4ER0A

Crystal structure of human dot1l in complex with inhibitor fed1
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
336
structure length
315
Chain Sequence
KLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic site remodelling of the DOT1L methyltransferase by selective inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
total genus 99
structure length 315
sequence length 336
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4er0A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4er0A02
5FULA 3ER9A 4CTJA 2YUIA 3C6KA 4AX8A 3KQVA 3R9XB 4EK9A 4MTLA 5EVJA 4E30A 2CKDA 5HIKA 3U81A 5LQAA 3KQWA 3I53A 4X63A 3BWMA 5H02A 1F3LA 1KPHA 3LBYA 4QTTB 2AVDA 1FBNA 4FSXA 3UBTA 4PGGA 4RTOA 3HVJA 3HVKA 3O31A 2R3SA 3KQOA 2JJQA 5B1SA 1BHJA 2QE6A 3ER8A 3FTFA 4HTFA 4K6MA 4WXHA 2OYRA 3HCFA 1XJ5A 2ZZKA 3OZSA 4FT4A 5GM1A 5IKMA 2OB2A 3ERCA 5EHIA 1O9HA 1I9GA 4RVGA 5ICFA 4MWZA 3KQSA 5DT2A 5CIYA 2NP7A 4XUDA 4RX1A 3FPHA 4FT2A 2YVLA 4LWOA 3UA4A 2CMHA 3OPNA 4X60A 2PXXA 1VE3A 3A26A 5DM0A 3EPPA 2GPYA 5EG5A 1XDZA 3V8VA 4EMSA 2C7PA 3OFJA 3R24A 4FR0A 4R05A 3MCZA 3VC1A 2OPBA 3EMDA 2ONYA 3P9IA 4P7GA 3SMQA 4AZWA 1M0EA 5EMLA 2YR0A 3LPMA 3HM2A 2B2CA 4OA5A 4PYNA 5K8VA 1WXXA 3M6UA 5DM1A 1WS6A 1X1BA 3DMGA 4X41A 4E2ZA 3KQTA 3T7SA 1TW3A 3NWBA 4QVKA 1WZNA 3MCTA 4EKGA 3OE5A 3UJ9A 3LKDA 2AZTA 1U2ZA 4BY9E 3DXYA 3UJ8A 2XBMA 1Q0SA 4KIFA 3GRVA 1D2HA 1NBHA 4Z2YA 4OQEA 2Z6UA 4DCGA 5HOQA 3UJAA 4XUCA 4DZRA 2KW5A 2JH8A 3FUTA 1N7IA 4Y2HA 2P7IA 3B7PA 5EOVA 1YB2A 2XVMA 2IP2A 2P7HA 4PIPA 1WY7A 1VQ1A 2OBFA 2PT9A 1AQJA 1KYZA 1JTFA 10MHA 3WSTA 3P97A 1YZHA 4YUYA 3HVHA 3JWJA 3GWZA 2PJDA 1FPQA 5DRYA 3VYWA 3L8DA 3GIWA 5FQNA 4C4AA 2EX4A 2QYOA 4HRAA 4DM3A 3G89A 2ZFUA 3AJDA 5KVAA 3GRRA 5EZSA 3M4XA 4ER3A 5JR3A 2UYOA 5EKUA 1IXKA 1JQ3A 1KXZA 5DXAA 2XYQA 3EMBA 4GC9A 5BP7A 2DULA 3OFKA 4OQDA 5E9JA 3DP7A 1ZGJA 2ZLBA 3LDFA 1R18A 3LCVB 3BWYA 5GOZA 4KWCA 1D2GA 3I5UA 4P7KA 2VDVE 5CVDA 5DWQA 3G88A 3FUVA 4F85A 1V39A 4RTKA 3GO4A 1MHTA 3B5IA 4GOOD 4PCAA 3BWBA 5DSTA 1JSZA 4GUAA 2XVAA 3F4KA 4HTFB 4OA8A 4C08A 3KR1A 4C03A 4LG1A 1PRYA 5FA8A 5GIOE 4HGYA 4GBED 1O54A 3EEYA 3LDGA 3P71T 1YFJA 1T43A 4RSRA 1IY9A 3THSA 2EG5A 2NXJA 3V97A 1G8SA 3CVOA 1BKYA 1QAQA 5M5BA 3I58A 2HR1A 5EZQA 5C9ZA 2NYUA 4R8RA 3TLJA 4RTJA 2H11A 3TM5A 5FHRA 5GIPE 4PYOA 4MQ4A 1NW6A 3HP7A 3NW9A 3ELYA 2NXEA 3IEIA 1L3BA 4R6XA 1G8AA 3RIEA 3EVBA 1JQDA 4RTNA 8MHTA 4CKBA 2Y1WA 4A6EA 3UJBA 5JUWA 4QTUB 1QANA 1JG4A 2AN5A 3CC8A 3K6RA 5E9QA 5HIIA 3T0IA 5T64A 1JG1A 3O4FA 1G38A 4BLWA 2OO3A 1KYWA 4O29A 2PX8A 2B3TA 2AOUB 2HMYB 1VL5A 2FCAA 1M6YA 2UYQA 5KS2A 4C04A 3BGDA 3G8BA 3FUUA 2JG3A 3LCCA 2OKCA 2BR3A 2ZIFA 3EVEA 3FUXA 4YUVA 4E2WA 4HGZA 4FP9A 3ME5A 5LQCA 2K4MA 1Q0TA 1NE2A 3SSMA 1JG2A 3DXXA 4KRGA 4U7TB 5EIWA 1ORHA 3T7RA 2CWWA 4RTPA 4OBXA 3X0DA 1KR5A 1D2CA 1ZKDA 2EFJA 2YTZA 1VLMA 3A4TA 4XCXA 4CKEA 3FRHA 5KYGA 1XCJA 5LQRA 5BW4A 1SQGA 4RYLA 4X61A 4V0RA 2PLWA 2HTEA 5EMJA 5BW5A 5ICEA 4LECA 3KPWA 3P9CA 3HA3A 2HV9A 4IKPA 2ZULA 2P3OA 3DULA 5T6BA 3UWPA 3MGGA 5ICGA 2O0LA 1SG9A 2NP6A 3IHTA 2ESRA 4RVHA 5CCXA 5EQJB 5T67A 2IH2A 4PCLA 3LDUA 2BZGA 2XYVA 5E1MA 3HA5A 5DM4A 3FPEA 2YXLA 3GDHA 4KW7A 4QDKA 4OBWA 3NTVA 1RJFA 3E8SA 3UJ6A 1OR8A 3P2EA 4RV9A 3PLAE 3HVIA 1RI5A 5FCDA 1DUSA 4ZTBA 1NV8A 3SVZA 1SVUA 2IBSA 4ER6A 3FTEA 2ADMA 4E70A 4QQNA 1EJ0A 5EHGA 5F2NA 3TFWA 5EMMA 4P7JA 2AVNA 2H00A 4F86A 5LQJA 2LD4A 2OXTA 4E31A 3I9FA 3G5LA 4IWNA 1X1CA 5HZMA 5DTMA 3SXJA 1EG2A 3O7WA 4KDCA 4RTMA 1JTEA 5FUBA 1AQIA 4A6DA 5F2KA 2ZCJA 2PSSA 2ZWVA 3M6VA 5FTWA 3UFBA 5GINE 1YZ3A 3P9NA 4GQBA 1EQAA 3ELDA 5DRTA 1P1BA 3BGIA 5GWXA 2PX5A 5K0NA 2OB1A 2IH5A 4RVFA 2AR0A 5G02A 5MHTA 2G8NA 4RTSA 4R8SA 5E8JA 1KIAA 3BZBA 5CVJA 2P40A 3GU3A 4ISCA 2DPMA 2O57A 2PXAA 3KPYA 2NXNA 4GOLD 4PONA 5HEKA 1G60A 4M7RA 5FWAA 5IH3A 4OX9Y 5D1NA 1UIRA 1KPIA 2GH1A 3DTNA 1WXWA 1QYRA 1ZG3A 3FTDA 3TKAA 4AZTA 1G6Q1 3KQPA 2FPOA 3TKYA 3CJTA 3KPVA 3TMAA 4ATNA 1SKMA 3TPZA 5EMKA 5DSXA 2ZBQA 3EVCA 4QDJA 4HSGA 1G55A 3DR5A 1NBIA 1B42A 1QZZA 1NW8A 2QRVB 5LQUA 4BLUA 1Y8CA 1X1DA 4PYJA 2Y1XA 3FRIA 3HEMA 3H2BA 1R8YA 4GC5A 1KPGA 1R74A 2ZBRA 5K01A 5ICCA 2ZWAA 2UYHA 2AOTA 2QY6A 5HILA 4ER0A 4YMGA 2AS0A 5C1IA 1I1NA 3UZUA 4YV0A 2OZVA 4E33A 1VPTA 5K0JA 3VSEA 2ZIEA 1IM8A 1FP2A 3KPJA 3MTIA 4Y30A 2I9KA 4AUKA 2GAFA 3IYLW 4IV8A 4P7FA 3HCEA 5LR6A 1QAOA 3C3YA 2F8LA 3EVZA 5CVVA 2PWYA 1XDUA 1YFLA 4DKJA 3P2KA 5K0BA 1VP3A 3OU7A 5D1HA 4E32A 4JXJA 3AWIA 3GNLA 3B3GA 7MHTA 3C3PA 1N2XA 2ERCA 4AZSA 5FHQA 3AY0A 2CL5A 2PXCA 3KU1A 2B78A 3CBGA 5FQOA 3G2PA 3G7UA 5E8RA 4EQZA 2WA2A 5GM2A 3UJ7A 4E2YA 3GGDA 1WG8A 3LBFA 3MERA 1ORIA 4ER5A 2C7RA 5P8WA 1INLA 2VS1A 2PWPA 5E2AA 4UOEA 1R8XA 2QRVA 2IFTA 2JHCA 1NW5A 1NKVA 5FA5A 3RODA 1RI3A 5K03A 3TQSA 1RI1A 3VC2A 2YX1A 3R3HA 5EC8A 5ERGB 3SM3A 1JR4A 2GB4A 3PB3A 3MAGA 5CVUA 1XCLA 3FPFA 4CWAA 2AOUA 1SQFA 3S68A 3G2OA 3KR2A 1XXLA 2PKWA 2VDUE 3REOA 2AN4A 3PFHA 4FGZA 2IDJA 3PS9A 2EJUA 2ONZA 3CJRA 3LECA 2OY0A 5K0EA 1FJXA 2Z6QA 2VZ9A 3GXOA 1R00A 3DLCA 3GRZA 4X1OA 3FYCA 2FRXA 2VDWA 4DMGA 4V0QA 5EEHA 4WVLA 3M70A 4C07A 3LHDA 1NV9A 4KVZA 