0LB 1JDNA 3T1VA 3ETDA 2KX7A 4YO8A 1OZGA 1WL8A 1I3CA 4X93A 5KSYA 1ISSA 1LLUA 5JJBA 3W3AD 2G1AA 4FLFA 2DP4E 4L76A 1ZC4A 1SUWA 2FYTA 4RKYA 4BLTA 5JH7A 5L95A 1AJEA 4XX1A 2VI5A 1IY2A 4Y2PA 5A3RA 3BDAA 4EH1A 4PAMA 4EBBA 3MCVA 1U3GA 3A2LA 5LYYA 1KPGA 2IV3A 3UH1A 4QFCA 3CINA 2XBLA 1NULA 1Z45A 1W85A 3ESXA 4L9SA 1AKEA 2ZBVA 2R6FA 1GL7A 3AFHA 1GA4A 3ETGA 4V0NA 4ZOAA 3SBXA 2JPDA 2G82A 3C4VA 4NFHA 4S1NA 1XNQB 4YREA 1A7UA 1NBWB 3OFVA 3UNXA 1KH3A 4JZYA 4EHKA 2CXSA 5CX4A 4K9LA 3U3RA 3Q2OA 2GRUA 1NI5A 1XDGA 3H1FA 4B6EA 4CLDA 5J23A 3ABQB 4C03A 3H6KA 2ICAA 4FI3C 1C4KA 1LI4A 1QO0D 5C8XA 4J0FA 4PV7A 1VHJA 3RKRA 2P4SA 2BGNA 2TMGA 1B0UA 3FNEA 2YN4A 3JQ7A 4K2AA 2F17A 3VTZA 5BR4A 1WTCA 4NBKA 4DR6B 4XGNA 4TN1A 1FYFA 1VG9B 3SIPA 5KREA 1A1SA 2QL5A 4GBMA 4L15A 2CHGA 4DQXA 1ODFA 4Y6SA 5AUPB 4MGZR 4MUXA 2DWUA 2N42A 2RGNC 1ZA2A 3LVQE 1U7ZA 4Q21A 1JTEA 4WHMA 4COKA 5CEEA 4A2CA 3WLOA 2KB0A 4ZDWA 3LAWA 2F90A 3NWJA 4ALKA 1CIPA 1OX6A 2GD1O 4JI1B 1K5HA 1DUIA 3QU5A 4ZQCB 4M22A 5FBKA 2PTGA 1GRQA 1MKYA 4OHCA 2W0SA 1RP1A 2A35A 1DIHA 1XTKA 2ZIVB 3LUKA 4KQ9A 3O82A 3DTVD 5CT5A 1VJ5A 4YDQA 4YUZA 3RGGA 5HFJA 4CF5A 4R9VA 5ELLA 1WJGA 4A8JA 5ICEA 4TXLA 4UAVA 1OZAA 4XWAA 2LWIA 4KMMA 1Q7EA 1W88A 1WCIB 2ZBRA 4MQFA 4A6PA 1VPWA 1FVOA 4UBIA 1UJ6A 3IKLA 1SHZA 4Z49A 2V3VA 3FGZA 2GBFA 3OKPA 2FX3A 4IHJA 1LS6A 3PV0A 4URZR 1QZ3A 3TL2A 1D6JA 1DWUA 2WZDA 4ASUA 2X8BA 4P58A 4RXMA 4B47A 4U7GA 1J2JA 3SC4A 4BDSA 1G8HA 2EJCA 1XWRA 3ESRA 5A5GA 5JZSA 2B7LA 1R00A 4YN3A 3D64A 2E18A 3EGEA 4Z1MA 3IOMA 1I5EA 3ADOA 3GJQA 1IJEA 3QVVA 2GDZA 3U7HB 5AW1A 4IH4A 4OH7A 3REQB 2OG1A 2PRKA 4BBJA 4ZXFA 2B5VA 3I9NA 1IN4A 1T8YA 3LLUA 2QT9A 3PPXA 5A0VA 4ON9A 3DDNA 2PUGA 1MORA 3F1KA 2WYUA 3DBLA 2WNHA 3GCGA 2IP1A 3A4MA 1IJBA 1OX4A 3RIMA 1G8GA 4EY3A 1WQ4A 5KNDH 5DYNA 3IDFA 3T38A 3CW9A 4NU0A 4U9UA 