4ER0A

Crystal structure of human dot1l in complex with inhibitor fed1
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
336
structure length
315
Chain Sequence
b'KLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
publication title Catalytic site remodelling of the DOT1L methyltransferase by selective inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 99
structure length 315
sequence length 336
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4er0A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4er0A02
1NKVA 4OBWA 2ZIFA 1M0EA 1RJFA 2GAFA 1WY7A 4DCMA 3KHKA 2QYOA 4PINA 2OKCA 3MB5A 2CWWA 4GBED 5KQRA 4ER5A 5F2OA 3KR9A 4KIGA 2K4MA 2EFJA 2FPOA 4MTLA 4DA4A 1Z3CA 3GGDA 1NV8A 1NW6A 2H1RA 3KQYA 5FWDA 3MCZA 5E8RA 2YVLA 4LWOA 5K0LA 1XXLA 2I6GA 3IHTA 1QAMA 5EPEA 4GC5A 1BHJA 3A25A 3REOA 2NP7A 3RODA 4R8SA 3CJQA 1SKMA 2AVNA 3TLJA 5DSTA 5E9QA 4YUVA 1IXKA 5DRTA 2GB4A 4QDKA 4P7JA 5BP7A 3B5IA 1JSZA 3R0QA 3DULA 4POOA 5LQCA 1G38A 1YZ3A 2ZIEA 4HH4A 2BZGA 2XVAA 4EKIA 2XYQA 4AZTA 5C0OE 1VQ1A 4XUCA 1QAQA 2PBFA 1KYWA 3KPJA 1G6Q1 2AZTA 3EVGA 1RI3A 1TW2A 3B3JA 1BKYA 2PV0A 2QRVA 3BWMA 3GWZA 3O4FA 2OO3A 3QOXA 4QTTB 5DM0A 5EMKA 3TKYA 3UFBA 4CXMA 2GA9A 4PYQA 5E1BA 4UOEA 1NBIA 3P9NA 3KR0A 2OY0A 4PYIA 4DCGA 2OYRA 2AN4A 5E2BA 5B1SA 1F38A 2H00A 2JH8A 3LSTA 4BP3A 4PGHA 4B17A 5K0BA 3FPHA 5HIMA 3UJ6A 1ORHA 2EG5A 3FYCA 3MCTA 4YMGA 2B9EA 3EVAA 3EVZA 3LDUA 4KIFA 2UYOA 2PX5A 4DKJA 3UJ7A 1I4WA 2P7IA 2C7PA 3OFKA 2NXNA 5FA8A 1R8XA 3TMAA 5E9JA 4RTSA 1RI1A 2OXTA 5DM4A 4HRAA 1F3LA 3F4KA 3SSNA 3PLAE 3ELWA 3T7SA 1EQAA 4Y30A 4ER0A 1X19A 2ZFUA 1DUSA 3G89A 1R8YA 3SMQA 3MAGA 3ID6C 5DLYA 2O06A 1JTEA 3CVOA 4MQ4A 3HEMA 4GOOD 2Y1XA 4GQBA 4P7FA 2OB2A 5CM2Z 1HMYA 4YMHA 5EZQA 8MHTA 3EVBA 3NW9A 3Q87B 1TW3A 1KPIA 5CVUA 1SVUA 3OU6A 3LCCA 1O54A 3KQWA 1VP3A 5KVAA 1PRYA 4XUDA 2BR5A 4X61A 4E32A 1PJZA 2CMHA 3GRRA 3P2KA 4QTUB 5EEGA 3DOUA 3PB3A 4KRGA 2IH2A 3CCFA 3NWBA 4KWCA 4YUXA 4RTNA 4V0QA 3P9IA 3PVCA 5CVEA 4CKBA 4A6DA 5D1NA 5K0JA 3ELUA 2BR3A 4RYLA 1KPGA 5HILA 3G5LA 3QV2A 4YUWA 4KDRA 2H11A 1YUBA 1MJFA 2AN3A 2PT9A 3A4TA 3D2LA 4ATNA 5GIOE 2P3LA 3TM4A 2ZWVA 5BXYA 5K0CA 5LQNA 2YUIA 3HTXA 3T7TA 5EHIA 4PYNA 5ICCA 1RI4A 2Z6QA 3EVCA 1XDZA 2B2CA 3GXOA 3GO4A 4YUYA 5E1DA 1RJEA 3HCEA 2B78A 4RVFA 1NE2A 3KQOA 5DM2A 3UZUA 1UWVA 4GUAA 1T43A 4LG1A 4EVIA 5CCXA 2BM9A 2CKDA 4FR0A 3KQMA 5DM1A 3EVDA 1XCJA 2IBSA 2NXEA 3UJCA 2IBTA 2PGXA 3DXXA 3OPNA 4ER7A 4MWZA 5FHRA 1VL5A 2YQZA 5EHGA 1Q0TA 1D2GA 3HCBA 3I53A 3KKZA 3SM3A 1QAOA 2UZ4A 2QRVB 2YXDA 2GPYA 2VDUE 3HCDA 4M36A 1AQJA 4E2XA 5HIKA 2UYQA 2YXLA 1AV6A 1ZHFA 5T64A 4KVZA 2CL5A 5ICFA 4RVDA 2O0LA 2N47A 4CTJA 3EGIA 3KPVA 2XYVA 3M6UA 4RTQA 3NVMB 4C06A 3IV6A 4PCAA 3KQSA 3VC1A 3KU1A 3UA4A 5DXAA 1D2HA 2R3SA 2CMGA 3GRVA 5DX1A 2IP2A 3PX3A 1SQGA 3HA3A 3R3HA 3UJ8A 5EQJB 3TRKA 1NW7A 2AVDA 3BGDA 3CGGA 4CKEA 1L3IA 4FS8A 4G56A 3HVJA 3R24A 3GRUA 3E05A 2HNKA 3FRIA 2FHPA 3L8DA 4EK9A 4HGZA 5C9ZA 4E70A 2AOUA 2ZBQA 1VPTA 3B3GA 3NWEA 2PXCA 3HVHA 2PSSA 4DF3A 1BC5A 2OBFA 3JWIA 4HGYA 2VDWA 2Z6AA 2ONYA 2I62A 2NXJA 4RTPA 5ICGA 3G2PA 4YV2A 3DR5A 3KQPA 3DMGA 1R74A 3E23A 4IV0A 5ICEA 4EQZA 1JG4A 1ZQ9A 1AQIA 2P3OA 2PWPA 3G88A 5DTMA 3MTIA 3SXJA 4OX9Y 2PX2A 2NP6A 4RTJA 3GNLA 4F84A 4GEKA 1H1DA 4E33A 3WSTA 