1UFKA 3HCAA 1DL5A 1EIZA 3DMHA 3NDJA 3BGVA 3FZGA 1VP9A 1QAMA 2FK7A 4M38A 2ZBPA 4E2XA 5K0CA 1L1EA 4YUWA 1UWVA 2Q41A 3PTAA 5CUQA 1RI2A 2P3QA 2PX2A 3D2LA 3EGVA 3KR0A 5K09A 4PYIA 2I6GA 3TR6A 2AOTB 5FADA 3OU2A 3UJDA 3IV6A 4RWZA 5U4XA 4HC4A 3SGLA 3A27A 3AXTA 3CJQA 3NDIA 3I64A 1EAMA 3EVFA 2H1RA 3TOSA 5E2BA 4MHTA 2C7QA 3KQQA 2AOWA 2G70A 5HFJA 1P91A 2P3LA 3CCFA 5HIJA 5LSAA 2FK8A 4PNEA 9MHTA 3P8ZA 4IV0A 2FYTA 3DXZA 3EGIA 1R6AA 2PY6A 3E05A 5DTRA 3KPUA 3EVAA 3P9KA 1HNNA 2Z6AA 3NVKI 3MHTA 1N7JA 5BXYA 5K0LA 2ZVJA 4PINA 5E9WA 5LQNA 3HCDA 3ORHA 5DPMA 3LKZA 3SR4A 4QPPA 3ELWA 1BC5A 2P1DA 2R6ZA 3UJCA 5K0GA 2HWKA 3B3JA 3AXSA 3FPJA 3HA7A 4RVDA 2EJTA 2O05A 3C0KA 5DTQA 1L3CA 2PX4A 1RJGA 4YV1A 4PWYA 3DUWA 5K05A 1RJEA 3EVGA 1Z3CA 5KQRA 1H1DA 4GF5A 3KKZA 1YUBA 2CMGA 4YUZA 1P39A 4FSDA 1AV6A 2ZIGA 2BR5A 3THRA 5DX8A 3R6TA 1JSXA 4R6WA 3GRUA 4CKCA 4RTQA 3JWIA 4PYMA 2JHPA 2JHAA 2ZTHA 3K0BA 4L7VA 4RTLA 3B89A 5DX0A 2IIPA 3NWEA 1BOOA 4GOMD 5KQSA 2HNKA 3E7PA 4KDRA 1RJDA 3FTCA 4DA4A 3SSNA 3BUSA 3LL7A 2XYRA 1DCTA 1NW7A 2O07A 1ZHFA 2N47A 1EJ6A 3BKWA 1XVAA 1TW2A 3C6MA 3DLIA 4GOND 4HG2A 4LWPA 5EEGA 1KP9A 1O9GA 3P2IA 4HH4A 4DF3A 4QQKA 5LQKA 2UYCA 2ZZMA 3HNRA 3NJRA 2BM9A 3A7DA 2BH2A 3CGGA 5CCBA 3DH0A 4U7PB 2PGXA 2IPXA 2ZSUA 1MJFA 3GJYA 5C0OE 3TM4A 4C06A 2C7OA 3Q87B 4PGHA 1PJZA 3KR9A 4M37A 1AF7A 3DMFA 4FS8A 4CTKA 2PVCA 3PX2A 3BT7A 5CVEA 1NT2A 1NW3A 2GA9A 1RI4A 2AN3A 2O06A 3A25A 5DXJA 4BP1A 2G1PA 3HTXA 1X1AA 3OCJA 2V7EA 3LSTA 5F2OA 4BLVA 4PYQA 2V74B 4POOA 1L9KA 2B25A 5HIMA 4EVIA 3BWCA 2UZ4A 1XTPA 4ER7A 2G72A 2I62A 3G5TA 4XUEA 1KHHA 5E1DA 2BM8A 1M6EX 2JH9A 3OZRA 4DQ0A 1JQEA 3R0QA 4CXMA 3FPGA 1SUIA 3ANXA 3T7TA 3PX3A 2PV0A 4YMHA 4PIMA 4AZVA 3PVCA 4C05A 3QV2A 2IH4A 3MQ2A 3CKKA 2YQZA 4B17A 2P8JA 3RW9A 5K0FA 2P41A 5DX1A 1VBFA 1X19A 5EIFA 2AOXA 3UA3A 1XDSA 1ZQ9A 1L3IA 2PT6A 3MTEA 2IDKA 3G2QA 4NECA 2VP3A 3HCCA 2ORED 2WA1A 3EVDA 4G56A 1P1CA 3E23A 5EPEA 5GP1A 3A7EA 3ID6C 2B9EA 3LCUA 1HMYA 1YF3A 2ZZNA 1I4WA 3GCZA 2G71A 5E1BA 2NNWB 3GRYA 2I7CA 3PT9A 1TPYA 3KQMA 4YV2A 4H0NA 3HCBA 1F38A 3JWGA 5EGSA 3NMUF 4GEKA 4M36A 3EEOA 4PYKA 3OZTA 3BXOA 4P58A 3NVMB 2WK1A 3PFGA 5E1OA 2BR4A 2FHPA 4YUXA 3BKXA 4FZVA 3QOWA 2P35A 2YXEA 2IGTA 4PYLA 3LGAA 2PBFA 3FUWA 3B3FA 3QOXA 3M33A 3FYDA 3EGEA 3M6WA 3G8AA 2GS9A 3M6XA 3OU6A 3G2MA 2YXDA 3OE4A 1ZGAA 2GLUA 5EKXA 3SSOA 3Q7EA 4MIKA 1FP1D 3JWHA 2E5WA 3ELUA 4QPNA 4QVGA 3MB5A 1JG3A 4DCMA 4EKIA 2A14A 2QM3A 5CM2Z 3SX0A 5CD1A 3LX6A 1VIDA 4F84A 2AOVA 5FWDA 4RTRA 2IBTA 3DOUA 4BP3A 1SUSA 3KHKA 5DM2A 3TRKA 5DLYA 3KQYA 2ZW9A 4KIGA 2NXCA
chains in the Genus database with same CATH superfamily
2VP9A 5LP6C 3LLMA 4HR7A 4QXQA 1Z4MA 5CR9A 1Z6ZA 2UUCB 4KAXA 1F2UA 4YCJA 2YWGA 5HYVA 3L5KA 4Q4HA 1N2CE 2QL7A 2VJAA 3MMNA 4KFTA 2FLVA 3OJWA 2V6FA 1JQJC 2IWHA 3RTEA 4B45A 3AFOA 3DO5A 1FC0A 1KPHA 3MCUA 4HEA1 1A71A 2NV0A 3H1AA 3FR7A 1U2QA 4IDAA 3GNTA 3O8LA 4JL8A 2NPFA 3HEAA 1KZ6A 4BV2A 3HVJA 5AH0A 1E66A 1V8PA 4LGVA 4TX1A 5DV9A 2P62A 1N77A 3NLLA 2GARA 3F6BX 2LWIA 1MX5A 3V2GA 1QHYA 4JSRA 3A9YA 3AR9A 2FMXA 1Y6RA 2Q4DA 1KI4A 1ZO8A 3QMWA 4N5IX 4KVGA 4HLDA 1TAGA 5ARCA 2LKDA 4J1WA 2GPYA 1PJCA 1JHXA 3HZHA 4IWRA 5JBQA 4TTJA 1BQ4A 4ZZ0A 5IUJC 4XFKA 4D0SA 2CFOA 2DHEA 3EMDA 5AYVA 2DKFA 2E37A 3BFKA 1M0EA 2FN7A 2K6GA 2HXYA 1TIPA 3C43A 4RWEA 3WX0A 1E58A 3PDUA 4KXQA 3DP9A 3VGJA 3RS2A 2OSVA 5HBGA 4GRIA 6ADHA 2NG1A 3WHLA 5BV2P 4RE6A 5DEOA 2RC6A 4V0KA 2BGKA 3E3LA 3ZD7A 4HAZA 1POXA 2O52A 1R0LA 2Q5CA 4LTNA 4WESA 4HLQB 5IM4F 3JQFC 1VL0A 1I3KA 3JARB 3ND7A 3SQOA 5IAOA 4URWR 2V4ZA 2WE8A 3W8RA 3PEVA 4MXDA 4ZVVA 3TSYA 2BFPA 1J0AA 2N0SA 3FOFC 2I3BA 2QLTA 1W581 4BNDB 4JLNA 3UAWA 1R12A 1D7AA 1K27A 4PYRA 3KOWA 3MPUA 3T9DA 3H11A 4ALKA 3PDWA 4HGQA 4XTRA 3H9QA 2FOLA 1PZGA 3DEKA 4J49A 5C8XA 5FWYA 1YZHA 1E5VA 1V4BA 2ZR9A 1KGSA 2G0AA 2ZI6A 3P1JA 4GM1A 3DBVO 1UEIA 4RMIA 4WN3A 3FZYA 4XIIA 4YLEA 1ZCJA 4NF2A 1XTRA 2DPLA 2ZIVB 3VX3A 4XGIA 4IUBS 3QF4B 3VQTA 1N2HA 1FYWA 3GRRA 4NMXB 1NR7A 5LFAA 2H52A 4OKSA 3MT7A 4DHWA 2WTNA 2FG6C 4BUCA 4EFDA 4OO3A 5AK0A 2VDQB 1ZVMA 3GRKA 2J5RA 1ZRHA 4QQFA 4DJ5X 3HVRA 4W99A 2Y4OA 4P32A 2PCJA 3NG1A 1M8JA 1PFVA 2XVZA 1JHYA 1WMAA 4QIHA 3DFUA 4RNCA 1CEQA 3UKDA 3FYMA 3I5XA 1GQYA 3PC7A 1GSOA 3QU7A 4K5QA 3HI6A 5E3JA 2R5NA 1X1SA 1M6VB 2GFIA 1DOHA 6Q21A 1XAJA 1ZOLA 4C08A 1JSZA 2O3UA 2FN4A 3IHWA 3KIPA 1D6MA 3LI2A 4OL0A 1Q1QA 3JS5A 1U3VA 2EQBA 3HEBA 1G8SA 2IEBA 3CVOA 3IQFA 3PUKA 5JAQA 5BSWA 2OESA 4OCZA 4BBZA 1MR3F 2VG8A 1ZD9A 2Q5QA 4YTEA 3T9BA 1DFGA 3A6PC 3I4CA 1ITZA 1GKKA 2F3RA 1KI2A 2W22A 3LLSA 4X4FA 3OSUA 4HRYA 1RCUA 4PFSA 4PBSA 4TKMA 5K6TA 2VQ6A 4EG3A 2HF2A 4WXYB 3NW9A 2HT6A 5HFAA 4F3KA 4YMHA 3LUKA 2LKCA 1UOOA 1JQDA 1NFFA 4JQSA 8MHTA 1PUXA 1KTIA 1UPAA 3QXGA 4FFSA 4AJKA 1FJXA 1QHHB 3W3AA 1HK7A 4V0LA 2YYZA 5HIIA 2ZB8A 121PA 1FA9A 2LLVA 1RKXA 4BV3A 3CKYA 4TSFD 4X4CA 4NYMQ 1RYDA 1VL5A 2C95A 3P27A 4ZQCB 1SKYE 5J23A 2R7KA 3FMPB 4G9BA 2DR0A 3CRQA 2VAMA 4MYDA 1XEFA 4KAFA 2GTIA 2XTZA 2ZDHA 4PBRA 4K05A 2XYHA 1M76A 3WWPA 1PSDA 1V3UA 3R41A 3V1YA 1PQPA 3ZKWB 1HYQA 4DY6A 4YAKA 4OUKX 1JG2A 2Q6VA 1FDRA 2JIRA 3CH5A 3ZDQA 