5BV8A 2IBSA 4Z6KA 2VTEA 3NPMA 4DV2B 3V2UA 3JRNA 4FYHA 4KIFA 4KUHA 5GQSA 1N9ZA 3OMTA 2R8ZA 1I6LA 4MHSA 1ECCA 4YGYA 3WXBA 4CIBA 2WR8A 5I7VA 3ZK8A 5CDUA 1VSTA 4Z4GA 1WBJB 2VHYA 4L2IA 3JSXA 1MPTA 1NDHA 1PYDA 1XTRA 2PKXA 5EP2A 4OXQA 5FR2A 3S1AB 3MN1A 4EEZA 3L49A 3DQPA 4L73A 1FXSA 4DILA 1HE4A 5FLXA 5H5JA 2ZWOA 1VMEA 1VGVA 1HURA 2JFHA 2GUWA 2V3WA 1NR5A 2FFQA 3RJZA 3W1WA 1N75A 1VA5A 2Z6UA 1BKDR 4CM9A 4GWKA 1N5RA 3I28A 3F6CA 1CR6A 4TTJA 1BZYA 4NZMA 5DNDA 1UKZA 1ZN9A 3U7GA 1K8RA 2W6CX 3HBFA 3H16A 4YQZA 4BO6A 4ZHQB 4NV1A 3O03A 4HVTA 1JSZA 2NIPA 1GAEO 5GGXA 2ISCA 1UDWA 4ZRDA 8ADHA 1DE0A 4FDUA 5AXDA 1PRYA 1K8ZB 1ZIYA 3JD4A 3ZWBA 2XX3A 3I3SR 4G8CA 1QHIA 3BXEA 4XGIA 4CDRA 3N0RA 5B12A 2GD6A 1NV8A 2C9CA 3F6EX 5KYWA 3SZOA 4Z9FA 4X7MA 4E7PA 3GT0A 3W6UA 1B2RA 4W5OA 2HQSA 3AKYA 4PZ9A 3TTTA 2X5JO 3FBTA 4CU2A 5F12A 1WS6A 3A6JA 1RKQA 1E5DA 3EWSA 2YV2A 4KNYA 1J06A 1BYIA 4FONA 3TUIC 5FV7A 5HSGA 4X64B 1W36C 4J0KA 1DIBA 1UWKA 2FN9A 4CM4B 2AXZA 5G0TA 2BKLA 4JCXA 4HH4A 1N6RA 4M9XA 4NZOA 3CIOA 3LQRA 3UQYS 3T1HB 2AEEA 4DSUA 2GHQA 3ZVNA 3EEIA 4B40A 5B36A 4BVGA 4IM7A 2W6JD 4I50B 3QXCA 4YRZA 4O08A 3UJ7A 2VT2A 2GJSA 3T95A 2NXCA 3JQAD 4O02B 4V0SA 4WEOA 1NMYA 1Y1QA 4GS5A 4ZARA 1TM7E 1YDMA 3RBVA 1MGOA 1RM3A 4ZT6A 1E2IA 1U8ZA 3IBYA 5DHFA 3DAPA 4XCQA 1PK7A 2PRJA 3RVMA 1TIKA 2P2SA 3KXLA 2Q8PA 1Z5VA 3FRIA 1WSBA 2XYRA 4MS4B 4UKDA 1QE0A 5EA2A 4E5KA 2AMJA 2OB2A 3QMPA 3PKJA 4TTAA 3MJRA 4BKOA 5P21A 3SU8A 4EVRA 1B8VA 3VSDA 2WJPA 3STTA 2JLZA 2FK8A 5KQGA 2I1VB 3FPKA 4DLTA 3MT0A 3ROFA 3VNVA 1TL7C 2AG5A 2PXDA 5A04A 4MUIA 2WOOA 3GK3A 3RH0A 2ET6A 1VI2A 1NY5A 4BO9A 4FWBA 4TS1A 1KP2A 3ITNA 4A6EA 2DPXA 3LZCA 4XD2A 1E5XA 5B4UA 3M49A 5KNDA 4JJZA 4IV8A 1Z73A 4MKGA 4TTQA 4DQDA 2IU7A 2WWHA 5HXAA 1RIFA 4ZVRA 3L7BA 1QP8A 3U39A 3WGVA 2XDAA 4BGDA 1KI3A 5F1PA 3F5SA 