1JQEA 3LKDA 3MTEA 4FT4A 1VIDA 2FK7A 3C0KA 3FPGA 5K0NA 3TKAA 4DQ0A 1JG2A 3LKZA 1RJDA 2G70A 2ZWAA 4U7PB 4AZVA 4BLWA 2PXAA 5HIIA 5BW5A 5GM1A 3T7RA 5IKMA 2ZTHA 2G72A 5FQNA 3KQVA 4M38A 3TFWA 4AX8A 2PXXA 3B89A 2ADMA 4QPNA 3BZBA 2ZVJA 4HTFA 1VLMA 1KPHA 2G8NA 3DLIA 3AJDA 3KQQA 3PTAA 3GDHA 3V97A 3FZGA 5D1HA 2AR0A 3LGAA 5GWXA 4LECA 5K09A 5HEKA 2AOVA 4PONA 3T0IA 5K0FA 5LQKA 2OPBA 3C6KA 1DL5A 3LBFA 3JWGA 3S68A 2UYHA 4BY9E 5EVJA 1KP9A 4KW7A 3MGGA 1SQFA 1WXWA 3OFJA 4KDCA 1N7IA 4O29A 4LWPA 4MIKA 3DH0A 4X60A 2ORED 4ZTBA 1X1AA 4AZSA 5T6BA 4IV8A 5FCDA 3X0DA 5EG5A 3AWIA 2YXEA 2UYCA 3AXSA 2YTZA 2IGTA 4DMGA 4OA8A 3DLCA 3P2IA 5H02A 5C1IA 2OZVA 3MQ2A 4QPPA 4X63A 4C03A 4CKCA 4GOMD 3ORHA 5EMJA 2AOTA 2ERCA 3TQSA 5HIJA 3PS9A 5CCBA 2R6ZA 5EC8A 1EAMA 5FA5A 1JQDA 3LDFA 4RV9A 4QVGA 3CJRA 4X41A 3NDJA 2PLWA 1NW3A 1NT2A 5CUQA 2P8JA 3G7UA 3FYDA 5E8JA 3U81A 4E31A 4RSRA 2QE6A 5LQAA 5LR6A 3BGIA 1P1BA 4OQDA 4BP1A 2AOWA 3GRZA 5E2AA 4M37A 5BW4A 5CVDA 3B3FA 5CIYA 1YB2A 5DXJA 1IM8A 3OZSA 3FTCA 3FRHA 2AOUB 2G71A 3GRYA 4R8RA 3EEOA 3FUTA 4RTLA 5MHTA 2ONZA 5E1MA 3FTEA 2I7CA 3FTFA 3ELDA 5EIFA 4OBXA 3SGLA 1WXXA 1M6YA 4FP9A 5DX8A 1L3BA 1YFLA 3BKWA 3DXZA 5G02A 3R9XB 1IY9A 2AN5A 2G1PA 5HZMA 5FADA 2IDJA 3I64A 2I9KA 3M70A 3LECA 1ZGAA 4CWAA 4JXJA 3KPWA 2V74B 2FRXA 4L7VA 4PIMA 3G2QA 4ER3A 4PIPA 5CVJA 2C7OA 3NMUF 2P41A 2P7HA 1UIRA 3LDGA 2KW5A 3PX2A 3M6XA 4C4AA 2IH5A 3RW9A 3UJAA 2IFTA 5KQSA 1SG9A 2NXCA 3P71T 3SX0A 4RTKA 5FULA 4FT2A 4C07A 2XBMA 2OB1A 3DP7A 1FP2A 3OZRA 4PCLA 5K03A 5GOZA 5M5BA 3I58A 1YF3A 5FQOA 3EEYA 4H0NA 4HTFB 5EGSA 1KR5A 4BLVA 1X1DA 5KYGA 2JHAA 1RI2A 3FUUA 2B25A 5CD1A 4P7KA 2IPXA 4X1OA 3KR2A 4RX1A 3VYWA 5JR3A 3A27A 3M6WA 5K8VA 3DMFA 3R6TA 4AZWA 2ESRA 2NNWB 1I1NA 2ZSUA 3BWYA 4Z2YA 3GCZA 4NECA 3A26A 3THSA 2QM3A 3SR4A 5FHQA 3C6MA 3K0BA 3P9KA 3G8BA 2P40A 1P1CA 2EX4A 3ER9A 4XUEA 1INLA 1X1CA 4YV1A 3HP7A 4WXHA 5GIPE 3LCUA 2JG3A 3P9CA 1M6EX 1TPYA 2FYTA 2AOTB 4QDJA 2PT6A 2V7EA 2VZ9A 4GOLD 3C3PA 1BOOA 1WG8A 2DPMA 3EMBA 2IH4A 5GP1A 2ZBRA 1EJ0A 3HVKA 3KQTA 1B42A 3M6VA 5ERGB 3EPPA 3NDIA 1JR4A 5LQRA 1G8SA 5EEHA 3KPUA 4HC4A 3TM5A 5EKUA 3UJBA 4E2WA 2ZCJA 2P35A 2HV9A 5K05A 3FPFA 3I9FA 3OU2A 3E8SA 5F2NA 4U7TB 3OE5A 4RWZA 2E5WA 3FUXA 3I5UA 5DTQA 1V39A 3M4XA 4FGZA 4YUZA 4IWNA 5JUWA 1QZZA 2ZIGA 3CC8A 1G60A 1DCTA 5IH3A 2Q41A 5EIWA 4AUKA 3LL7A 3SVZA 1MHTA 5U4XA 2FCAA 2PY6A 3HA7A 2O07A 3AY0A 3C3YA 2PKWA 3EMDA 3G8AA 3HA5A 4PWYA 3BT7A 3ME5A 1N7JA 3IYLW 3MERA 4C05A 2BR4A 4RTRA 1VBFA 2HR1A 5GINE 4A6EA 3BXOA 3E7PA 2AS0A 5K0GA 3GU3A 2C7RA 3ELYA 1I9GA 3EGVA 3OE4A 5DTRA 1NW5A 2WA1A 3FPEA 2WK1A 2AOXA 5FWAA 3A7EA 4ER6A 1EJ6A 2P1DA 2WA2A 5E1OA 5EMMA 2DULA 1ZGJA 3UA3A 3O31A 4PYKA 3LX6A 3H2BA 1D2CA 3RIEA 1FJXA 4E2ZA 3A7DA 2XVMA 1NBHA 2ZBPA 2VP3A 2B3TA 5K01A 1YFJA 1XDSA 2FK8A 1KXZA 3BWCA 2JHPA 4OQEA 5DWQA 2A14A 3DUWA 2GH1A 1P91A 5E9WA 4CTKA 2C7QA 3CKKA 5DRYA 3DXYA 1VP9A 1L3CA 2JJQA 4PYMA 2ZW9A 4ISCA 2BH2A 3NVKI 5DPMA 1EIZA 7MHTA 1R18A 2VDVE 1SUSA 3HCFA 4IKPA 1JG1A 1XTPA 2HMYB 4R05A 4V0RA 4C04A 1Y8CA 4PNEA 3UWPA 4PYJA 2ZULA 5EOVA 1QANA 2ZLBA 1N2XA 3BKXA 4GC9A 2ZZKA 4PGGA 2PJDA 2HTEA 2PWYA 3FUVA 4QVKA 5EKXA 5K0EA 2BM8A 3IEIA 3M33A 4XCXA 3VSEA 5DT2A 4FZVA 1ORIA 4QQNA 3PFGA 3OU7A 5FTWA 3CJTA 3P97A 3BUSA 3LCVB 1SUIA 3K6RA 4RVGA 