4WZAE 3WLAA 2QENA 3HVUA 2DYKA 1W44A 3NC4A 3IUMA 5DP1A 4RL6A 4K9RA 4MLCA 1NUTA 4BTLA 1FS5A 4RLHA 1DKUA 1Y34E 2QVGA 3E18A 2HTEA 2PXLA 4EITA 1BG6A 3PKJA 4O4JA 1GL9B 1RRKA 3ASZA 3SHFA 1DLJA 3HA3A 4ZRDA 2NO6A 1KSJA 3SC3A 2AI3A 3VTKA 2NSLA 1FS6A 3ZCUA 3HSSA 1ODJA 1O5OA 4OQXA 1SXGA 3TTYA 3WL7A 4E94A 3FMOB 4IQ0A 3JQGB 2MYTA 5DM4A 3FPEA 1TJ5A 1YZFA 4G1VA 3T7IA 4BO5A 3BK7A 2WIBA 1L4BA 4QJ4A 1ZPQA 4D0RA 1RI5A 3E5NA 2JCVA 4EO7A 3G0HA 1E92A 1JDSA 2I3ZA 3L18A 3FIJA 4DXDA 4YP9A 1SK9A 4ZAXA 2FCRA 1E9SA 2AMFA 1AZSC 3AF1A 4B40A 5IF3A 4FJ2A 2XMBA 2C03A 1NUSA 1KOFA 1YVRA 4JVNA 2RGNC 3OX1A 4ID3A 4J07A 4R1OA 1KH2A 1NWCA 4N6GA 4H7HA 4LRSB 3I9FA 3GDOA 3UENA 1GY8A 4MUYA 4C89A 3KYIB 1PT8A 2EV9A 3UK0A 2HWXA 2WAAA 3E6AA 1I6LA 1OLUB 3WGMA 2DOKA 3ZV5A 4P92A 5CNJA 1JLLA 1SM4A 2ZWVA 1X2BA 3GP5A 13PKA 4GPZA 1O5IA 2NMVA 1TRHA 4RK0A 4GQBA 2FUCA 4HLUC 1P1BA 1V5IA 4XB2A 1IFXA 4MGZR 2JLYA 1O96B 3DEIA 4Q4JB 1IHUA 1P31A 4R2WA 3PQEA 1ISMA 4Q7QA 3QVXA 2EHJA 2IYNA 1NI3A 2O8FA 3NQ41 4KK3A 4LAFA 2W6ID 4EUNA 1SWWA 1GCGA 2O57A 2X0RA 4OP2A 2BFEA 5DHFA 1ZK4A 1MKYA 4OG2A 1PK8A 1PEDA 1UIRA 4I46A 3L5OA 4X45A 5CLJA 3I01M 3TKAA 2B5OA 3BGWA 3UV6A 4BNDA 5HWSA 3THWA 3VPSA 1P1IA 1ABBA 1JH8A 1M7GA 3GT3A 2CSUA 4P38A 4RF5A 3JARA 1ICEA 2AW6A 3AZOA 4RPCA 5GONA 1NC3A 3F5SA 3HN6A 1DC7A 4EF5A 1WDMA 2CLFB 2LTAA 4YAEA 3V6LA 1RS0A 1LJLA 4QU8A 2G5TA 3CR3C 4GGPA 3EWSA 3BHNA 3A6KA 4GPIB 3NZLA 1OHHD 3PC3A 3SHTA 1HE2A 5LJIA 3F73A 4KFUA 3LYAA 3K1TA 3K15A 3TEFA 4UEKA 4TKVB 5DH9A 4WXMA 3TNFA 5KSPA 3ZY5A 3WLIA 1RQGA 4AJHA 2FE4A 4QOHA 2AXPA 5EI5A 5F5XA 3ZNNA 2VJOA 1X8KA 3L7BA 3M81A 5HZHA 1JRLA 3H13A 5A4KA 4ZI7A 4F4HA 1IOWA 1NYLA 4TMZA 5H9VA 1RXEA 4FYWA 4TYYA 1OFUA 1OU4A 2ZKLA 2A0YA 2UVPA 2H0QA 2W4IA 4I3FA 4LY3A 1A97A 2L18A 1NR1A 2PH5A 4EJ0A 1WUHS 4DUGA 2CL5A 1JU9A 3IOYA 3LFHA 3G7UA 3EZYA 3W79A 4WZBB 1A7UA 3TPFA 4XASA 3GGDA 3MERA 5FNVA 2HINA 3UJ7A 1U90A 1WE2A 4D4MA 4YAIA 1AMUA 2QP9X 3CZRA 4G6ZA 1ZK2A 4AC9A 2PWPA 3AIIA 3CG4A 1DADA 1XMVA 1IEVA 1B6TA 4EATA 1P4AA 1RW4A 5C1BA 1IEXA 1E59A 1JXAA 4Y67A 1S5PA 1N34B 1OAOA 1E5DA 4GVLA 4HMQA 2QAGA 4AWAA 1Z33A 1EVQA 1XMQB 4MKXA 3PPWA 2Q6TA 3KSZO 1TMGE 4E3ZA 2HSDA 3LUPA 4NJOA 3G2OA 3P9YA 4FHEA 4RIGA 4LKOA 2OGSA 2ZAOA 2GAJA 1QGED 4BQPA 1DV1A 2UKDA 3TTVA 3BCUA 3ROFA 2J31A 2WWTA 1DWKA 5KYTA 5F9HA 5JJLA 5F1OA 2X0EA 4CQMD 3B20A 3H1EA 4WOJA 5T3UA 4XOIA 1CQXA 2P9YA 3BWDD 4X94A 4LISA 1IDOA 1AURA 2B1IA 4HMOA 2DZDA 2XB4A 4UD2A 3RM3A 3L8MA 4Q1DA 2Z0MA 2ZI3A 4YACA 4CODB 4F2HA 5K7SA 4HDCA 1BXZA 2GPNA 2XXAA 1UP6A 1BMDA 2PUEA 4FW9A 3EC7A 3G2LA 2Z83A 2BTQB 4OLHA 1E6EA 5SY4A 4EKYA 1N8KA 2CDNA 3GK3A 1NVFA 4H16A 3PE4A 4BRSA 1FMJA 1Q50A 3EGVA 3KR0A 3RHFA 2H57A 2XITA 2YWJA 1GEEA 4BLQA 2Z5LA 2CLDX 4Q37A 2VHCA 4WBNF 3LUCA 1P2GA 5C5IA 5JCXA 4KNYA 2R5WA 3BG5A 4P36A 3JXDL 1E3WA 1MAAA 2QZPA 2WC1A 3G5AA 5TQVA 4EDHA 3GARA 4X1KB 1T4CB 4QXAA 3TI9A 5AM2A 3IJ5A 1G5QA 3T3GA 1UXJA 3HP4A 2VDWB 1XZGA 2JAXA 4MTCA 3RRMA 4A36A 2FK8A 2E5FA 3C8UA 2BFDB 4HB2A 5J9FA 3DXZA 4ZV7A 1ZAYA 1IBSA 3QNUA 3VBEA 3ZJ5A 5CDUA 1RQ2A 4LC1A 4DZZA 5KYXB 3KZCA 3A06A 1PT5A 2PBZA 5E9WA 2A1IA 3JTEA 2ZYGA 1QS0A 1CG6A 3JY6A 4PVCA 2OV2A 5KYXA 1CZKA 2QLBA 4GR5A 2O38A 2V97A 2WI8A 4Q9KA 2FPUA 4DV1B 2O05A 1TFUA 1XP5A 2E87A 1L3CA 1T9BA 1XMPA 2NUPA 3AY6A 1ST3A 4FMDF 1JJVA 3GFPA 2Q1SA 3PC2A 4C6HA 4DAEA 4YUZA 2Q6IA 1KJ9A 4Q3AA 1S8OA 5DTIA 5HE9A 5JFGA 3LZ6A 5DX8A 3JW8A 3WZMA 1QGDA 2GTHA 1AOXA 2NSHA 3BA1A 3LT0A 4IGIA 3BGSA 4NJEB 5CBPB 3SC2A 5AMXA 4F91B 5JS7A 4L4UA 2I2WA 2F43B 4BB5A 5JW6A 2A4MA 2P4QA 1LGYA 4BPRA 4REMA 2BTOA 2VXBA 4A8JB 1B73A 4JVLA 4EG0A 3FE2A 3PWZA 2PZGA 4S2EA 3LQ1A 3VU3A 2A1UA 3ZVKA 1H9BA 2FWRA 4D3DA 1CY2A 2XGGA 2E6KA 4BL5A 3VSAA 3CGGA 2EJVA 3DH0A 3RC2A 2PMBA 3TM4A 1U7TA 2OR3A 3G9ZA 3L6CA 1N5MA 3MLBA 3T4UA 2W8BA 2HN9A 2QX7A 3IILA 1DUIA 4FS8A 3OQBA 4LDAA 1KJ8A 4X95A 3WSVA 5IFLA 2WZQA 1ZHOA 3DTTA 4YG1A 2WF9A 2AKEA 4KYIB 4FR2A 1Q0LA 3LBAA 1A5AB 4KVFA 1AMNA 4EBFA 3AFMA 4ZYWA 5FFFA 4RY9A 3M4YA 3DBRA 1YMUA 1DG3A 2CZQA 1JGTA 5DWDA 2G72A 4EVSA 1T0HB 3ITKA 3P0FA 3A9RA 4LSZA 1M6EX 1BX0A 1SURA 2PZFA 1B3RA 4MV9A 1HDCA 1K7CA 2YJ4A 3ZYZA 4X3OA 4BO3A 4D74A 3A2MA 2H2GA 1ZLYA 3PVCA 4GWGA 1SHUX 4KTTE 5L3QB 4J7CA 4O02B 4DLLA 3K5WA 4QBIA 1RZRD 4YRLA 2EOAA 3ZJUA 1Y1LA 4QXOA 3JVUA 2XSZD 4AS3A 5DX1A 5AW1A 2WBLC 4N5LA 2AOXA 2G5GX 1BU5A 4OYLA 4M9RA 3LVRE 5FKJA 4WK4B 4TN5A 4DNXA 5HRAA 4NEHB 4IJUA 1G7RA 3OQ1A 4QARA 4X4GA 2G9UA 2ZTMA 1JHAA 4XCQA 1ZVJA 2H59A 2DM6A 2V7PA 4Q1VA 2UZ1B 2NNWB 2O2XA 1DHTA 3ASYA 4G81A 4QNNA 2IV7A 4J8PA 1DCFA 3H9EO 1QCDA 3EZ2A 2XNJA 3FMGA 3L93A 4OVKA 4PIVA 3VGPA 4D82A 4XXHA 1XX6A 5DHUA 3TMKA 1GFIA 2WJ4A 3UUFA 4DV3B 5EP2A 4GEKA 1QPBA 3NB0A 1FSSA 1XPJA 3L7OA 3Q0TA 4P4GA 5CVCA 4Y98A 3BD1A 4X54A 1NVWQ 3WIVA 4E51A 1YE8A 2D5CA 4C7BA 3JSAA 3FLEA 1AU9A 3QOWA 1NF3A 3ZHMA 1G41A 3KYCA 3LD9A 4KVAA 4LE0A 3ZWKA 1L7AA 1AB6A 3M6LA 4CCYA 4DLRA 3W5DA 2RH9B 3HUEA 3I6MA 2R6GA 3M33A 3V4OA 3W6OA 1NUUA 4QREA 5LB2A 5JSFA 1X9IA 2JJ2A 1J1IA 2PZKA 1P2VA 4G9EA 3T5AA 3FMIA 2DERA 1YQWA 2OO5A 1QG4A 4GEGA 2W2PA 1QVRA 4NCHA 3W4KA 2PE5A 4HPWA 4PS0A 4YMVA 3LTNC 