2PXTA 2GVZC 3KR0A 1CDZA 4X44A 1FLNA 1YS9A 2Q9BA 1DC5A 5JNUA 1YE3A 1X2LA 2BFNA 1ZEMA 2D2IA 3GRYA 3P2MA 3PICA 4O2BF 2R25B 2HSZA 3JD3A 3F98A 3HTXA 3KLNA 4RVOA 1JJVA 2VC2B 4V0OA 1W73A 2PXEA 1JH9A 2PD3A 3PHCA 4LXGA 4NENA 4C07A 3DBLB 4EKNB 4LSWA 5C4MA 5G4KB 1VRWA 1HE8B 2JKVA 3OQJA 2AWIA 4PSAA 2J7WA 1SU8A 2QTVA 1SIOA 4GRAA 4Y18A 4CM6A 1V9CA 3JX9A 1TA4A 3LXRA 1VG1A 3I3OA 2GEJA 1B1AA 1XEAA 2OORA 4M0KA 3STHA 4ARBA 3OFJA 1R6TA 3I2YX 1D0VA 4PRLA 5HRCA 3UA3A 1SGWA 2JHGA 4FMCB 2P2ZA 2IF0A 3BGVA 5NULA 4F6CA 2DVMA 3QIAA 4PHCA 1ISIA 2Q9CA 3BD6A 2IVFA 5BSKA 1N6OA 4LJRA 2O2YA 3QZUA 1I4OA 1PZFA 3AP3A 4RKRA 3X1ZA 3X1DA 5KJFA 2HIHA 5A5EA 1A9XB 1JZSA 1VXRA 1W4AA 2JI9A 3E9CA 2ATEA 3EULA 4NHEA 5LQRA 5D85A 3K0SA 3EW7A 3KFLA 3DCNA 2ENWA 4O2BB 2EBFX 3D59A 4CQLB 4RXTA 1SURA 1IWOA 5LDHA 1C0LA 1K5PA 4C5BA 4DRXB 5L4LA 1NKVA 2XF2A 1Y1TA 3GR6A 4FFMA 4L07A 3U7QB 3N8DA 1ADFA 3WYFA 4P84A 1VCOA 1NVVQ 3L43A 3LC0A 3LY8A 4DYDA 3I6ZA 3GJXC 1UKEA 2XKBA 3GEBA 1ZJZA 1GIAA 2VLBA 2H65A 4M1QA 2C3MA 1YNOA 3FLBA 1W46A 5EP4A 4L50A 4RORA 1MLDA 1EWYA 5DKFA 1U6IA 2BGTA 5A6SA 4KSBA 1QHGA 3RKSA 2IELA 4S3MA 2CNDA 4EHIA 5KDLA 3M1YA 3P7MA 2PVSA 5AKIA 3TR5A 3UMRA 4K05A 4DN6A 4MX8A 3HO8A 2WUEA 3CWZA 4UQLA 1U0RA 4K9DA 4TMXA 4TQAA 3WSTA 4JITA 4FZ5A 4D4HA 4ZOQI 4GR4A 3S1SA 2OXFA 4U7FA 2OFXA 4DR7B 1QO7A 1Z38A 3HCDA 2GF9A 1WUIS 4BNVA 1RC8A 2EG9A 4OXNA 1OLOA 2BSXA 1OBCA 1R88A 4HYYA 4F5WA 1BA3A 1UH5A 3AEXA 4JXXA 2J0SA 3AGQA 4ND5A 4LXHA 4XQ0A 1IN7A 4IX9A 4ZK6A 3CH7A 5DBFA 4KP7A 1YACA 1PR3A 1F3OA 3DLIA 3JD1A 4L57A 3SLGA 2VTBA 1NT2A 2C5BA 1H2XA 1VZ3A 2VQSA 4RTSA 2IS6A 1I3KA 1KZ1A 1R10A 2VL7A 4GKJB 4UDNA 3VZDA 5IYZB 1RS0A 4CODB 2Q3FA 1W94A 2K7ZA 1U0LA 2CZGA 5LOVB 5FWDA 1BN6A 3Q3GE 2AQ8A 3SMVA 4DUGA 1TM2A 3EGOA 1PDWA 2C96A 2Z30A 1U0TA 2B4TO 2WU1A 2Q07A 4KAAA 4BE9A 1N8SA 4MDEA 