5CVVA 2O57A 2VS1A 2Z6UA 1KIAA 3LPMA 4HG2A 2IIPA 1JTFA 4QQKA 3EVFA 1WS6A 4F86A 3VC2A 3GJYA 5FUBA 4P58A 5HFJA 3MHTA 3EGEA 4R6XA 5F2KA 5LQUA 2GS9A 4Y2HA 2Y1WA 4E2YA 1O9GA 5T67A 1KHHA 4WVLA 1YZHA 2JH9A 5KS2A 10MHA 1FPQA 1X1BA 1U2ZA 2PVCA 3NJRA 2ZZMA 4GOND 2P3QA 1ZG3A 3AXTA 1Q0SA 4FSXA 3LHDA 1G8AA 4PYOA 4E30A 3ANXA 3G2OA 3BWBA 2IDKA 1JQ3A 4RVHA 1FP1D 1G55A 3NTVA 9MHTA 3BGVA 3FUWA 3KPYA 5EZSA 4P7GA 3SSOA 3HVIA 3PT9A 2QY6A 1AF7A 4FSDA 4BLUA 1WZNA 2F8LA 2JHCA 2YR0A 1KYZA 1L9KA 3KR1A 3QOWA 3OCJA 5P8WA 3TPZA 1R00A 1JG3A 2EJUA 1R6AA 3UJ9A 1P39A 5GM2A 3EVEA 4RTMA 4HSGA 3THRA 3JWJA 3V8VA 3B7PA 3Q7EA 1VE3A 4RTOA 3OZTA 4EKGA 1ZKDA 1XCLA 3G5TA 2EJTA 3P2EA 4DZRA 4OA5A 1XDUA 2XYRA 3UBTA 5LSAA 1JSXA 3G2MA 5EMLA 3ER8A 4PYLA 3DTNA 3ERCA 3CBGA 1QYRA 3SSMA 3FTDA 3LBYA 3PFHA 1EG2A 2GLUA 2LD4A 1HNNA 3UJDA 3DMHA 4YV0A 2ZZNA 1NW8A 1RI5A 4EMSA 3HCAA 1O9HA 1L1EA 3HNRA 4GF5A 1FBNA 3P8ZA 1OR8A 1XVAA 5DSXA 2PX4A 4K6MA 4MHTA 3HCCA 1UFKA 3TR6A 4DM3A 3HM2A 5HOQA 1XJ5A 4C08A 2O05A 2YX1A 4M7RA 3JWHA 5DX0A 3TOSA 2HWKA 1RJGA 4F85A 3O7WA 5LQJA 3GIWA 4R6WA 2PX8A 3FPJA 1NV9A 2NYUA
chains in the Genus database with same CATH superfamily
2PR7A 3TW4A 4EPRA 4A5OA 2OXEA 2GUWA 2YV5A 2Y4NA 5CVTA 5AIBA 3UHPA 1J70A 2AH5A 1KFBB 3DAYA 2R62A 5F78A 3IEXA 3PEWA 4Z9XA 2DFPA 5LDGA 4HBZA 2OZEA 6GPBA 5HZKA 2FPOA 3ZI7A 3BSYA 2XDWA 4LDNA 4DM7A 2XCSB 1NLFA 1ZK3A 3R5FA 2O38A 5LA6B 4MUKA 5DFAA 4JITA 4Q7QA 1B7GO 3KLPX 1WPQA 1ZIYA 4WSOA 1V3TA 1UZUA 2R1VB 2J87A 3OLWA 3RS7A 1EA7A 2ZUDA 1LA2A 3A25A 3D8BA 2ZYSA 3R9XA 3KZ3A 1N2ZA 3U26A 1WSDA 5IKOA 1Q3KA 2FZKA 5I9NA 1J1ZA 4C9BA 4E1BA 3JYOA 4AP6A 3ZJ4A 4BNIA 2RH5A 3W3ZB 3OWQA 4XX0A 3FMOB 1E3SA 2IOHA 3C41J 4M9CA 2PM8A 3J7TA 4XAQA 3PX7A 5I4IA 2P90A 2J9FA 4LHVA 1FX1A 4X4CA 5DBIA 1J9GA 4J7UA 1SIWA 1N4DA 3QU9A 3ZLJA 3EZYA 3ZHTA 1DG9A 3FVVA 5JIBA 3O4FA 1B1AA 2BGIA 2WJZB 2YHIB 1G8HA 4MUHA 4PEVA 1JIIA 5D6OA 5DOZA 4UPDA 3W5VA 4WY2A 4BWVA 1AMOA 4HQ0A 1S3IA 1NBIA 1SC4A 2OG2A 5CU7A 4ZEWA 3DDHA 4Z7OB 1DIRA 5K3SA 5JAQA 4E1AA 4X44A 4EPTA 4QUIA 2VZ8A 2QLMA 3KDAA 4PGHA 1Y3AA 2FR1A 3VZCA 4LI0A 3KXDA 2F67A 1U63A 3O2JA 4GHWA 4V02A 1E9VA 3IAS6 3Q98A 4YCNA 1A77A 1SUWA 3EHDA 1HRDA 1OI4A 2VSQA 1SOVA 2JLAA 4RS4A 5AUPB 2D6FA 2I54A 1M1YB 1PD1A 5KNCA 1GUBA 4ZI7F 1XZDA 4G86A 2VJYA 5A4JA 3V34A 3BWEA 5AM0A 4UMDA 4J1NA 3LRXA 4L72A 4MWCA 1ZM3A 4QNMA 1R8YA 1TM1E 3NYIA 4A1FA 3IOBA 4TMWA 4Q3OA 1P7PA 4U0KA 2B6HA 2D1FA 4MUMA 2QLFA 1M2EA 1VJ1A 3ZHQA 5IVPA 1E7SA 1VPVA 1HMYA 3WGLA 2PN1A 2P6UA 3QWIA 4LY3A 4DVGA 2VA9A 3TXXA 4F4UA 2PXHA 3D1LA 1THGA 3JQRA 2PS1A 1U28C 1H2WA 2X1VA 4OUDB 1PJZA 1C0LA 2NSHA 1ONSA 2CJWB 4NH0A 2OV1A 4WXYB 5G40A 4BGIA 1OPRA 3AESB 1OKKD 5KWIA 3K32A 3NOQA 1GTSA 4IJ6A 4V0QA 4QULA 4CFSA 5K0JA 1U7DA 4O8CA 4Q5IA 2Q07A 4QQ8A 4URWR 5HILA 3I4LA 2AN3A 3UG6A 2FPKA 1AO0A 1W44A 4AN0A 2EERA 3QVOA 2OZLB 3A4TA 4ZYZA 2BFFA 3DEAA 3QEBZ 1RZUA 4K9NA 5K0CA 4FMCB 2YUIA 1TUBB 4C2BA 1GGHA 1DGQA 1E1CA 3IE0A 3VO8A 1XDZA 5FTLA 3U4AA 3T35A 2W5UA 3H1EA 3QFIA 2XV1A 3HCEA 1SUPA 1BXKA 2JJMA 1VLVA 2YCLA 3KT3A 4G5GA 4WJZA 4EHNA 1VHQA 1KEKA 1EFKA 1GQFA 2R48A 1ISFA 2AX4A 4DADA 4TSRA 1JHRA 1G8PA 1S2NA 3TAHA 3UHAA 1UIMA 2HGZA 3SIWA 1XEFA 1N5RA 2E49A 3Q40A 2R1JL 1FSFA 4OB7A 4RFSB 2GHRA 2FFAA 3FY4A 3H5WA 4IQ4A 3FFTA 2GPNA 