4B3RB 4AKSA 2D7JA 2E5WA 3I9KA 2XOKD 4M88A 5E3HA 4CCAA 1BD3A 4RKFA 1M2GA 4M8SA 4QUGA 5AJXA 1IUKA 4NC9A 1Q3KA 1SKAA 2C29D 1OLSA 3LX6A 1VIDA 2EGHA 2I91A 1OH5A 3J7AC 2DB3A 2WYOA 3W34A 5HRUA 4FZJA 5DM2A 3IVXA 4OSOA 3T9AA 1Z5PA 3VDXA 1KVRA 2WFLA 2YMPA 5BN4B 4UUNA 1TTQB 4P2BA 3C6KA 2H29A 3GJQA 1FFGA 3LK7A 4CR7A 1ZR4A 2CKDA 4RKWA 1Z83A 5BUSA 5KTPA 1FLNA 1STOA 3A6EA 2JAQA 2RGAA 4JR1A 2EFHB 4N40A 2EFCB 3BWMA 1JEJA 4CLRB 4B3CA 3U3DA 1QIMA 3GEBA 4IVNA 4ZQHA 5F33A 2FX2A 4URYR 1N5DA 4QOEA 2CVZA 3TUJC 4GQIA 3JZMA 1PEAA 2OCXA 2FR8A 1EE1A 2CNOA 3D43A 3C7CB 1UC9A 3GZNB 3NAGA 4HDKA 1P7ZA 1XTBA 2ZJBA 4MS3B 3PRJA 1F8XA 2DUNA 3EPKA 5GM1A 3SZ3A 2OB2A 1I9GA 1YH3A 4RHEA 4W7IA 4YCMA 2F64A 2AIRA 3OUZA 3FPHA 3QVOA 4JGIA 1SKBA 2YVLA 3PJFA 4E5DA 1B7GO 4B3SB 2BP7A 5DM0A 1JILA 1QIKA 4MRNA 1N2JA 1VB3A 4LE1A 1QZUA 4TZKA 4EMSA 4YAJA 2IS6A 3ZNPA 4UKDA 1LCDA 1HRDA 4WLVA 5I9MA 3FD8A 4BATA 5CBPA 5D01A 4YBAA 2FPIA 3DDUA 3S1SA 2QLLA 1MO4A 1T4GA 6YASA 3C6ZA 2HGSA 5KYVA 3P96A 2IYYA 3TGLA 2DLDA 1JFFB 4G41A 2NIPA 4NCNA 3GFGA 1AHNA 2RHRA 2B8WA 4CHTA 2HK8A 3M7IA 2DQYA 5BSTA 2OC4A 4EYEA 5JYCA 1NBMD 2GM9A 3K72B 1ADGA 1E3SA 2DTXA 1D2HA 3WLFA 5JXJA 3VU9B 5KNBD 1E2NA 4UBJA 4F2PA 3R5JA 3A1TA 2PZMA 4CMGA 2HRRA 1CQWA 2P7IA 3LIIA 4HB3A 4IIEA 1Q7EA 4M1QA 1WW3A 4CM8B 1ORRA 1VQ1A 2PT9A 4GMDA 5DYNA 3UWDA 2I4RA 1KYZA 1V41E 2ZYUX 3IALA 3KJHA 2NZ8A 3WSTA 2YYAA 4E1VA 1X7YA 2VQEB 2IP1A 1JIUA 1KDOA 1X13A 2ODTX 2VNIA 1QTQA 1DTEA 4KIUA 2IEAA 1YIOA 3OZFA 4IXMA 3LX4A 4JNKA 3S28A 2VJMB 2YWDA 5ALVA 2HHHB 2XZLA 1H8ED 2BKAA 5DRYA 5FQNA 3CVWA 2RDMA 3CLTD 2C99A 2Q4OA 2JFFA 3N9IA 1ZJWA 2UYOA 1O03A 3HB5X 3SZLA 1W7AA 1XFAA 2ANBA 1Z6YA 3RVNA 3TOXA 2Z58A 1Y5MA 1L5FA 4ZMSA 2H08A 4L28A 3L79A 5IZCA 1R0YA 1UFVA 4LJKA 3IKVA 7YASA 4OFWA 1N5JA 1ZNYA 2JLBA 3B1KA 3CTPA 4UXIA 2YZNA 1O94A 2PMDA 2VTVA 3AB7A 1KU6A 4M1MA 4EB8A 4OH7A 1U80A 1D2GA 3ND8A 2P5YA 1E18A 4LJYA 1JIIA 3BSFA 1XYVA 5ALQA 3MA0A 1ISFA 4KQ9A 3VXKA 5DSTA 3GBFA 4A23A 4TS4A 3RLIA 4C03A 5MFPA 1H66A 1BCRB 5JD4A 3P71T 4F12A 1IEWA 4YG7B 4XWWA 1P29A 1R5BA 1AD2A 4B6PA 4UTRA 2QBYB 1QUEA 1Q0PA 1W8IA 5ARDA 4QHSA 2IBMA 1V37A 3FLBA 3H6GA 2VQSA 4JJ7A 2ZOSA 2W0SA 1Z4LA 4N6OA 5JARA 4BVHA 3AFHA 3QU9A 2OBMA 1J6UA 4FOPA 4C6SA 1QVZA 2FKNA 3FYUB 3UCEA 1Q0QA 1T36A 4EI8A 5IARA 1PQUA 4PQFA 4HWKA 5CA1F 4NOJA 3N58A 1K8QA 3HFRA 2TECE 2E4YA 5J2UB 2PX8A 4BFWA 2AUMA 1LMB3 2XQIA 4Q3EA 1R0SA 4GZMA 1U0LA 3IE0A 4A0HA 2BSXA 5FP0A 4G1BA 3AP2A 5IUNC 3CROL 1Q1NA 1FYDA 1QUFA 1RXIA 1Z38A 2IIBA 3DKRA 3E2MA 3I92A 3NM4A 3UUEA 4ROTA 2JG3A 4LDPA 1E6MA 4QTXA 4AWXA 1PNRA 1E1CB 3E4DA 3EMKA 3HJUA 3PXBA 4W5HA 3IVMA 4UTNA 1Y9AA 1AU7A 1RRMA 3A32A 4HDMA 1L5HB 1X39A 4X4EA 2AJ8A 2D00A 3FMFA 2JFYA 3K2QA 4FHCA 4TS1A 1FTQA 4BDSA 1NXVA 1W75A 4R2JA 2J9GA 1ZKDA 4CL8A 1G21E 3AOEA 3X1KA 5LQRA 2HDHA 2XUDA 4MKRA 3U61B 4TWRA 1NNEA 2H5EA 1IOZA 2JEYA 1ZUIA 3W06A 2OGWA 1E1LA 5BW4A 3B52X 4K3UA 3TIGA 4YFYA 1EDEA 3LPAA 4JEHA 1ZX1A 3KPWA 4RSMA 2MSEB 1OI2A 3DVAA 1P9OA 2AI1A 3TJZA 1A2OA 4M98A 1CK4A 1OT5A 4DUPA 5CCXA 1YUMA 1ZGCA 1WOYA 4PCLA 4Z5CA 1R4MA 2PMKA 4WADA 4LZJA 4WXEA 1YKSA 4FFWA 4BQEA 5FV4A 4HZUA 5F5NA 5IBCA 2JCSA 1TNDA 2Z3VA 5KSWB 1KQOA 1YB1A 3UB2A 2D3WA 4EHJA 5MF6A 2AEFA 2NT3A 2DWUA 1DQZA 1ML4A 4K9DA 4FHZA 4ZQBA 1N5LA 4Z0HO 4URXR 1BOFA 4PLGA 4MUGA 1IMJA 1QO7A 1W5FA 3MS2A 2IS4A 1DC3A 4C22A 3G9UA 2KBFA 1Z35A 1SULA 5FTMA 4NCJA 4WNYA 3OCVA 4F86A 5LQJA 2J8ZA 2BCEA 3IERA 3F7NA 1HKUA 4GRAA 2C2YA 1FSFA 2WJYA 1PS9A 3KYDB 1NERA 1PR6A 4CMEA 4UMFA 1AK9A 1P18A 2ZJFA 3GJXC 1GKIA 2POQX 4M7PA 1PFGA 1PU2A 2DBRA 3OOSA 4P98A 3KUXA 4EYQA 1QPZA 5DBEX 2RGNA 4KWTA 1PYOA 4MYHA 4N3GA 4DB4A 5DRTA 4NAHA 1WNFA 1VIYA 3EUFA 1ORWA 2A86A 2ROQA 2Z8ZA 3MTJA 5B58C 1RRFA 1AZTA 2G8NA 2X5JO 5G53C 4WNAA 3FOEC 4G8CA 4FLMA 1L0BA 1V7PC 3RK0A 5JXHA 4J0FA 1KI8A 3WIDA 1NGSA 1T1EA 2X9QA 5D1NA 2AG1A 3L06A 4A6XA 4DIKA 3B6IA 1K7XB 2M98A 2YWCA 3I0MA 5C34B 3OH8A 2WHEA 4CCSA 4NU0A 3TKYA 1ESNA 5DN6A 4Z6KA 4WJLA 5K6AA 3SPXA 4MQUA 1Y5RA 3VBCA 2Y0CA 1H05A 2AHRA 2BFMA 2QRVB 4ZPXA 3T1VA 4B4WA 5IZ4A 1QQ5A 3EWNA 3X1WA 1DXQA 1Y8CA 1EFKA 3DOOA 4FOLA 3KS9A 1XKLA 4KLNA 4WLUA 4EI2A 3JALB 1YI1A 4MUHA 4D9JA 3HKCA 3DWEX 4L6AA 4BMDA 2CXQA 4NBUA 1FDWA 2PQ0A 5KYUA 4MUMA 4MVJA 3BB4A 1DI0A 4HNQA 1VA5A 2LDXA 1RXCA 3AERA 2Q28A 4UVHA 3RRYA 5HJ5A 4I9HA 3EB9A 5AXBA 1GTRA 1SVKA 3B7WA 3DEYX 3H1FA 4L4YA 1H2ZA 1W73A 2EATA 3QENA 4B5LA 2XNDD 2HD4A 1ZCZA 5INTA 2G67A 4M0PA 3NBZC 2NSYA 1IH8A 3QBVA 2AK2A 1U28C 3KB1A 3CR7A 4HDRA 1P77A 4D4GA 2FEOA 3UT5A 4OI1A 1EJBA 1CWUA 4PHTA 3GEPA 3GT7A 2HYIC 1Z4NA 1NRWA 3KEQA 2G08A 2ERCA 4X65B 2WF8A 1V11A 5IJAA 2B78A 1LH0A 4IP0A 3RDPA 4WXRA 4KJXA 1J24A 3JZDA 2XE6A 2QTHA 2HK9A 1KDVA 2PNJA 2C7RA 4V39A 1SUFA 5P8WA 2V4MA 2JLVA 1R4MB 3ZE0B 1LRJA 5KDDA 2REOA 3IQXA 1QYDA 2XQKA 1GPKA 1L7QA 4WKGA 1LPPA 4B82A 1XRRA 1YASA 3RYHB 2R5FA 1DPGA 1ISIA 3F5DA 3ZU4A 4RFSA 3BPSA 4DSNA 4C3ZA 1OREA 1XBTA 4JP5A 4B34A 1KY5A 4L9SA 1XZIA 1G8JA 3OMXA 3QVVA 1QRTA 3S55A 2XV1A 4UU7A 3CKMA 2O8FB 3HR8A 1MJGM 5LCXA 1KJNA 2QM8A 3BTUA 3SJAA 2IX9A 2HLPA 4R98A 2SCUB 3T52A 5AW8A 4Q82A 2O8CA 2OHGA 4N0MA 