3L82B 7MHTA 2R7NA 1VIMA 3KQLA 2AFRA 4CXMA 4Q1CA 2YTZA 4H3VA 5C3UA 1QP7A 4G8JA 3ZDZB 2G80A 3TJZA 4OK3A 3IQWA 1BO6A 4PIPA 1XKQA 2RGNA 3I72A 2SICE 4JEIA 1Z8NA 1OHHD 1UBRS 2W5UA 3O9XA 1FPMA 5F98A 2ODRD 1IEQA 1M2JA 1PGPA 1VLLA 2ZBEA 3LVFO 3IBTA 4LE2A 4TMZA 4XJVA 5CYOA 5IJ0B 5C52B 3B1FA 1JB1A 4GG1A 4PCAA 4C7KA 1TGVA 4E46A 4FBLA 1SUAA 4Z53A 3R3JA 1KTIA 4P5DA 4EYOA 2NWQA 3RJTA 1MZVA 1N2XA 3ESQA 3COJA 1MX9A 1T3LA 4JC0A 3WAKA 3LLVA 3RG2A 3ZD6A 1ZIXA 3AB8A 1SQ0A 1PVDA 2GERA 3N0XA 4LQCA 2CEAA 4EEKA 3DL4A 1UXOA 2ADFA 2HCJB 2YWEA 3MS4A 3IDSA 2EWMA 1RI3A 3P0RA 4GGOA 4PE5B 2VYCA 2O7QA 3L8GA 4RD0A 3ZBPA 3H0KA 1HFKA 3L6DA 4RZQA 3AINA 1ICIA 4I2VA 1IOZA 3O3MB 4BNYA 1CP2A 1GQRA 4KI7A 3CVUA 5EIAA 1V5WA 3LW8A 1HZZA 4M1SA 5DULA 3SEFA 1RRGA 3PKIA 3RC9A 4OHBA 3WQBA 1PGNA 5ECYA 4HH1A 4QDJA 1JDTA 2JZCA 4FSHA 4Z3OA 2BHTA 1F4PA 121PA 1NNI1 3FJ1A 1ANKA 3UEOA 5G40A 4JBLA 4KR7A 1P18A 4D3SA 3R7NA 3ZOKA 4OAPA 3H9UA 1TQ8A 1V1JA 2QN3A 5H4GA 4RKEA 1S8AA 3DFKA 1VE3A 4QWMA 4WJLA 1XZJA 3E35A 4H4DA 4KR9A 4YMIA 2PXAA 1VBNA 2AR7A 2UUPA 2O2IA 3EARA 4FS3A 4XGKA 1HYEA 2QT1A 4N6NA 3LY5A 1H23A 1XT6A 1HEIA 1MAUA 1B0PA 1IHXA 1KYWA 2VHEA 1KARA 3GDFA 4Q9NA 5EAIA 4BVEA 5G3YA 3LUHA 3RT7A 2EW8A 3OP9A 1YVDA 4Y0NA 1UKBA 5KTPA 1YQXA 4IDPA 3Q8MA 1XWIA 2FUCA 2QUAA 4J90A 4L8FA 3FE2A 4R2HA 4ZYWA 3BGWA 2VZEA 4QYTA 3CBGA 3NBZC 4BQNA 1EM8B 2X8JA 1RLOA 4JL6A 5BV1A 1LNSA 3QPDA 3S0JA 3AEYA 4DV6B 1TLLA 1YU9A 2VNHA 4DLRA 4ZU1X 3LDGA 4MVJG 1RRFA 4Z1OA 5I48A 1R0RE 1WHSB 3DZBA 3QRWA 4AJ4A 4JI3B 2PA3A 5MN6A 6NULA 4P8RA 1WZ2A 1F8XA 3QXGA 1VDZA 2BEUB 3PUJA 4D4JA 3C45A 4DLVA 6REQB 5KYXA 2XZDA 4LAFA 2Q3JA 2WWIA 4GHWA 4KXYA 1Z4LA 3CEAA 3A1VA 1D2HA 1K0UA 1LU9A 1OE0A 3EMVA 1FNNA 1SEPA 3FZYA 1RPEL 3GDOA 1KAGA 4NCKA 2J0EA 2QLFA 3DL2A 2CLKB 5DN6A 2C9OA 4ARZA 3IUBA 3KZNA 4HWSA 1QIFA 