3DNFA 2IYFA 4B84A 5HYVA 3KJZA 2CFTA 1W85A 4JP8A 2W83A 4J2TA 1EYZA 4WZAB 3PDJA 2M6RA 4MQ6A 2MSKA 5JRJA 2ALJA 3EQ6A 5HIKA 4K9OA 2FWBA 5L3QA 3FNIA 1P7ZA 3N2IA 1GU1A 1XZLA 2ETXA 3PKJA 1U9JA 2BRUC 4G1FA 2R1ZA 4C3ZA 4Z5HA 2QAJA 2W22A 4JH0A 1E2QA 3DKKA 1XZAA 2RHMA 3ORQA 3GVCA 2KZ8A 4JGBA 4OM7A 4PHGA 4RD4A 3EGIA 1XD9A 3QU4A 4KFUA 3NVMB 2HREA 3CNEA 3GW8A 3IV6A 4NWIA 4PZCA 1Y4DE 2JFXA 3I2FA 4LXHA 3TZCA 5EJ6A 4U4AA 5LLDA 1AN9A 1MV5A 1UT8A 3I4CA 4ZALA 4HVAA 1ZPQA 4MUBA 4OREX 4QGSA 2F43B 4RS3A 3NCTA 1U4NA 5H4HA 1E0KA 4UEJA 5C1BA 1HQYE 2YJ4A 2JFHA 1OXUA 3B3GA 2VXBA 3BXGA 4DF3A 1KJIA 2VC2B 2Z2ZA 5BNWA 3Q2KA 4RZ2A 3TECE 1X7WA 2D0PB 2WJWA 3PT5A 3QKIA 3WB1A 4RNDB 3M81A 4BO8A 1Y9QA 1KZ6A 4JP2A 2V5AA 1I0ZA 8AT1A 3EGXA 1XTIA 4J0IA 3RADC 2HCSA 2F3RA 4UBIA 3H6GA 2Z2YA 1BA3A 4BO6A 5C32A 4OX9Y 1SURA 1GIAA 4YHHB 1K2VN 2YOFA 1KFCB 2QN7A 3QPDA 4MVJG 4IX1A 1OYOA 5FA6A 4F97A 1LZLA 2DH6A 3GPDG 2PZFA 3P19A 1J6UA 5L9AA 4JT9A 1RJDA 1SM4A 3RVLA 2XXAA 3PXUA 2J0EA 2GKSA 4NI5A 2W6PA 4D0GA 2MYNA 3T7RA 7ADHA 1EFUA 4OXIA 4JY7A 1FFGA 4M38A 4AX8A 1FRFS 3WIDA 4QPNA 2J31A 1SIUA 3EA0A 1DXYA 4HNTA 2FEOA 5KYYA 1XDDA 1MEEA 1AZTA 4RANA 5EIHA 1E1KA 3KQQA 3M7IA 2CE2X 2R7NA 3GBSA 3WWPA 5H80A 3SHQA 2GSWA 4CDGA 2RAUA 4FINA 1XTRA 2V6FA 1KDPA 4CQMB 1CRZA 1QKJA 3RE1A 2WM8A 1U8ZA 1N0WA 2G7MC 2EBHX 1C9EA 3AVQA 2QG4A 5B1DA 1VM6A 2ZM6B 1SQFA 3BK7A 3E3AA 4KQGA 4EGQA 3F4BA 5T6BA 4EABA 1E1DA 2CD9A 2NYVA 3V80A 2FWAA 2O8CA 4AMYA 1AXEA 5I7OA 2R5NA 1G8MA 4QO7A 1E79A 1LKZA 1GTG1 1W5FA 2ZRGA 3AXSA 3EFEA 4GZMA 4H3HB 5AJUA 5IARA 3RC1A 3RWMB 4AZ3A 2XGSA 4CKCA 1L1FA 1JIXA 1X7YA 1NVKA 3CNQS 4GOMD 4IJMA 4HO1X 3D64A 2I7XA 4ZREA 2NO9A 3TNYA 4DIFA 2PZBA 3F6PA 2WVAA 3E81A 4TT3D 4FMBB 1GD1O 4W5RA 1K7YA 2C2WA 2FW7A 4F56A 3W34A 2AD5A 3NDJA 3D43A 3Q8WA 4GZ6A 5FWXA 3ZY3A 3LQKA 3CEHA 5DU2A 3N1UA 4XGIA 1U2EA 4CL0A 4QGAA 5LR6A 1SJ9A 2CMFA 3CXRA 3BK2A 2HZ7A 5ALQA 2QVGA 2JIRA 4P54A 1UBUS 5CIYA 4NOMA 2PL1A 2AN9A 1G6KA 1YV9A 1YQGA 3LGSA 4O2BA 2CNOA 3H65A 5FR1A 1SGWA 2OSVA 4QATA 1Z7YA 4E14A 1T34A 4X62B 1ZI9A 2AJDA 3EIQA 5LU8A 1QFJA 3ZWXA 4EVQA 4Z51A 3BJMA 3OE7D 5DTJA 1NZFA 1SXQA 3CCBA 3LW7A 1UFVA 4F9EA 2B0JA 3KVVA 3UT5B 4BRUA 5H70A 3H0CA 4EGFA 4ZDJA 4OB4A 4UEQA 5EIBC 1B0NA 4J90A 5DBFA 4ETWA 1V6SA 3MIZA 3WYDA 2NX2A 2EIXA 3PLNA 2QHXA 2R97A 1C7EA 3BTSA 2WOOA 4RKQA 2OUIA 5CXXA 4CFZA 2OB1A 5CT5A 1FP2A 3NT5A 2J48A 3OZRA 4ZV7A 4BWGA 4EJ6A 5CDYA 3MOSA 5ALSA 4ZYYA 3VR2D 4H1UA 3W77A 2LYSA 4DMUB 3CA8A 1RRPA 2DFLA 3LOQA 3A4YA 3N58A 5IDVA 1MC1A 4M60A 5BR1A 4QREA 3BBLA 4YRLA 4AI6A 1UXHA 1G5IA 1TT5A 1CQTA 4B85A 4GG1A 3Q0TA 3R5HA 1U7WA 1YA8A 4Z0HO 5K8VA 1TU4A 4FDUA 1TJ5A 4YRTA 1XA0A 2NNWB 4CN9A 7AT1A 2XTJA 3H5NA 3RK4A 3SBXA 3WFIA 3DMRA 3MB8A 4ZI2A 2IXGA 1QF7A 2V54A 4C6TA 2QGNA 3GT0A 3QQ5A 3ZX5A 3T5AA 4DYHA 3P9KA 1II8A 1VKJA 2EP7A 2J6IA 3AM3A 1W49A 3ETHA 1LLQA 2EFDB 4DIEA 3AVVA 3HXOA 1GTMA 1MB9A 1YNOA 2ZATA 4Z54A 4CMEA 4XFJA 4BKOA 3ZNPA 2P9HA 3AHFA 4INPA 5FBZA 3JTEA 3U61B 4CEIA 4P4TA 4W8GA 1GA6A 3KT6A 4GWGA 4P53A 3BRSA 4K8RB 2IVBA 1BX3A 1HL7A 1J09A 3DVQX 4OU4A 2P6MA 3MUNA 1APBA 3OCCA 4UDYX 3TBHA 5HNKA 4L5AA 4U8GA 4B71A 5EEHA 3FYTA 5DYYA 1GSIA 4P22A 4DIOA 4ZVSA 2D5CA 2XNSA 3QVTA 4TXHA 4BO4A 1PG5A 4Q1CA 1ZFNA 4FFNA 1SBQA 3FBGA 3I5UA 1V71A 4CKYA 3PNYA 3RTBA 