1G2QA 3A37A 3EEFA 4OK3A 1CDOA 2BRUC 2XAAA 4URFA 2FSHA 4I55A 5DU2A 4F8EA 2GASA 3MD0A 2RGBA 4EHIA 3WR5A 1UXKA 4X1YA 3A9XA 3F8TA 3AR4A 5IAEA 1P9LA 1MNQA 1XZ8A 2PGJA 2AC4A 1U02A 3FPCA 3RVOA 4HVAA 2GZ3A 2OCKA 3WLRA 1A72A 1W1WA 1JLRA 2A9VA 1PT7A 4RD6A 2QQFA 4Q02A 3AHCA 4HX9A 1DQNA 3AXTA 3C7TA 1XCBA 1G21B 5DNVA 4JSYA 3I64A 2GPBA 3MFQA 4YQFA 1IIRA 2H6EA 3JXEA 3LYLA 2IPOA 4R5MA 3TEPA 3BOSA 3IJRA 2O49A 4WY8A 4H7PA 5CFPA 1MC8A 5IVKA 1QOZA 2PY6A 1N5KA 2OHFA 2W70A 4DG9A 5LZ5A 1N32B 2P2DA 3NVKI 2F62A 2Z95A 2QQ5A 2CL0X 1IN8A 4BVFA 3ORHA 3CF0A 5K0GA 1H3EA 4QE3A 3AXSA 3REQA 2ZE7A 1W1IA 4CEIA 1Q77A 1KBOA 1T4DA 2ID4A 3E7DA 2UZ0A 4RKQA 7ABPA 1DINA 3RYCB 3F47A 4Z9BA 4YV1A 4JJ6A 1QZ3A 4N76A 1FP6A 1Z3CA 2WJ6A 3LHKA 3ADOA 1QCYA 4MPJA 1CR4A 2CMGA 2PGIA 4G5QA 4NXNB 4NNJA 4JCYA 4AUMA 3PQDA 2PSDA 1KY4A 3OOJA 4EUEA 1KVUA 4TRJA 3RYTC 3FVTA 3DJYA 4ZCPA 4AS1A 2I2AA 3H5NA 4G8BA 4RK1A 1QLWA 1V7QA 2ZTHA 2RC5A 4B48A 4MKFA 4U9UA 5TF4A 1U8AA 1WUIS 4DR6B 1ZS9A 3I4LA 1A9TA 4DA4A 3JWPA 1VI5A 4ZVLA 1ZHFA 3T41A 4YMUA 3MOGA 1EJ6A 4ZO8A 2OYSA 2RHLA 1JDZA 3ANTA 1GVHA 4JIMA 1XYYA 3R6GA 5CA0A 1V9SA 2IHYA 4KPFC 5B6JA 2PXPA 2C5AA 1EFCA 4K6GA 4CMIA 2YHSA 2JPDA 2QRMA 2VL7A 3T1YB 1QP7A 3FFAA 2VSOA 2XNCA 1QJCA 5CCBA 3KJGA 1SXJD 4OQLA 4I5GA 1E2DA 2QRNA 3GLGB 3CRMA 1C5KA 1QYIA 1TC2A 3L0SA 3O90A 3OMWA 2WY2D 1NW3A 1AS3A 3R9IA 3WO1A 2O06A 4EUHA 3VKHA 2F00A 2P68A 1FPMA 2V7EA 2VF4X 4UHCA 1R4ZA 2Q7XA 3NJ8A 4JDPA 5JRJA 3DHNA 2I62A 5K5EA 1X14A 2ZBUA 4JJAA 1A5BB 3NOOA 3KVYA 2I2CA 1QXSA 4G1EB 3TL3A 1A4RA 2VUHB 4X0EA 3WK5A 1EP2B 2QUIA 4UE2A 2NTEA 3ZGVA 2ZT7A 1OAOC 3EIUA 5HOEA 3R7LA 1TKBA 3ROEA 1JVBA 1LRKA 2C77A 1HLPA 1UKZA 2P8JA 4PXSA 3L7MA 3RW9A 1TM4E 4KQIA 5DXFA 4E08A 1SELA 2JAHA 2VSFA 5FRDA 5CW1A 2IYTA 2YN2A 4A0SA 5LWQA 3DLBA 2Y1OA 5EPEA 5KOIA 2BH9A 2GZAA 2I55A 3M5PA 3MQ4A 4NPCA 1CZRA 3BTOA 1WEHA 2JCYA 4LMBA 3OCWA 5T4EA 2A0FA 3OHMA 4F5ZA 3EXFA 2JFGA 3C39A 2ZYSA 1PYGA 4PAQA 2B6HA 2YUTA 3IAEA 2FWJA 4KSCA 1JKJB 4C88A 4HEQA 4ZK2A 5J2UF 5EFOA 3PTLA 1E8NA 1Y3CE 2GEJA 2GBFA 3O2NA 4CTNA 9ATCA 1SCKA 2P75A 2N1MA 4B35A 3WWCA 1VM6A 1ZH8A 4PPGA 4N3CA 1UEXC 4PSDA 3LUGA 2BTQA 2O8EB 1EDBA 2P0EA 1HL3A 3DKPA 1LY1A 4F6LA 2P9FA 1TQHA 1LV7A 3KVNA 3MGAA 3OE4A 4FIDA 4WVFA 2MJLA 3VOAA 4ZYXA 2AC2A 1Q20A 3O4RA 2H65A 1NI4A 1SC1A 2MXDA 3HDYA 4NU8X 1IBKB 1ZUNA 3RAGA 3SJ7A 1XV5A 1WEKA 2ZBVA 3JWHA 4PM4A 1ZITA 1PL7A 1Q12A 4GI3A 4I14A 4ZVPA 2C5GA 3VI4B 1PYDA 2WYHA 1W9MA 1XDGA 5DP2A 1UWLA 4Q7MB 4DBVO 4JH0A 2ZCUA 3OOYA 2NUTA 4BP3A 2MU1A 3R75A 4MUEA 1JDBB 2Z4SA 3FKSD 1K63A 3T7JA 1ZICA 2DPXA 3KEOA 4PZZA 4A92A 2PGDA 2XYGA 1KS2A 3KQVA 3CLVA 3F7MA 2ENUA 2QZZA 1KVTA 3PK0A 5JXGA 4HEJA 4UUOA 4DC9A 2VI5A 1Q3TA 4B6EA 2VDJA 3SIPA 1ZIPA 3X1JA 2YZGA 4L8YA 4R68A 1OXXK 4B2YA 1PGPA 2IPNA 2IE8A 4GQAA 3IKJA 5THQA 1KKLA 2YASA 4OOFA 4W4TA 4AJIA 1VLZA 1YDFA 3WQBA 2VP6A 3ZGOA 2VYVA 3O31A 3DOHA 3F90A 4YT4A 2OORC 2X77A 1IJBA 2JJQA 5EHQA 4CGZA 1MB4A 1PX0A 3K1YA 4K6MA 1F06A 3TSWA 3VNBA 4U7JA 1TTPB 5DM60 3B36A 3QI2A 4GP6A 2Z8YM 3DOEA 2DLNA 4WEQA 3PXUA 4XWTA 4ZIRB 1PUIA 4GKJB 2GHRA 4RKEA 1OWNA 1UOPA 3I5AA 3OWQA 1KO4A 4OI4A 5EG5A 4EELA 5JI2E 4S1PA 1IZ8A 3V8VA 1UK6A 2IHKA 3AP1A 3DVSX 1FRNA 5HJEA 3THXA 3L6EA 2WLTA 1DO2A 1MJNA 3A70A 5CFMA 1FU8A 5BVGA 2WWFA 3VDMA 4UHJA 1EVJA 2I7DA 1WXXA 1UBHS 1U4SA 4MWGA 1SAYA 1DCKA 3GMTA 5DSZA 3QTLA 1JHVA 4EO9A 2BNOA 2OQ2A 3EXEB 2C5BA 1CUXA 3N59A 4H4CA 4MWCA 1FRFS 2DFTA 1AC5A 3ZDBA 4IYRA 4X84A 4FM9A 2Q4TA 5JC8A 4BY9E 2BYTA 1TVMA 2Q2OA 1SIUA 1IHPA 2IT1A 2RARA 1NURA 1FL9A 3AIMA 2AGVA 3EXIB 2GAIA 2R8EA 1V8ZA 3UEOA 5HOQA 4YRPA 1YB2A 2JASA 5JSZA 2V6GA 1QFJA 1OZHA 3LP6A 2BPOA 3C7KA 4HNRA 4M22A 4JLSA 3IP9A 5EHNA 1DMSA 3V7NA 2F9FA 3DUFB 4ZVOA 1E96A 3EDCA 4BBJA 1HFKA 1CJBA 3JWJA 5TV2A 1J06A 3MXOA 1JNXX 5COQA 5FI3A 5FOWA 3IUSA 1FFDA 1W52X 3ZWMA 4C4AA 2AD1A 3H1GA 4WECA 2ZIZA 3NROA 3NHSA 2GJAA 3G89A 4DMKA 3K1JA 1NMQA 4CI9A 2P78A 5EA2A 4DIUA 1WD5A 2O19A 2QBYA 2VRBA 3CXUA 4KZPA 4F5EA 4Y2UA 1M5TA 3CRNA 3QI7A 3KTAA 1CEYA 3QU4A 1BWQA 1MGOA 3NATA 4CF6A 3E22A 4ZZ1A 4IIDA 2HADA 4AXBA 4V2UA 1JYEA 2J0UA 2P6MA 4GI2A 3TTWA 4TWIA 4HJRA 1ZP6A 4FYPA 3TW6A 2L42A 1OZ0A 1OFHA 3P26A 1B0PA 3G0IA 5BVHA 2IU6A 2QV0A 2FR8C 3RGWS 5BNWA 3GO4A 3BX1A 5EXXA 1T2UA 4LV8B 3R0IA 4BB0A 3VYTB 5K8IA 4HTFB 1RBMA 2IYOA 1B8UA 1H6DA 1ZIOA 3E15A 1QS0B 2WPDA 5FA8A 1TXGA 1FNDA 4HGYA 3SCFA 4UU8A 4BNTA 2VIIA 4PPNA 2IU7A 4JDUA 2X6RA 3AI3A 2RHHA 4DM4A 1AT1A 1C1YA 2HT1A 5IWCA 1Y6QA 2XUPA 4JR2A 2C9YA 1KE1A 1P5FA 5HPYB 5KNDH 1UMDB 2ZJAA 4RTJA 2HBYA 3AMVA 4MR8B 4PYOA 1RR6A 3K6JA 3ELYA 4TRRA 4EHNA 1UAGA 1V4NA 4QOIA 2G83A 1GG5A 1JP7A 3SCZA 2XJ4A 3O8OB 5HE8A 3O8DA 1P74A 2MYUA 3L6BA 1XQVA 3FVRA 3HGMA 4J7UA 2ZRDA 1HBJA 5IAGA 3W9SA 3EY4A 1KYWA 3GHHA 4O29A 3EXG1 1DKOA 2B3TA 2MINB 3R3SA 4E09A 5KNCD 1M6YA 2GXQA 1X86B 2UYQA 3GEDA 3TLYA 1PJ3A 4LXIA 1K1EA 3FUUA 1RYBA 1RYZA 5IKPA 1ZBDA 2VRCA 4COKA 3OBBA 2RG1A 3GGCA 5B64A 3TGPA 1XQWA 2X4DA 1M1NA 3LK6A 1HFJA 4FW8A 4O5OA 4RA6A 1T8WA 4OQFA 1MRNA 2QXYA 4G84A 3ZZMA 3JWEA 2QORA 3MN1A 3T7RA 5DNWA 3DBRB 4FDTA 3T99A 2JFUA 3LNCA 3OCCA 3A4TA 4BGIA 1GGHA 