4HLNA 2O0MA 3AI1A 3ENWA 1EGVB 1MIOB 4J1XA 3BIFA 4Q39A 5IEJA 2W58A 2YDXA 2P3OA 5B1SA 3EXHA 1TO1E 3JYLA 3F8WA 4IFEA 4X84A 4X24A 1LBTA 3OM0A 3PX7A 2JI6A 1H9CA 5C8ZA 5HR5A 1XMPA 3I39X 1ODJA 5D2CA 3ABSB 3HA5A 2P9QA 4DG5A 5IJWA 1AF7A 3UB2A 2RAVA 2FDXA 5BV2P 3VYWA 1FTNA 4RLFA 1NPYA 1QQTA 2X0NA 3LK6A 1CBUA 4DBLC 5ALPA 3GOQA 1BJTA 1RI1A 2AJCA 1XU4A 5K0GA 4JENA 2ZKIA 1GHTA 4D82A 2Y66A 2VZLA 1KI7A 2FFRA 4U0JA 2QU7A 1ZESA 3ZTTA 4MLCA 5FOUA 3PXXA 3EA5A 5DHRA 2XIUA 2X8AA 5FOWA 5HGXA 4FJ1A 4MCAA 4BO4A 2QMZA 4JEMA 4M0FA 1G9XA 4N0EA 3FCXA 5GONA 1J0XO 1CJMA 1R0KA 3RV3A 1Z0IA 3GGJA 4PXYA 1SXPA 2NVBA 4C7JA 1YCFA 4WCDA 3QHAA 1P9LA 3AF4A 2YHIB 1H6CA 5G3ZA 2Q1UA 3PXBA 3JVDA 4IWXA 4N8DA 1COZA 1E6KA 2IKQA 4CEIA 1XALA 1KF0A 4TTSA 3T94A 4GUAA 3D3JA 3NOVA 1OTYA 2J08A 4XH9B 5DPMA 4BP8A 3LCJA 4HQFA 1EG7A 2JFYA 1JLMA 1T5SA 2Q4OA 2YC4C 3AEUB 3ASYA 3BF8A 3GLIB 3ISJA 3UMBA 1D4FA 4JP3A 2BNMA 1GRRA 4PIMA 3DUFA 3QW4B 2A4KA 1PFYA 2QRHA 1L7VC 1M1YB 4IIJF 3E9YA 3X1XA 4LCJA 1IJKA 3BEOA 2PZLA 2WJ6A 3GEGA 1GPKA 1JLLA 2XCUA 1YQDA 2UZ1A 3BTVA 2Y71A 5IM4A 4WZAA 4H18A 1WTAA 5DFAA 4NP6A 4FLMA 4EW3A 1ZDMA 2WWFA 1CXZA 1MFPA 2HGZA 4RFVA 5KDDA 3R09A 3ANYB 5I4KA 4I6EA 3PF8A 1SVSA 2RGEA 2W83A 3FTPA 3DTTA 3RSQA 4ECEA 1NBMA 4IG4A 3F8TA 3G59A 4Z9YA 5KPDA 3TG2A 4L8VA 1PR9A 2PZEA 4FFRA 2AZXA 1IHPA 5IKEA 2GM3A 3IDQA 1SBZA 2C4MA 1LSSA 4M46A 4XGRA 2ZTHA 1OPXA 1RHQA 3T34A 2BCEA 5EJIA 2OYSA 1KPHA 4FJ2A 4R2LA 4AJ9A 2K2WA 2C9ZA 3T0GA 3CLTD 2O7SA 1YGPA 3JQAA 3M9WA 1N78A 2GMWA 1E2BA 1QG2A 2ECPA 1DC8A 1XEWX 1Y7IA 2P65A 4KB5A 4Q16A 1P17A 1XNJA 2F48A 1PK9A 4WVFA 4LV8B 3VPDA 1NLFA 1XZEA 4A0RA 4JYZA 4C08A 1E94E 1A9RA 2KS6A 4LJLA 4DYHA 5F77A 3OIFA 1E9DA 2BH9A 2GBGA 2NQTA 2QJOA 3N8NA 3GP3A 3PGLA 4IJMA 3U3DA 3S2SA 5EZQA 3UAZA 5LQJA 3WGTA 1E7MA 2B8EA 1L3BA 4R6XA 1EU1A 2H16A 4OYLA 