4FLEA 1DC4A 1C9MA 3OPYA 4WOKA 1X1QA 1LEHA 1GA4A 2AIRA 4Q00A 3OX3A 2C5HA 4L57A 1EZ1A 2BFOA 1XI2A 1G5TA 2O07A 3IOYA 2JAOA 1I94B 3C97A 3PD7A 3SEZA 3FPAA 2DVMA 1CQWA 3DAOA 1A9PA 4DM4A 1IL0A 2PRSA 5ECYA 2CXQA 2YFHA 2WV9A 3RKSA 1ZJZA 4MV6A 4KITB 4OJKA 2PUEA 4F9TA 3CZ5A 4NX2A 4Y9UA 1EE1A 3H2HA 3QA3E 1V5IA 1X8KA 2JI7A 2WWYA 2ZOSA 2Q8NA 2J33A 2Q2NA 3GIDA 2R96A 3O93A 3QF7A 3R0JA 4P4LA 1DHRA 1QIMA 3O3OB 4XXHA 5TS3A 1AS2A 3B7WA 4NAVA 2ZRFA 2GCOA 1NFFA 1V11A 2FEAA 2QNRA 1WTAA 3RBAA 2F7SA 4FYYA 5CEJA 4A2QA 4D8XA 5FT9A 3ZQ6A 3GN5A 2ZQYA 3W8DA 1RPZA 3Q0EA 2Q6LA 3BXEA 4R83A 1UDWA 4NJOA 1NERA 1U9ZA 1JU9A 3VH4A 2Q9UA 3FNGA 2LNMA 1US8A 1XWWA 4ND1A 1SUSA 3V46A 1VKZA 2HMYB 4Q12A 3ZD8A 3QV1A 4W5HA 1CUCA 4B7CA 3TQTA 1R0CA 2I0FA 1XZGA 2WJGA 3O1IC 1S3FA 5EOVA 4EL0A 3R1FA 2ZDHA 2ZZKA 4OHKA 2PXTA 3HP1A 1GPH1 3BCUA 3GCGA 3L8YA 1WAMA 4O6VA 2XMPA 4AUEA 4BZZA 1QR6A 1ZCZA 5BNTA 2XITA 3IEIA 1E9DA 2WWHA 1E1NA 1PNRA 3H11B 3OFSA 1K4MA 2DBZA 1U3CA 4GEGA 3JXDL 4MV4A 4TYPA 4DHWA 4M1WA 3OP9A 3PDCA 4MWTA 1PRVA 5FTWA 5LA6A 4B3IA 4GX0A 2VK8A 3A3NA 2O57A 3NMUF 3DHEA 5HKOA 2R1VA 1N2OA 2Z5VA 2FEPA 1RADA 3VFDA 1NVFA 3P96A 2JVIA 2GJKA 1P2GA 4MCHA 5DBGA 2OK7A 1FVFA 1O8CA 2NU7B 2ZJ3A 3ADOA 4JQYA 4TRJA 4M0DA 5HBGA 4FI3F 2F6RA 3I9LA 2ZZMA 1YJCA 3ONVA 3ZR4B 3A4VA 4L5YA 1A9OA 1NU8A 3QE3A 1A1SA 1E8MA 2BWJA 1C4WA 3PRKE 3QLUA 2ODPA 1Z06A 1CUSA 1JQ3A 5HGJA 2V3WA 3UK6A 4AMVA 3O75A 3BFJA 1T8RA 1P9NA 3HE3A 3IUSA 4GR9A 4FSDA 2YHIA 3PHHA 1SH7A 3TQRA 1ADYA 2YR0A 4B2PA 1YT5A 4JYAB 2Y1CA 1UUFA 2OCIA 3EC7A 3K09A 1R00A 1V7ZA 4IGAA 4PLHA 2AJLI 4HLDA 5HXAA 1PTKA 1RW4A 2E18A 3N0TA 4CR6A 1TYBE 4S1TA 3TOVA 5CG1A 4XVCA 4RTOA 1IUKA 3OZTA 2BHNA 4EKGA 3HBMA 3D6UA 4KHZA 2H4YA 2GFHA 4PRKA 1H23A 3SX2A 3EUSA 1E9EA 3U1VA 1U2SA 1MX9A 4FONA 3EXG1 5TX7A 4BC0A 1EVZA 3DZHA 1TJ4A 3ZHOA 1KE1A 4EATA 5JJKA 4P93A 2IOFK 3FBTA 4AL4A 1JFLA 4DBZA 3CZAA 1RHUA 4OJTA 1M1YA 4JJKA 3DDNA 2G82A 3VSCA 3V6MA 3EOAI 3PQ8A 3O1JC 4QDTA 4BUZA 2J67A 2PPXA 1FBNA 1OR8A 2H48A 4B7AA 1VLLA 3PKZA 4C4SA 4EFNA 1L4LA 2ADOA 1HA3A 3DVAB 5A5DA 5AHWA 3HYNA 1KJ9A 3R3WA 2VT2A 3IQGX 3ISJA 4R1UA 5KNCD 5KU1A 2WLTA 1XVVA 3ABZA 5KVSA 3GIWA 1GUDA 2PX8A 4K9MA 4PV7A 1J8YF 5FO1A 4KHPB 1L7QA 1O94C 4OBWA 2ZSKA 4FGJA 2IEDA 4DCMA 4ZYTA 2QYOA 3QI7A 2IF0A 1UMCB 2CJWA 5KYXB 1W2GA 4ER5A 2QGZA 3BM5A 3AESA 1M74A 3LT0A 4FYKA 4R1MA 1WH6A 4DNXA 4ZOEA 1ZI8A 2QD2A 4HBGA 4QWMA 1GL6A 4JZYA 4ZVTA 4MTLA 8ABPA 1K92A 3I2JA 4JX9A 4BRWA 4Z3KA 1NW6A 1MC5A 4M7WA 5J2UF 1VKOA 4PQGA 6YASA 3NEJA 1CUXA 1ZA2A 2X7XA 2OZLA 1X38A 2A86A 4J7AA 5KNDH 2HWYA 4L51A 4BMSA 4AQ7A 2KQUA 1SKMA 1P73A 1TUBA 2QRUA 2QQEA 4PLGA 4DPKA 1RU3A 1KI6A 1CQZA 3B1ZA 4YUVA 2XWQA 4F46A 1U7HA 5IT9A 2J5RA 4QAQA 4LZAA 2ISSD 2OC4A 3R0QA 1M6WA 1VHJA 3DULA 2G6TA 3ODPA 1PJ3A 2B94A 3WL6A 5J3JA 1X74A 1XCOA 5B7PA 3ETDA 3PUJA 3VNUA 3L4BC 3K0FB 1JXOA 2EF1A 4RFSA 1LF5A 4HN2A 4PRZA 2Q8PA 2XECA 2XNJA 3X44A 5DCLA 4TSFD 3ZWYA 4HLUC 3KD3A 2GZSA 4WZAA 1PP4A 3IKJA 1U7ZA 4ND3A 4S0XA 2R9VA 1A5TA 3EPHA 5J63A 1PGOA 2FUCA 2VF5X 2BJCA 2PKRA 4YRIA 2G5PA 5B1SA 5IM4A 1OFUX 3LSTA 1VI6A 4X1IB 4BPRA 3CLTC 5JDCA 2YJ3A 1ZWLA 1A8UA 4D0NA 1O4VA 1DTSA 3A0RB 1UAAA 1GCIA 2RGCA 2EG5A 4NBWA 5I7SA 1PGJA 4IIBA 4MXDA 5LDHA 4BY9E 1QH8B 2VTBB 3I2GA 3OPYI 2HIAA 3IQZA 4RTSA 3L6DA 3ZWVA 