1V26A 2YW2A 2RGYA 4JJGA 4OYHA 1KRWA 3KT6A 2YS7A 1K5PA 2L0XA 2PUGA 2Q5OA 2OTCA 2YMLA 4H6XA 2IVFA 3ORYA 4BTEA 1EKXA 3MGGA 1V4VA 2CD7A 4MGYR 3T12A 5ICGA 4LRXA 4JR0A 1C9DB 4UCWA 2P1RA 2PKCA 2V7TA 4TKUB 5EQJB 1H3NA 3U44B 1YJXA 1AUPA 1C81A 1L1RA 4MAMA 2ZDQA 1SHKA 3ITDA 4BNXA 1OXMA 1K68A 1VJRA 3VNSA 5GVSA 3ZGXA 1EFRD 1XC7A 3C74A 4JWKA 4KB5A 1ZCBA 2GNOA 2XIUA 5BOSA 4JCXA 3SMVA 4NFHA 3DT9A 1SC6A 4KH0A 3H5AA 1D1QA 2I8CA 1Y37A 1EK0A 4D9HA 3P4XA 3CEMA 1K0UA 2R8XA 4QUHA 3HCWA 2VHUA 2ADMA 3BRWA 4XGRA 1DE0A 1U1DA 3LX8A 4JNCA 4WWHA 3TXXA 4JI0B 3ZN2A 5ITZB 5JNUA 1TO2E 1Z62A 5HZMA 2II6A 2Q2WA 1I2BA 1VMEA 4Q01A 2FEKA 2FMUA 5FV7A 1K6JA 3SXJA 2YN0A 5BT8A 4KDCA 4I1SA 4RTMA 2MINA 3DTVB 1H2RS 3LISA 4A6DA 5F9FA 1QQTA 5BVGB 1OXSC 3KOOA 2OAP1 5SYNA 4I5FA 3FYUC 4L5CA 2VDNB 3WGIA 1XMSA 3P9NA 1YJCA 1YJBA 1EQAA 1ECLA 2C5FA 2FZVA 3ZHSA 5IDWA 4MR9B 1Y1QA 1MA3A 3BMNB 2A9QA 2CXHA 2JJMA 3E5HA 3WKBA 4DLWA 5CB0A 3KT0A 3T3OA 3ADCA 2NVWA 3JRXA 4PCVA 1IZ0A 3OECA 3WK9A 4JITA 1ZZ8A 1CCWA 3KPYA 2OE2A 1VJCA 3KBBA 2H85A 3T5PA 1IONA 4U2EA 3PUWA 2GH1A 4R1TA 4O4IB 3G8DA 2VUIB 3ABSB 2OMEA 2XA2A 1E1RD 3HA2A 2A5FA 4B44A 4BJHB 2ZBQA 4IXDA 3TYXA 1EPUA 4HSGA 2DH5A 1ZONA 3HCRA 4INPA 4U8GA 1J25A 2PL3A 1YFZA 2FPLA 4N5DA 5ALGA 5F64A 3TAXA 3WYCA 2QNIA 4PF1A 1OVMA 1X1DA 2OBYA 3D5QA 2G80A 2Y1XA 2ZREA 4Y2VA 3S27A 2YQ5A 4QQ8A 1BA3A 1NX9A 2J07A 4E5YA 8LDHA 3CVYA 3ZZTA 3TZBA 2E21A 3LVFO 1U6KA 2KM1A 1WP9A 1H3FA 4IHJA 4YLYA 3IEMA 4RD4A 3E9RA 3PKZA 3UGTA 3OP9A 1JLLB 1UBSB 1P19A 2Q3BA 4YT5A 5ALSA 3WJAA 1OFVA 2ZIEA 4Y30A 2W2MA 4BYMA 3PFFA 4RADA 4LVUA 3GLIB 1NVEA 5LR6A 2GR9A 1JA1A 3NIDB 1SO8A 2BFDA 4HQLA 3ZS9A 4DIMA 1S9HA 1BMFD 2JJ2D 4S05A 2ZJ2A 4LMPA 1EHIA 1RFLA 3GN1A 4KKVA 1ZGZA 4FS3A 4YCLA 3VA7A 1WUTA 4E46A 3U3WA 1KERA 1ZL2A 3DTVA 4DJAA 7MDHA 2AV6A 3SKVA 2WWXA 5JDCA 4D6PA 1RXWA 1S1MA 2CEAA 4WNIA 1SZDA 1U2RA 4PGFA 4TV8A 4ARSA 2WVGA 3KUCA 5C18A 3TSZA 4XVQA 4L9RA 3UUGA 4EMTA 3QOYA 3SXUA 1Q2UA 1M8GA 4NAUA 2FRDA 3J81k 4MI6A 1EWTA 3A6FA 2JHCA 3TRJA 3V1NA 3ZTWA 5K03A 3SXUB 4RPLA 3BZWA 2P79A 2ZE5A 3A2LA 1KI6B 3VC2A 4BC0A 1K86A 3HK2A 1J8YF 2ZYTX 3KLBA 1CJUC 3DNFA 4RQAA 1KFBB 4EKEA 4YY3B 1LA2A 3BH0A 4XWYA 4BX0A 1T36B 4TL6A 1ND6A 3KR2A 2VDUE 1EX9A 4FD3A 4NOKA 5FJIA 5H0IA 1RPEL 3ZNQA 4TKVA 4NCBA 3KV3O 4LPKA 4Z2AA 2OA0A 5C8YB 3VJRA 1YQTA 2E6UX 5K0EA 4ZODA 3ZGNA 4UEOA 3ZWDA 2BFAA 3TVDA 4D9GA 4F3NA 4L0CA 2VHJA 2I9PA 1NIPA 4G25A 1YR3A 2XADA 3IPXA 1CB0A 4V0QA 2HMSA 3LHDA 1JHOA 2PXEA 1XCOA 1LQCA 1U5BB 2XZPA 4RAQA 3W8DA 3VNVA 2CLKB 1M2EA 4Z53A 2D2IA 3GGPA 3HWRA 4IDNA 3W7VA 3H99A 1L1EA 3ZDDA 4MKHA 4J29A 1LF0A 2Q1UA 2Q41A 2J5QA 1CQIA 3GOQA 3QW4B 4HH1A 3D7KA 4LBZA 4XDZA 4IUYA 4EUFA 5C8VA 2ZBEA 2QE7D 4EKNB 3CUSA 1B76A 1O94C 1FMCA 2JZOA 2L1PA 4XTCS 4QSMA 3BRCA 3P9ZA 5B3JC 5DNAA 3KUUA 2V3WA 5I01A 2OHIA 5CDFA 3VHXB 4YP0A 2XJ3A 3M5CA 4V1CI 1JMYA 5HCUA 2GRMA 4RESA 2IYPA 2A94A 3K0FB 2DWOA 3KQQA 4Z0TA 5H8WA 1L8LA 5AT1A 4MV3A 4RJTA 5A6SA 1R6AA 2G07A 4LF5B 5BPFA 2XZTA 2PUTA 3LDHA 4QA9A 5F52A 1ILEA 1GPH1 3O4HA 1G3QA 1NPDA 1Z29A 4XB6B 3MS4A 5KZMB 2P1DA 1JAXA 1QQAA 3VR1A 4P9NA 1G8PA 3GJ7A 1BVUA 1XQ6A 1E3EA 1Q7BA 1UPXA 1XZCA 2JB9A 3I9V6 3KKPA 2POCA 3QX8A 1KY2A 2AQKA 2F1HA 2XCUA 4IJKA 3HADA 2FUNB 4WOPA 1FFYA 1RJGA 4CG0A 3JAMA 5K05A 2J9FA 2G5CA 3KKNA 3LQFA 4NR0A 4OGFA 3DV0B 1Z7BA 2GI4A 3U0VA 1VMDA 1FYXA 2ZIGA 4QGFA 4C0HA 4D9IA 4R84A 3BF8A 6REQA 3TR5A 4Y1EA 2WQZA 3VU9A 5FBVB 3K7EA 3DCNA 1QU2A 3PUHA 3RUPA 2FQYA 3IUBA 4JAVC 2JHAA 1WTCA 3HYCA 4L7VA 4LBWA 2MSWA 4WKNA 3VR6H 5DX0A 3CX7A 4PO1A 1CR1A 5H9WA 3NT5A 3CV3A 1OSLA 5IG2A 2BFEB 1XLWA 1AVTA 4WESB 2FZKA 4FB5A 1KAMA 4K8RB 2CHEA 1E3OC 1SRRA 1ZD4A 2FETA 3PF8A 1EVKA 5G4KB 2FB9A 3SCGA 3V00A 5IXYA 5DBHX 5LLTA 5FWYB 3SLRA 3N87A 1QRDA 2UYCA 4HAVA 5AM3A 4X64B 3LH5A 3CUYA 3FZQA 4O4IA 4P83A 3G82C 4JLJA 4CM4B 8ATCA 4P3PA 3WGZA 2IPXA 3L8GA 4H08A 1GYPA 4K2HA 1SQ0A 4QFCA 4BMPB 1PHRA 2XTJA 1UINA 3VR3A 2YDYA 2H18A 1XB2A 2PVCA 1AHHA 1RI4A 3L1UA 1EYZA 2G5PA 5IT9A 3UFXA 4LXGA 3H2HA 1FUIA 1L4EA 3IQIX 4HXGA 4EVIA 1C7IA 4G5YA 4OHPA 3EN0A 1NYQA 2I34A 1U0OC 1G1MA 4ZU6X 2VBFA 4QOGA 2AKYA 2IF2A 2QUJA 1UC5B 3EIQA 3OFVA 5SYAA 2B1JA 3TECE 3T7KA 2C82A 3V32A 4QO7A 5KMGA 4RDHA 1E5QA 1EP9A 1UQUA 3DVAB 1ISSA 2YQZA 1L4UA 3OBIA 4NULA 3EFBA 4B7UA 3EW7A 5EIFA 3M82A 1IHXA 3FR8A 2CCJA 3C1UA 4FCTA 5L4NA 4DANA 2EJCA 1L4HA 4QC2A 2C2XA 3D6JA 3M34A 5EVCA 1GUFA 5E6RB 2QNRA 1LSOA 1T5LA 3ZJYA 4LF6B 2NZXA 2NTYC 4JJEA 4YJGB 3UN1A 2ILTA 3H9BA 4IIGA 3Q3CA 3QOFA 2WYIA 1ZGGA 4Z4QA 3O38A 2CNDA 4LHEA 3BB1A 3NNNA 2E4UA 5FUMA 4GDFA 3LC1O 2J30A 5CT9A 5KX5F 1CV2A 5FOQA 2BGRA 2I3AA 2FHPA 5J2TF 4J2HA 4NYJR 1Q17A 2D2EA 3M1LA 5KU7A 4OLBA 4NDAA 2W6JA 5EE3A 1TDJA 2WB4A 4Q47A 1G8KA 3EOZA 4N18A 2XMQA 1C80A 1Z6GA 3H87A 4Q7JB 1GZSA 1N92A 3GJZA 4RY0A 2I6TA 4FBMA 5JCJD 2WVAA 3AR6A 5BQPA 3KALA 3AYXB 1PGJA 3IE2A 3JQ7A 3V48A 5EYPA 1CZOA 1H4TA 1K8ZB 3RR2A 3O82A 5KC9A 5GMOA 2QUHA 4EKIA 1FLVA 1EFVB 2J32A 3SX0A 2OV3A 4HGRA 4DEXA 2XZOA 3OZBA 3ICWA 1T8YA 3DW3X 4AMYA 4POAA 2B4RO 4KFSA 1Y8RB 4J0QA 1O97C 1UT5A 3KQYA 4AUEA 2PJRA 4OFBA 2ZRJA 3I6YA 3SLKA 3R9XB 3M2TA 