4E13A 4BEBA 4EY6A 1I1QB 2H2IA 1Z06A 2W37A 5AW8A 4HGYA 1GSIA 3KXDA 3G0HA 3QBDA 3UC5A 3M1IA 1NF8A 2XDQA 1JA9A 1RLUA 2IPLA 1CEEA 2C1XA 3D6FA 3NWBA 2P8JA 4IDHA 4PFSA 4DXDA 1JNXX 2Y1KA 3EGCA 1Z2EA 4NQZA 1IVNA 2H4XA 2QX8A 3GARA 4HR7A 1GILA 4D8VA 3RS0A 3IA2A 1UMKA 3RFXA 3SZGA 1NN5A 3RWOA 1RHKA 2R8OA 3GELA 1OROA 4X3CA 3QOXA 1FNSA 5IEBA 2C99A 1RC1A 3G8CA 1WF3A 3LYHA 4R5HA 3AR8A 1MJFA 1TFUA 3IR5A 4MLDA 4WERA 5LLDA 1P6QA 4RZHA 1YQGA 2JI7A 3HB7A 5I47A 3H3XA 2VO1A 4M87A 3UZUA 4BVHA 4PPNA 1GKLA 2QENA 2YY6A 4KIGA 2F43B 3Q11A 4AUKA 3CLCA 1ZW1A 2H7CA 1K88A 3PR1A 1NJ8A 1SIUA 4B3SB 4GC5A 1XD2B 1AKYA 1UP6A 2B4KA 1ZRNA 2IK8A 1Z68A 4M1MA 5JAQA 1KRHA 3FNHA 1WD7A 4YAGA 1BS2A 1G5HA 4PC7A 5FI3A 3KV1A 2OHGA 3BMCB 1GG2A 3CVWA 2Q5IA 2V54A 4NX2A 4DMRA 1R12A 2I2BA 4XYMA 3CPJB 3TZBA 2HBRA 2TS1A 5K3FA 1FRVA 1NASA 1ZISA 3L3BA 2JGIA 4HXYA 3GLHB 4RELA 2F00A 2PXCA 4C6RA 1L7PA 3O7MA 3EY9A 5LIPA 2RCYA 4HGQA 1A4RA 4D0RA 1Q1BA 4DV5B 4U9HS 2G08A 3R23A 3SQNA 3PEUA 2EKQA 2FGJA 2ODWA 4P33A 5ANRB 1DX4A 4AY4A 3EDMA 3P9KA 4MP8A 5B2FA 3GG2A 1SXJD 4NZYA 1TE2A 2C94A 3B9PA 4H4CA 2YJGA 3T4PA 1BU8A 4M8SA 1H2RS 4JX9A 4AMGA 1UAGA 3E05A 4M4SA 4DQUA 1O0BA 2AI1A 4S24A 3I9V1 3PTLA 2FI1A 4QZVA 4DR2B 2PGXA 2QPLA 4UQPA 4P92A 3C74A 4IIVA 3ZKCA 2CFIA 3CNHA 3PI7A 2B2XA 4Q00A 3ADCA 4L6IA 3KWMA 4MR7B 3VR4D 1PWXA 2X2FA 3V1NA 3LT5A 2VXOA 4JKOA 3WA6A 4I08A 3R24A 3K96A 2OUKA 4UDYX 1G8KA 1X7XB 1YOVB 1SMKA 3BIOA 3E22B 4ER7A 3DXYA 3TKLA 1Z2OX 3MA0A 4YJHB 3B6JA 3WKBA 3TBHA 5LD2B 6ABPA 3JVIA 2DLCX 1G8MA 3JXEA 3GFFA 2AD1A 3CCFA 2XD4A 3PI6A 4UUQA 3A04A 2CVZA 1JIXA 2I62A 5EY5B 1P77A 4QXAA 4LXYA 2J7UA 3ICOA 2J5BA 3CE9A 2PDAA 4IIJA 4PO3X 4RH3A 4UMVA 2XRYA 3KEGA 5EZYA 2VHZA 1E3JA 2WM9B 1XJQA 4WE3A 1Z0SA 2REBA 2WYVA 4WWHA 1BMQA 3W8EA 4CQNA 2ZWMA 1DWOA 1QGZA 1Z4IA 3HBNA 4FR2A 1LDYA 