5FEMA 1JB1A 2F43A 2GN8A 3CX8A 4YALA 1I0LA 5E7QA 3OPXA 1XXHB 3DP9A 3LUCA 4DA8A 2R00A 5HUJA 4ZO8A 1QZXA 1E7WA 2Q5OA 2DQ4A 4QELA 4WZBE 1DC5A 1IBKB 4RPLA 5J1SB 3RC8A 4K6GA 3SMQA 1OZAA 2HM7A 3CFYA 3MAGA 5J4YA 3TMKA 1D4OA 2OBBA 2Y68A 5JYBA 3LWDA 1DOAA 1V47A 3F4LA 1M67A 2MYUA 3LUHA 5CM2Z 2Y1XA 3DNVB 1IBRA 2P4EA 2XUKA 3TD2A 3L7IA 1XRSB 5JADA 3OQ6A 1G6HA 2GK7A 3OU6A 5COBA 1U3VA 2XB8A 1H2YA 5CRIA 5CDHA 3PNLA 2AUNA 4JC4A 3HB4X 4X7BA 2VF4X 3GRRA 4HDSA 4ML3A 3UWMA 3ZCUA 4B3SB 3IXQA 1NPTO 2Q5JA 1PZXA 3AR9A 3LP6A 4M1KA 4BFXA 2IH5A 3ESBA 3Q6IA 4S12A 1KY2A 2GCEA 1UJBA 3MT0A 4JHLA 4X97A 1ONBA 4KH1A 1P5ZB 3CN9A 5AM4A 4CMJA 4UKDA 3TQFA 4OGGA 2ZIAA 2WTEA 3Q7PA 4DQUA 3TELA 2PT9A 3LFHA 2SKEA 3BJRA 1QRUA 4NFYA 2QN8A 1EINA 2EP8A 5A05A 3T7TA 4F0JA 3M6AA 3GXOA 2Y1DA 1JH9A 1YS6A 3NWOA 4BATA 1HF0A 5CK5A 2OBXA 1J90A 3DCIA 2RGUA 1I4OA 1OC2A 2MSCB 3DE4X 2BBWA 3P0IA 5JLJA 5TC4A 3GFPA 3WLFA 1Z08A 3IP9A 2CKDA 3N8GA 3KQMA 1M8KA 4FR0A 3EVDA 4WIAA 5EFZA 3ZHCA 2O20A 3SQXA 2IBTA 4OHWA 3JS5A 2FFJA 3LY8A 1VL5A 4K8OA 1E2JA 1A7JA 1GQ2A 5LMNB 1W36B 1ZMOA 4DCVA 2RONA 1KMQA 1PJ8A 3G9QA 4CIVA 4HNRA 2X9GA 4KPGA 4O4JF 3U31A 4YQEA 5CMLA 1VYUA 3GY0A 5SYNA 1XTQA 2QZ9A 4G8DA 2CL5A 1Q7TA 3EUAA 1E79D 1M2JA 4X7RA 3A9CA 1SUEA 2VPZA 2IVGA 3V8RA 4RF5A 1QRDA 1G8YA 3M6UA 3ND6A 2PU7A 3L8HA 1PGNA 2FH5B 4W9RA 2OHVA 1YB4A 5AKHA 2CHGA 3T06B 3CLSC 2BHLA 2H59A 2D1QA 2M2IA 3I0ZA 4E4YA 2C2ZA 4IXMA 1KQGA 1IN1A 1L3IA 3FWKA 4FS8A 4HLQB 4DAOA 2DT8A 2IVZA 3OF3A 3GRUA 2EEPA 2D1YA 1A04A 2EFYA 1XMVA 2I03A 3I2KA 3LA8A 5T3UA 3S99A 2QKYA 3HJGA 2PXCA 3WMWA 1E8DA 5M29A 2IZ0A 2E9SA 1CULC 5FL7D 5IW8A 1YZVA 1TA0A 3D4BA 3KEMA 4K0RA 4QFCA 1IBSA 1OXTA 3C7TA 4ZT7A 5ILGA 1V8BA 2HQRA 4CTOA 1UKEA 1EFPB 1EFRD 1RYEA 3MD9A 5EQFA 2XXQA 2C4MA 2QJWA 2L0XA 2V8OA 1VHDA 3A70A 4Q03A 4QDOA 1AS0A 2I29A 5DNAA 2C9DA 4BLTA 2PWPA 2IU7A 4DCCA 5DTMA 3MTIA 1E6LA 1JYFA 2C1XA 1RABA 2GMWA 3Q72A 5BV1A 1KZ4A 1T8UA 2MMGA 3VKGA 4PPFA 2ZSAA 2FK7A 3I01M 3DE3X 1RXIA 3HWRA 3PPWA 2ID9A 2Q2OA 2GEFA 3T5CA 4KO3S 4DLZA 5KNDA 1G8KA 1TD9A 2XYGA 4JYPA 1XOIA 4KV7A 5H9VA 2ZIVB 2RHGB 2IYWA 3NT4A 4XR9A 2X0JA 1NXXA 3K0CC 4QU9A 2PXXA 1GYRA 2Y3IA 1REQB 5KAMA 2OZKA 2ZJZA 4DR4B 1OLXB 4HZUB 1ISSA 2O5EA 5ECGC 1N9KA 2IHZA 5JCZA 1N6IA 1LS6A 3TRBA 5DMXA 1VRWA 2YWDA 4YDSA 1NX6A 4EEKA 1QOPB 4RPKA 5ALFA 4FGSA 4GSKA 4C1BA 5EVJA 3D7LA 4NNJA 3V7NA 4KDCA 2C9YA 1N7IA 1SPBS 3DF9A 5FPKA 2VP5A 4EO9A 4CLOB 4D3YA 2X2OA 1RAFA 1FMCA 4G07A 1GRRA 4YAOA 3OWHA 3QI2A 3TOXA 4I36A 4M8SA 4N8EA 1SG6A 4OA8A 1ES9A 3VPXA 1HF3A 5KYTA 1R0XA 4C03A 4YGYA 2B98A 2PCJA 4KAXA 2QW1A 1ZESA 1AHHA 2FQYA 3JYNA 4IQFA 3U9LA 3DZCA 4QOGA 4YJGB 3RVJA 1G5FA 1VMDA 5KWEA 3UATA 3FTQA 3GV0A 5IUKC 4IS3A 4ZT4A 2GCPA 1GAEO 2R5WA 1NW3A 1K3TA 2HDOA 2REOA 2IPMA 3GA7A 3DM9B 5CUQA 3W7VA 1X1EA 4HWOA 4B75A 3QE9Y 3TSCA 2FDCA 4FJ1A 4X7MA 3A4NA 3VI3B 1Z5NA 4NEQA 2PKCA 1KMIY 3WQSB 2FLKA 2OCLA 3AT1A 3B1YA 2PQ0A 1I32A 1V8DA 1LH0A 4TLAA 3S8QA 1K8RA 1LB1B 2HH9A 4QRHA 1E7QA 2K6GA 1R0YA 3NOOA 1O8BA 1WCV1 2WAYA 3CR8A 3U17A 5HF5A 1GPJA 4K03A 2IITA 3OX2A 3W5IA 3VR1A 2P2NA 5F4ZA 4RADA 1NRIA 3KFVA 1QQBA 4KWEA 5JJCA 2SBTA 1O57A 1QG2A 4M86A 4X85A 2PUJA 4DWJA 2Y1GA 3OQBA 1DKOA 2C3UA 4HGQA 4C3UA 2RI0A 3DG9A 2ASVA 3A6DA 1CY4A 3ON5A 1BJKA 1MH9A 4HF7A 2OYCA 1BDHA 4JAVC 2VCYA 