1N5RA 1OSNA 4Y6GB 2RJOA 3AERB 1OVGA 4RYDA 1T4CA 3W05A 4EHAA 2ISSD 4TM8A 4GIBA 3CW9A 2GZHA 2FPPA 4CNQA 1D4ZA 3TCXB 2A0KA 5COBA 3NXSA 2A33A 3QLUC 3U26A 1R10A 1N4AA 2A5YB 4R2KA 4L4SA 3TJMA 2FPPB 5CM8B 2HSGA 1Z0AA 1U5CA 4YV7A 2J3HA 2Z04A 4H17A 4KIJA 1Y6JA 2D0OB 4W6QA 2PVPA 4WLOA 5CDHA 1CUCA 5TJ9A 1NL3A 1T2CA 2EBWA 1L5KA 3EFHA 1EM8A 2PZ8A 3KT8A 3OESA 4HTFA 1L7EA 2WHPB 4DCTA 3WLNA 2J0SA 1F4PA 2C57A 2P4UA 2WJ3A 4UZEA 1YL7A 4BZPA 1L1FA 4CG2A 2D7CA 1JKJA 1YBVA 2V8BA 3PQCA 5ER9A 3AF4A 1AGPA 3JQ9A 3F3KA 5LQSA 4ZTUB 2FXIA 3U7IA 4XH9B 4JL5A 3Q7PA 4ZEOA 5ALMA 3RNLA 1UM9B 4UEWA 4F4FA 1BHQ1 5IK2D 3VKGA 2FFJA 5HKAA 1SBYA 4IICA 1AKUA 3WHKA 1E8DA 3LW8A 2QSUA 3RIXA 1RD4A 2W2VA 2JFPA 2WHYA 3E9EA 2D7DA 1HTTA 1H69A 3RE1A 1ZC4A 2XB2A 4A8JA 2TMGA 2HA0A 4H31A 2ODWA 1FUUA 3FOBA 2A78A 5IAAA 2PUFA 2B98A 3OE5A 1S2OA 3G59A 2X1LA 4RACA 4AKTA 4F2DA 4IVZA 1NVVR 2HNAA 1X57A 3G0TA 3ESZA 4KCGA 3SFVA 3A9UA 3OEED 3FVWA 4JKOA 4O2LA 5HHTA 1QZTA 3F2IA 2ASVA 3ZU6A 2WWRA 3QPAA 4YJFA 2KW5A 1Z68A 1WH6A 1F9AA 1UKVY 2LV8A 4ZU1X 5EGNA 2P30A 5LBIA 3U49A 4O4HA 3T5CA 4GS5A 4ZQEA 4J16A 3GROA 4P82A 4GD3Q 1G17A 5DLEA 4OL9A 3W8NA 5B3LA 2Z43A 3P97A 1AN9A 1T15A 3MYYA 1QNFA 1U3CA 1GKYA 3RUHA 621PA 2HZBA 1K9SA 1DARA 1UPBA 3ZLVA 4KUGA 4PZEA 3W5BA 1WXQA 4EZEA 1JLSA 1GNRA 1ZSYA 4NMMA 3L6OO 4Q1EA 2GD0A 3WRYA 2IVBA 1K66A 2ZFUA 3GRCA 1B93A 2JI7A 5E2IA 1XRMA 2H5JA 2PBRA 1K7YA 3AB8A 4DLUA 3DEFA 1M73E 3H0KA 4I8IA 1E0SA 4FGKA 1JDUA 5JQGF 5CTAA 3X1DA 3RRNA 3H5RA 1PV1A 1P3Y1 3KJNA 1T34A 2EG9A 3C6QA 3GC6A 3NH6A 4L73A 1V2HE 2GN6A 1J2UA 3BDVA 5GOZA 1MT3A 3I5UA 4ARVA 2AEMA 1KP2A 4KACA 1RKVA 3HBNA 1QRUA 5BSRA 3OQJA 3O74A 5IX8A 4TMTA 4ZCLA 1XTSA 3G5UA 3T7CA 4KZKA 2DC1A 5HKOA 4C4PA 2ZRCA 2ZYWX 2ZUCA 4X1IA 2M2IA 3Q3EA 3S99A 2H2WA 3BF7A 3ISJA 4EG4A 1G18A 4P0TA 4B7CA 1DOAA 1SVNA 4RLSA 2PRJA 3RSCA 2UV8A 2QM7A 3TR0A 2Z08A 4WBNB 2WAYA 5JHHB 1QO9A 3I58A 2CN1A 1CLEA 1HKHA 1IPFA 2BVNA 2CF6A 1GPLA 1K5DA 1QH9A 3D4IA 4LHYA 4AK9A 3A0RB 2MR6A 3R3ZA 2BT4A 3LY5A 2XB8A 2OUIA 4ZARA 4EB0A 1RM5A 1PJ8A 4R6XA 1G8AA 2WUFA 3FF1A 5BORA 2ERYA 4REQA 2ZQZA 5IZCC 5DBIA 3VZPA 3U5ZB 3CC8A 4WLNA 4Y2JA 1N6RA 4JT2A 1SUWA 2X0IA 4RVNA 1N0VC 1IY0A 4WOBA 2X9NA 3BK1A 3AV0B 4DQUA 4KO3S 4B8YA 5CYFA 4B6QA 3TUZC 2ZROA 1NQOA 4RPHA 3L7DA 7REQB 1T5IA 2PJZA 5EP4A 1VECA 2M1XA 1NQUA 3U4IA 3CNEA 1X77A 4EB6A 4L9AA 4FOSA 5I4BA 1G6HA 1KIFA 2DPGA 5KOHA 2EF8A 3QLTA 1Q0TA 4YJHB 1XL0A 4GSYA 2ZGVA 3IC5A 4ZAWA 5BQXA 5JNVA 4CM1A 3LHFA 2EBYA 5BOSB 1KH1A 3I0NA 5AKGA 3K0AB 4ZO6A 4KFRA 3CEPB 3FRHA 3MB8A 2OP1A 4U02A 1UBJS 2I5PO 3NC1C 2IUOA 1DJOA 1GT6A 2COEA 1OI4A 1ZZ7A 1RHKA 1TJ3A 2HMUA 3Q10A 2EKPA 3EYAA 4HWTA 2EGUA 1RKQA 2J9YB 3C16C 4II3A 2IZ5A 1OWMA 3Q9UA 1LCCA 1E7RA 2XCJA 4KL8S 3RC8A 4ZAYA 2BZGA 4UHFA 3CB4A 4BE7B 5J2TB 4ZQGA 4OBWA 4AJ2A 3NTVA 3RFTA 4F72A 3D81A 3GCDA 2HLDA 4TV9A 3QE9Y 2AR7A 5C1OA 2KS6A 4FUTA 5AK4A 4CM5A 2YIMA 3UT0A 3D6TB 1VDMA 1TM2A 4M3NA 2QMYA 3ULKA 2HA7A 2AL7A 3L7CA 4TYWA 1DOZA 4FI3F 4HZGA 1V5WA 1H6AA 5TXGA 3TAUA 4ALNA 4URVR 2VBCA 3OLZA 2QYSA 2F55A 5TS3A 1KYIA 1L7OA 2WIFA 4XQ9A 1XA3A 4GYYA 5GV7A 3F8SA 1NF2A 4IFIA 3ZCVA 2H2HA 1ACMA 1ZRMA 4GI1A 5F2KA 1CRPA 2VH5R 1X80A 3INGA 3EGXA 3N5CA 1GPBA 4Y2XA 1JQAA 3GGSA 1FP7A 3OCXA 3RVPA 2PRIA 4LW8A 1XAGA 5ECGC 2B92A 5DNYB 4JJFA 3N05A 3BE6A 2HSJA 3Q3GE 3BDIA 5D3MB 1C1DA 4FBGA 1WABA 1ZK0A 2IUSA 1F8UA 1LS1A 3BZBA 2OBXA 2ODPA 2OWDA 1AKMA 1JPVA 1CIPA 3PRYA 5EXDA 4YJKA 1ORTA 4S2UA 2IEIA 1M2OA 4F0JA 1WXWA 2OK7A 4Q4DA 1A77A 4CV3A 1F14A 2XKBA 4DCCA 3RT7A 4MQEA 5LP6A 2RSLA 3A9CA 1WXFA 1GRCA 4UPDA 4MEAA 2C5EA 2D1QA 3NEAA 4XYEA 4OXQA 1JVNA 2ZSIA 1R5NA 2ZIXB 4M0LA 5JOQA 1IZZA 1MX9A 4H3VA 3ZI4A 5FOXA 2QHXA 3H83A 5DTJA 4J3NA 1VLQA 2BCJQ 2PO7A 4YDRA 5FF9A 2HEIA 4ER0A 2H4ZA 3RFXA 2CLHB 1KVQA 3LX5A 3U7QA 4WIAA 3ZW9A 3UZUA 2I4OA 1YJ8A 2VLIA 1G7TA 1NY6A 3EIHA 2HU7A 2Q1YA 3C5CA 4F3RA 1E9DA 4B32A 3R6LA 2AZ4A 2FHSA 3CLUC 3S4YA 4A16A 1VGQA 4OQQA 1CJCA 5H83A 2F8LA 1L5YA 2XF8A 2KZ8A 1Z7GA 1YRLA 4V02A 3QFSA 5DNUA 1JI3A 4KNWA 3IVGA 1NUAA 1XHLA 3B3GA 3VO9A 2JQEA 2NAFA 4U9IS 4RORA 5AVKA 3BAFA 2JLRA 4BEVA 3CF2A 4C7OA 4YGYA 3AY0A 1ZVVA 3G02A 5JE8A 1FDTA 3A4NA 1F7UA 2PKEA 4DLZA 1ZISA 4GECA 2VF5X 1WG8A 4E1BA 2EYUA 3G5GA 5E95A 3BCHA 3MT9A 4ER5A 1D09A 1II8A 1KJYA 1U81A 1YBAA 5BV1A 2M1ZA 5JYBA 2XEDA 4N7BA 4X7MA 1U9IA 2BE9A 2QAGB 4JEIA 4E88A 1GGVA 1U5BA 3KKLA 1QHEA 3V1UA 5BSEA 2PUBA 2JNWA 5E4TA 5FBKA 4MPDA 2VCHA 4FHFA 2AG0A 2WWYA 1QKIA 4TUYB 5EC8A 5ERGB 5A1JA 3FXAA 2WM2A 4O8BA 4ZK6A 1H2YA 2QS9A 5ICSA 5ESDA 5CK4A 2AOUA 3ASUA 1SQFA 1DC5A 1LLDA 1RJ9A 2BMJA 1XXLA 2PKWA 3AR7A 3C5HA 3EZ7A 3HBMA 1WZCA 3KUKA 1TZJA 3WL3A 3WWOA 1OPXA 4EW3A 3BHIA 4L4XA 3S1LA 4ARAA 4UAVA 4ZEMA 1F1BA 3IEUA 2I6XA 1HT3A 2YMMA 1ZK1A 4MLZA 5EJFA 3L7KA 3SWWA 2WAOA 4O1MA 4TTAA 4ZEVA 1CY0A 3AH8A 2AWIA 3N8KA 4Y9TA 2NQTA 3PDJA 3L7IA 4HAXA 4JU8A 1NV9A 1HMPA 4OQYA 5A3VA 4C07A 2D62A 1ZIXA 1UFKA 1G5TA 2I4MA 2EFYA 2DECA 4U7WA 2PWBA 5FWXA 1I14A 5A4MS 2OV1A 2P90A 4QJ3A 1GQSA 3O83A 1D3AA 3I12A 4FB4A 2CV0A 4JOBA 4CHGA 3ROKA 3PTAA 3GEEA 5BYJA 1DXHA 4LGCA 1RI2A 4TVOA 3VR6D 1F48A 4I9GA 3OU2A 