1P5HA 5JSZA 1G1MA 2E55A 2MSNA 3G5UA 2A5GA 4KU4A 3O1LA 4BFSA 5CDFE 4P38A 4EW6A 5LZ8A 3ETCA 1UBMS 2IV1A 4RH0A 1GR0A 3UFXA 4ALJA 3BHMA 3Q8XB 2P4UA 2RGDA 1ULAA 3D8BA 3MNFA 1SOVA 2QN8A 2ZJFA 3KNZA 1L7NA 4HF7A 5F64A 1M2WA 4MYTA 4CEHB 2BGLA 3T12A 4B4OA 4DF3A 2FR0A 4DCUA 3CVXA 1VYTA 2OT3B 3GLGE 3T54A 2W2PA 5J58A 4B31A 1QORA 2HCTA 5E3JA 2IWRA 5IXYA 4NNOA 5BVGB 5BNIA 3H1GA 5DASA 4JUAA 3FNIA 2AUTA 4GQMA 2I4NA 1ZI6A 4PBRA 1IFXA 4YR7A 3UBTA 2PZKA 2ZJ7A 3OOSA 4AUEA 5A1TA 2ZUFA 2FSHA 1ESMA 3PQ6A 1VSUA 4UOQA 4JXZA 3DONA 1X9HA 4HFJA 2KM1A 3DW3X 1U7UA 4TOIA 5CXUA 3CH6A 1WOMA 3IPLA 2GHIA 3HUTA 3H2IA 3T15A 4R98A 2YWBA 3T8YA 1HV8A 2BI7A 3Q9LA 5KC9A 2NX2A 3CUUA 1L7EA 5ESDA 2CJWA 3JQRA 2ZZMA 1ST3A 5BRJA 4TYYA 4LOKA 4AXXA 2JEYA 2QY9A 1JP7A 1XDSA 3QYJA 4I5GA 4HUJA 5EWJB 4B79A 2WDPA 5LWHA 3SYMA 3OU6A 2C4UA 3L46A 2OENG 2ORIA 3TSCA 3P96A 5HS4A 1MQSA 4U8GA 1NU8A 1SU4A 4TLLB 1AGRA 3H1AA 2PA0A 5EVCA 3NRJA 3K0BA 3B51X 2W2QA 3QLUA 3QVLA 5K0TA 4ZVPA 4X60A 3GGDA 3VHXB 4NXNB 1QC5A 1AU7A 1DXOA 3PBKA 3RQIA 5K99A 1REQB 1H8HD 4JLVA 3RQSA 5ERGB 3ZIAD 2DWPA 4F6LA 3FDXA 2VT6A 1PK8A 2IKSA 2V8BA 1J8VA 1A9XA 1YCHA 2AVNA 2XPCA 3CEJA 1A8HA 1RLMA 1HSOA 3OQ1A 2JHPA 4G5QA 4ZQGA 3VH3A 3WIVA 4BN4A 3HVRA 5CEJA 3U5ZB 4LNUB 4KTVE 1NVDA 4NHOA 3ZE9A 1I94B 2XB9A 4OATA 1H4SA 1E6MA 3KOOA 2R7AA 2DU8A 1SBYA 2OK7A 3QQPA 3IQIX 3RADC 1Z2AA 1EX9A 1M2HA 3MPUA 5F78A 3WK6A 1DZ3A 4URFA 4Z0HO 3KUDA 2C2OA 2QTVB 2EEPA 5IDYA 4AMVA 3KHTA 3VYSB 4I9FA 1Y6JA 4W1RA 4YV7A 2TMYA 1DAOA 1GSHA 2H51A 4BLVA 3PEWA 1Y5RA 4C6HA 3O38A 2YZMA 3RS2A 4HX9A 4X4CA 1CJSA 1NQ5A 4XSVA 1VCHA 4BGVA 4MJ7A 4BUZA 5C1OA 5ALHA 3HBLA 2G36A 3GW8A 2EJTA 4FXOA 4O2LA 4REOA 4U1RA 3E9RA 2IIBA 4NNPA 2CLOB 4QJBA 2KSQA 3K0HA 4WK2B 4CKXA 2UYHA 4PX2A 5HQJA 1JDZA 4BLOA 1DEOA 2IPOA 1I3MA 4U2CA 1QVAA 1ZMOA 3OQIA 1JA1A 1HMPA