3CYFA 5T8KA 3BRCA 5C52B 1GGVA 1P0CA 3D6MA 3JYPA 1DBVO 1FCJA 2N1BA 5AW2A 1AGYA 3R5XA 3OTQA 4B4UA 1IXRC 1R0LA 3GLGE 3KAQA 1ABEA 3FYHA 5KKAA 2D0IA 4I5GA 1M2WA 1TVKB 1BGWA 1LQUA 1RHJA 1DKQA 3P9RA 4GM1A 4NFSA 2ZS7A 3KZOA 4FMDB 2F62A 4JC5A 1UC9A 2FWJA 3KYDB 1WKBA 5DLDA 3FHTA 2WQZA 1UBLS 1RI2A 4W5NA 5L4NA 3OOEA 1ENPA 4F06A 3QSYA 1LPPA 1JI0A 2L19A 1H2AS 3R0XA 4TUYB 3EQ2A 2HZBA 3Q11A 1I1NA 3RLFA 2CUZA 3OH8A 3RDPA 1OLUB 4NECA 5IVKA 5IDQA 3MWLA 3C6MA 1HE5A 2JIBA 3K0BA 4J07A 4KMMA 1UXOA 2VG8A 3ICPA 2P40A 3H11A 3PDUA 3ZWBA 1SBZA 4KVFA 4D3FA 4HWTA 1FP7A 1UXDA 4GD3Q 3DONA 2QZSA 2QVYX 1DCFA 4Q9DA 3ZY6A 3LC7O 3D0RA 1B6TA 3Q8LA 3MXTA 2QQGA 1KWGA 4GLBA 2G3YA 3TEPA 1L8AA 2FZWA 3VYUB 1XD8A 1Y7LA 4DIBA 5EJIA 3CF4A 4QM7A 1RM4A 3C4QA 5CW2A 4LX0A 1Z0FA 2NU7A 4LJYA 1JHXA 3H87A 3O8LA 3AV0B 4BCCA 2PGJA 4TWJA 3FX2A 2WG0A 4UHCA 2CSFA 5K05A 3O73A 3I9FA 2V45A 5J4LA 1R4NB 1ZR4A 1LUAA 5K0TA 1PLJA 2F17A 3AW9A 4UVIA 1E2PA 3OLCX 4YI3A 3UAZA 2ZJ6A 1NKSA 3P52A 1K7XB 2FPXA 3U4DA 3UKJA 7MDHA 1MHTA 821PA 4N48A 3ZXSA 5AKZA 5F76A 1L7PA 1J1IA 1ZM9A 4LW8A 2Z5FA 4P0TA 1WW8A 4IOLA 1C8BA 1YKSA 4JLAA 1U0HC 1Z82A 2JGJA 4JS0A 4URYR 4YJ2B 4HUTA 5CXUA 1UDXA 2X14A 4Q1FA 1ZBDA 3FWNA 2EKZA 2XNCA 4NEHB 1ENYA 3UV6A 4EWLA 1AKVA 2IL1A 5LQMA 4MMYB 1C1XA 2JGIA 3KSDO 1YAHA 3UJPA 5D3QA 3CISA 3SG0A 4EF6A 3AR4A 3OZAA 3A7EA 3I1IA 1EJ6A 1HE4A 2GNAA 4R8KA 2GM4A 3RASA 4MV7A 4G0YA 3KXIA 3AB8A 4YDRA 5LA6F 1Z47A 1M8FA 3VR4H 2W43A 3W1EA 4CLHA 4GMXA 5AW1A 1UOPA 3MJFA 5IRCD 3PQ3A 2PXEA 1D0VA 4XWAA 2GVDC 3DEIA 1KARA 1OYWA 4OHPA 3B48A 2VF7A 2W9XA 3DUWA 5JG7A 3RIMA 2GH1A 2DECA 1EWYA 4GGOA 1MA3A 3G02A 3DXYA 2FPLA 3JQ7B 2BEJA 4JX8A 4RPCA 4UREA 3T7JA 2CSUA 1DXQA 1I4LD 2NQTA 1JSCA 4G4SP 3KSAC 2NYRA 5HIAA 3B7GA 3CWZA 1ZNYA 3G68A 4LJ9A 1UZAA 4L1KA 2CUKA 3WLEA 3BD1A 3OSUA 1X70A 3WLKX 4P3OA 3L1IA 3AQIA 2P0EA 2QVZX 1J39A 4WFKA 1UMCA 4YAWA 3EZ2A 5KYXA 2BGWA 3AUUA 3QLVC 1ICEA 3QG5A 2CL6X 5AKJA 1G3QA 2WF9A 1UC5B 4ACBA 2QTRA 3DHYA 4FFPA 3TLMA 4JI8B 4J7CA 4DCPA 2EJWA 3GN1A 5JNSA 4EG3A 4IDGA 1UQRA 3D5QA 2BBSA 1Q7EA 3E2MA 3ENVA 4H1WA 1OXVA 3ZGZA 2QQ5A 4V2UA 4Z8XA 2XADA 2KPJA 1A9SA 1VJCA 2M9MA 2Z4RA 1QGAA 2N0SA 1QM5A 3JYHA 3PRHA 4F6RB 3H2SA 2ZI6A 3PR3A 4WVLA 4LAFA 1ZCAA 3W5UA 4ITUA 3AF3A 3CF4G 4QASA 5FO0A 4IIXA 2BEWB 4X5OA 1FB5A 1JR3E 2FG6C 4W63A 1TQ8A 1Q77A 3K0FA 2AZMA 1A76A 3S6JA 4ND6A 3GMIA 4IZ6A 3BGVA 3FUWA 3K6KA 4RA6B 3S29A 3H5IA 3IILA 3TINA 4D0LB 1AF7A 1OWNA 4PCUA 4ZQBA 1IQRA 2O8FB 2P69A 4C0LA 2VRNA 1ESDA 3JYQA 4PGFA 1JG3A 1MNQA 4C1NA 2CFCA 2ICAA 2KB0A 3JWJA 5JROA 3J81A 3NOXA 4D9KA 1J8DA 1KDOA 3NM5A 2VHXA 4KPYA 1L4UA 2E1PA 1E1RD 3H97A 5ILOA 4ENRA 1ACJA 1MQAA 1LNSA 2ODTX 5F1YA 4OHOA 1CJMA 1XDUA 2Y66A 2QL5A 4UBNA 3GLKA 2BKXA 4GZLA 4MEJA 1WM1A 3RTDA 3PSHA 4YRNA 5IG2A 1XXHA 2ZZNA 3HCAA 4BASA 4RK5A 4UHHA 4YR9A 1P77A 1DAFA 2QMEA 1RQPA 1W34A 3G0BA 1DIOB 4BFLA 2FPGA 2AFRA 5JPIA 4DM3A 3RYFB 3SLKA 5HM8A 4XYLA 3H42B 2XKAA 2XR1A 1WXHA 4B33A 1ZRNA 5D3KA 1EGQA 3VKWA 3CXUA 4I9UA 2PL9A 1Z88A 1XNRB 1UC8A 2ZVPX 4JQOA 4OQFA 5BSUA 2F3UA 1MCZA 2CVFA 3K9LA 2ENUA 3OEED 1A8QA 3T12A 2NYUA 1SHZA 1GYPA 2C2MA 5MFPA 4WJLA 2J0QA 1RJFA 1ADFA 1PGPA 4INOA 5LUBA 2Y1FA 4XGRA 4BX9A 1HT3A 2MQKA 2VHVA 1L5KA 2WWTA 3LIIA 1FEZA 3DBVO 3DGFC 1Z3CA 3CW2A 3UMRA 3O8DA 4O1MA 3DEJA 