1U7HA 2EW1A 3Q7TA 4U7HA 4QOJA 5B1YA 1K08A 2BI7A 3F5MA 3DDWA 4YROA 2PSHA 3WK8A 4O08A 5D7NA 4R31A 1L4LA 1W0JA 2H1RA 3EVFA 4ABYA 4DR1B 2P2YA 3LQKA 3WGVA 3SCHA 1RRGA 3IBFA 1Y4AE 4ILEA 3IBCA 2AOWA 4RK6A 4CIDA 2C7QA 4BV8A 1JQ5A 1PGOA 4BMVA 4QXPA 3W8FA 3WBKA 4F5WA 9MHTA 2FYTA 3CNHA 4N48A 5AI8A 5DTRA 3S40A 1ZJ5A 3PDIB 1B2LA 4MZXA 3AGQA 1ZMRA 4LXXA 1ENPA 1PV2A 2QN7A 3IUPA 2QLJA 2VHZA 3FPJA 2XT9A 3FHJA 3WL5A 4LI0A 3FTNA 3O75A 5MGBA 2I0FA 4EZIA 1CF4A 1FNNA 3YASA 2D0IA 2BFBB 3DOFA 1C3JA 3EVGA 4G67A 1S2MA 3B38A 1O58A 3M6MD 3V1LA 5LQMA 2B30A 3DQQA 1KK3A 2KI5A 3MSXA 3MQFA 4OKIA 4YRQA 3KZVA 3CRZA 3IIEA 1IM5A 1G6OA 1A5SB 1SOUA 4N8SA 2C2HA 3PFBA 2JJ1A 1GP2A 2I1QA 3KKKA 2GEKA 4OJYA 3BS3A 1B6GA 1KC1A 3FTCA 3JATA 1I6WA 4GYKA 2WZCA 3U16A 2IXBA 4BKMA 2MCFA 1QWOA 4QG3A 3W8EA 4OMUA 5LQKA 1JE1A 1VL8A 2QRLA 1RYHA 3EPHA 3B12A 3FWYA 1ESMA 1WDWB 2YV1A 4OGWA 3MCWA 5A3SA 3NUQA 1PHPA 2C96A 1IZ9A 2VP2A 1YDHA 2FQWA 3ED1A 3KLNA 3F71A 4LJAA 4MW0A 5FUVA 4DE5A 2G40A 2G9QA 2Z3ZA 2WSSD 1C3LA 1E3IA 1MXFA 1O77A 2R62A 2ZSJA 3F1KA 3PX2A 1IRXA 1YAHA 1L7RA 1UDAA 4Y2PA 4YEDA 2D6FA 1ZMBA 3D7MA 1QH8B 2ZBDA 1V6CA 3T7EA 5J40A 1JJAA 3NWJA 3OPYA 1V16A 3OD5A 2P65A 5KVCA 1KHHA 4FMPA 3AUJB 1JJBA 2KJQA 1NVAA 5F1KA 3VH1A 1K88A 1ORVA 1SUIA 1UBNA 4CTOA 2FRDC 5GADl 1G19A 1FQOA 3K0FA 4L72A 3MC1A 5I7VA 5JIBA 5AVWA 2IH4A 2DG2A 2VT7A 4MW1A 5A4DA 4UULA 3A0UA 3CNOA 4BRZA 3Q4GA 3CHYA 1M2NA 3I28A 1R0CA 4JQYA 4NONA 4UVGA 5DBGA 3S8YA 2FPIB 3DBHA 3SOPA 3NIBA 2OOSA 2ORED 4X92A 2VUSA 4PU7A 4HNVA 1ZEJA 1YMVA 5L95A 3LCUA 2VRCD 2ZZNA 1EDDA 1HDRA 2PKYX 4TL8A 3VZCA 2QGZA 2O1WA 1PV4A 2PXVA 3AILA 1J0CA 3LT4A 3OT5A 1E6WA 5C8YA 3SVTA 2F3UA 1ULZA 3KXIA 5IF9A 2QRZA 4HZIA 2G0TA 2WKPA 3D8NA 2FQXA 1G9SA 1T5HX 4WJZA 4G01B 4JI5B 2WJZB 4D79A 4GU5A 1MX1A 1Q6ZA 5FUWA 3RI3A 4GL2A 3PNLA 1QF6A 2FW1A 2WKSA 2IY7A 1J2YA 2ATXA 3ESRA 2AJBA 5TPWB 4ESVA 5EIEA 2IGTA 5E7QA 4KWHA 4FGJA 4FFOA 1CHDA 1MW8X 3GZTB 3EBLA 3A1UA 4XI9A 1V3VA 3G8AA 3OU6A 3G5MA 4R2LA 3SC2B 1YBHA 1UXCA 4HDQB 3KXPA 2ZIAA 2YXDA 2OENG 2ZRBA 2A84A 5GPBA 4FQ8A 4P31A 5J2UA 2IODA 3TF5A 2BFNA 1O8BA 4M1EA 1KYQA 1SIBE 4HO1X 1B1AA 5KHLB 3LUDA 1Q83A 3WQSB 5LOVB 1QH8A 5FBLB 3CO5A 3MRTA 4RD2A 1MFZA 4IEFB 4LZAA 3QX3A 4Y1RA 3N7UA 2Y93A 3LY8A 5AM0A 2Z5VA 3G7NA 3K9WA 3W9YA 3N3AC 1EBBA 4DA8A 1F2UB 3TW8A 4IX9A 1YD7A 2A6PA 2H1LA 1WXGA 2XR1A 3V4VB 4BMNA 4YI5A 5K3FB 1JBKA 3VTZA 1EI9A 1ELOA 1WCXA 3AVOA 2BZSA 2Q99A 2DCMA 2O0KA 3EPRA 4IFTA 5J1TB 1ETHA 4XOUA 3UTCA 3AHGA 3R7WB 1YZUA 3ZWBA 2J3LA 4QGAA 2IDZA 1N5IA 2VQDA 5KJ1A 3AFGA 4LJSA 3JQBA 4NSNA 5ALWA 3WYAA 3VR5D 2RIRA 2CL7X 4A8TA 4MS4A 2FEWB 2QAGC 3JRWA 4MP8A 2VF7A 4OHBA 3RSHA 2C00A 4DG8A 3FOAA 2PUVA 1FMTA 1GFWA 4GI7A 5B1SA 2WMYA 4MS4B 4WE3A 1GPNA 1NPYA 5GZ6A 3W7AA 5CCDA 4MRAA 1E2QA 4A0QA 4MZDA 3FAZA 1KYYA 3RCBA 1O9HA 1M34B 3IODA 4ZHQB 1NG9A 3TSOA 2X42A 2FZEA 2O6LA 4WFIA 2VEDA 3NBQA 1I7QB 3IPYA 4ND1A 5E4JA 2QOEA 2IUUA 5C1PA 3A26A 3NPAA 1OXTA 3DZ8A 1ZYUA 1B4DA 1Z4OA 3ETDA 3AP3A 2C0QA 1CVLA 2YYSA 4H3HB 3M89A 1XPOA 3F2VA 1GNTA 3R0JA 5IH7A 4G1UC 4R1QA 2M4HA 3RS3A 3U1VA 4MH0R 3U7GA 2ONYA 3IDAA 1HE3A 1V7ZA 3EJWA 3OC6A 2CROA 4Y2YA 1PD0A 5IEJA 1XTTA 2HQSA 5DM1A 2CLEB 1FS4A 3F6CA 5JAUA 2VBIA 4KXXA 3ZY6A 3PCTA 2TMDA 1I4EB 1UM8A 2H2IA 3GFTA 4PCUA 4KR9A 5CHYA 3ZY2A 5CLQA 1U65A 4JUAA 4FHDA 3I5YA 3OKAA 4IOJA 2ZUVA 3L0PA 3S2GA 2SKDA 5EYPB 1IWBB 3V6MA 3EIEA 5LKRA 4EW2A 1ZZ6A 4L8FA 5I48A 1JWAB 3RJ5A 2XCIA 4Z9AA 2C3OA 4KP7A 4A7PA 5ICMA 1Y9QA 1WY7A 3M6AA 1Z0FA 2W9XA 4J4BA 4LE2A 1YL5A 1G3UA 2FOXA 2FWBA 2JD0A 4Z4FA 1Z07A 5AOVA 4ZT4A 3WFZA 3SM9A 5H3CA 3W2FA 3JQGA 5TT1A 1J42A 3RSZA 5CFNA 1BMTA 2PR2A 5CYPA 4XLTA 4ZDWA 1XSEA 3X1XA 1XRJA 2DEUA 1T3SA 3JYHA 4CV0A 3DPUA 2R85A 2GEVA 5C3UA 2QYOA 4KC0A 4KXYA 4HQNA 2JDIA 2OBBA 4WCFA 5L7TA 3NV9A 2CDAA 5LOVA 2XNSA 1RZUA 2DQKA 4HNHA 1FEZA 3WNBA 3OJ0A 3FNHA 2CNKA 1Z0KA 4Y42A 2B4AA 4W5NA 1ZA2A 2XYQA 4WCFB 2CMDA 3PG5A 1O97D 2QRJA 1RCFA 1VMAA 4GWKA 4JA2A 4XFDA 2DFLA 5D6OA 3WADA 1XNGA 4JXZA 3KVOA 4TKZA 3JAKA 5EESA 1IHDA 1T9DA 2G06A 2J08A 5E4FA 1PZMA 2XECA 1DP4A 2HFJA 3X3HA 2PSEA 4L5IA 5ELXA 1MHTA 1JLHA 5JPIA 1S96A 4HVCA 1U2GA 4LG1A 4R8VA 1S1CA 2PIDA 2RGGA 2V1XA 4KO1S 5IKOA 1R3UA 3LDGA 1M6NA 2KB0A 3L1IA 4NICA 3F6EX 1U5AA 2NXJA 3ENVA 2EBFX 1EGQA 3C4JA 4TYQA 5ALIA 1BKYA 3OT1A 3LXXA 4MB2A 5EFZA 3B6JA 5TQ0B 1UADA 1M7HA 2FOIA 2GZ1A 1FRVA 2XVYA 4EHHA 3DOCA 3NU1A 1JQKA 5CAEB 1CZHA 2QG4A 3J80A 3FTPA 5DTEA 3SK0A 4Q4JA 4FI3C 4DXAA 2K7ZA 2PS3A 4KEAA 4XJSA 5C4IA 1KAGA 1P2UA 3ODPA 3N2EA 3PC6A 3T3EA 4RTNA 4FC7A 1VYVA 1WX1A 4P4SA 5DHSA 5EN4A 4D3YA 4PG6A 5A6VA 1VKOA 5FFNA 5AHWA 4B6OA 2CSFA 1XELA 5E9QA 3LHSA 1FW6A 3O4FA 2QQ0A 1LW6E 5KJ6A 1ZJJA 5I8ZA 2LCVA 3D8SA 4TYMA 4JP2A 4IOKA 4QFMA 4UVDA 3UK6A 3IO5A 4ZV4A 1TT5A 1YKFA 1YA8A 2I80A 1DEHA 4NE7A 2ZM5A 1UKBA 1O08A 4ACBA 3I23A 1XDBA 2XDQA 3WIBA 4FFMA 4AMUA 2KE5A 5J4YA 3GP8A 2NAPA 2O59A 2J3IA 4HDNB 3GGOA 1E2EA 5H82A 3IAUA 4J3FA 1ORHA 2V65A 2Y1DA 4KR7A 3X0DA 2WD7A 1CUAA 3DEJA 3MLFA 2PWZA 4FIZA 2O5VA 4YRCA 2WSIA 5I47A 4KAAA 2Q7OE 2FUEA 4NK5A 1AY0A 3IMFA 4H15A 5JECA 3W3AD 1GITA 2FR1A 5AHRA 1XEXB