1JDSA 4WKGA 3O3MB 1T9KA 4PZUA 4A0RA 5IM4F 2O0MA 4ZOAA 1TM7E 1DJNA 1BQ3A 1N2IA 4JJEA 3G5UA 1A71A 5BP7A 3DV2A 2EF0A 4JT8A 5EVCA 5JOQA 1YRYE 1PNVA 3EDQA 2C78A 3A14A 3G8YA 3RBVA 4ZCRA 1VFNA 1HRKA 1YZ3A 3MVEA 5ALOA 3U7RA 1JFFB 4FZRA 4RJIA 4C0BA 3RRBA 5ES3A 1E9AA 1G6Q1 3MAAC 1N0HA 1B2RA 4ZQEA 3SCZA 2QX4A 4CQMD 5EJEA 2CEAA 1L8QA 5K6AC 5AFSA 3LQXA 3C1AA 3FIUA 4F3TA 3H3XA 4PR0A 5FPPA 2VIIA 3GWZA 1W52X 1DFIA 3TKYA 1RT9A 3I9KA 2BGJA 1ZD9A 1ZWKA 2GOYA 3C5CA 3NBFA 4JN6B 1BYUA 3OCZA 4L9AA 5JRDS 4WK4B 4B8WA 3F3MA 2PIDA 5HS4A 1ZISA 3LO8A 4IW3B 1T1JA 1QCYA 2C3YA 5H59A 2WT4A 3MGAA 3UTCA 1KJYA 4LKRA 4G67A 1SUFA 1RLJA 2A4KA 4HUQB 1XQYA 3L7DA 4I4NA 4JLPA 5BV2P 3FYCA 1ONNA 4MWSA 4DUYB 1MEOA 3FETA 4IM7A 1ZSNA 2XWJI 2VPYA 4JBWA 1HETA 4L27A 3UJ7A 1XUOA 1CNFA 3OFKA 3RO7A 3JARB 5E9JA 2G76A 1TZMA 2O3TA 1P60A 3H1FA 1F3LA 5FP0A 3G0OA 2Z4SA 4JODA 3PTZA 4IVZA 2GSDA 3OZXA 3HKDB 5TMDA 4BFZA 1TNDA 3UXYA 4LJ7A 2ZE7A 2RC6A 4N3NA 4LQ4A 4EEXA 5IFLA 3FFBA 1EFPA 2BNOA 2GCGA 1DKRA 4IF6A 1JXQA 1PSZA 1WF3A 3H13A 5I51A 2FEMA 1K0UA 2QMUA 4GYJA 2B92A 2AD1A 2CDNA 2OP0A 3JRXA 2QL6A 1EGAA 5ITWA 1KKLA 4N41A 5CD9A 3IQXA 5K8JB 1ZK4A 2JFBA 3CCFA 1PGQA 1ADCA 3PUXA 4UMEA 5SYMA 3L6BA 4MJXA 2CMDA 3GN2A 2JANA 4Y1RB 5CVEA 4GMKA 5D1NA 5EUMA 5EWJB 3UGQA 4ENPA 4YCMA 4KTTE 2L8NA 3GFQA 2DQZA 3IBTA 4R41A 2HJ9A 4KDRA 4W1SA 1REQA 1J2YA 3NV9A 1JPJA 1WHTB 1M66A 2X4IA 1OLXA 1UMBB 4HN9A 3WLMA 5I3ZA 5KNDD 4DA6A 2P3LA 3ASUA 2RFLA 5LQNA 1RRGA 2EX0A 1BMFA 1LDNA 2FUKA 2IXDA 4XD7A 2AXEA 2ATEA 2WIUB 4Q3KA 2H0RA 3WISA 5T3YA 3EVCA 3I6YA 5DKFA 4OYRA 1G4UR 4Q6BA 5C5CA 3AKZA 4GVLA 1QR2A 5I9MA 1Z2NX 4GUAA 4N39A 1UJ4A 4CBVA 3MWYW 2AA3A 2J3QA 2AYYA 1DQRA 4K6CA 5LP6B 1SG0A 3CUTA 1KO8A 3K70B 3JXBC 1TC1A 4OG2A 4KQXA 5DDIP 2A9QA 3T15A 3SYTA 2IPAB 4CLOA 1R50A 1WIZA 3TYXA 3T3OA 1HSOA 2DTXA 1L5SA 4Y7DA 1SCJA 4EHBA 3U60B 3INGA 4IKOA 1QE0A 1E58A 1UWLA 5DCUA 2HN9A 1FW6A 1ND5A 1QUFA 2NN3C 4YEDA 1O08A 1E0SA 1ZHFA 1ZCFA 2PXLA 3EY9A 4KVZA 5LYJA 3QF4A 4PZZA 4YJGA 5ICFA 2QJFA 1NFQA 2PX6A 1NUTA 2J8ZA 4A92A 3OAAA 4KQKA 4BCBA 4DDKA 3MWFA 4LGCA 2O2XA 1O94A 5DE3A 3RT1A 2WF8A 4RGBA 3SOPA 4EDFA 4BX3A 2CMGA 1MZVA 5G3YA 3NC4A 4GNRA 4FR5A 1QWOA 3CGGA 4OOEA 3RSFA 5G0SA 4H4DA 4ETNA 1H8EA 1K89A 2IHVA 3G7NA 4Q15A 5DIZA 3OZBA 3UAOA 4WKNA 3A9YA 4BNKA 5JAOA 1NF9A 2H07A 3Q3IA 1FY2A 2ZSFA 1ZNQO 4GPTA 4II7A 2DWPA 4YNBA 3S5JA 2CF6A 4BEJA 1Q11A 3WE7A 4HGYA 4HWGA 3B53X 3L1JA 5GZ6A 3ZZ0A 3JRWA 5LB4A 5IU6A 1QU2A 1E2GA 1SOUA 4TTSA 3G2PA 1U80A 3S2ZA 3DYBA 4YFVA 1KP2A 2MINB 1PJSA 4GI5A 1WNFA 4WZBA 4UNQA 3L7OA 2E87A 4YRFA 4NBTA 5KTTA 4UMVA 3QUSA 4F4HA 1G21B 4I8XA 1ESCA 5IHXA 3CVVA 3N8KA 3EAGA 1HDZA 3CNOA 1YFJA 3ZGXA 5BWOA 1JG2A 4IVNA 3GJ5A 2ETVA 1YDFA 2WSMA 2PXAA 5AXAA 1JDNA 5BW5A 2WJYA 4LHYA 4Y1EA 4F92B 4BTLA 4HLUA 4P6VF 5IKMA 1WB9A 1OREA 4A8JA 2RK4A 3DLHA 4WK2B 3P94A 2UUOA 1G0OA 1TVKA 1WULS 4MYDA 5F7OA 5CFRA 1Y9EA 2PCLA 4TQAA 4DPLA 5ES4B 1ZJ6A 3I92A 1XWRA 1FFHA 1U0LA 4AY5A 3GEDA 3V97A 2WPNA 3QVLA 5DHQA 1P33A 2RHLA 4N0DA 2ZYHA 1Z4JA 4OXKA 3V42A 1DL5A 1F0KA 1Q3HA 3FD8A 2ROQA 4TUYA 5H3CA 4D9GA 4IGFA 4DXDA 1WXWA 4I2NA 1E96A 3OY7A 2CEKA 2JGNA 1E3LA 4Z4CA 1M1XB 1X1AA 1OLUA 3MRSA 3QOYA 2OHOA 1BD3A 1DBRA 2B2NA 2X5JO 1QPBA 3AJRA 4DKJA 2NSDA 1I2DA 1D3AA 3WYBA 2ZT8A 4YJDA 4R8VA 5EJGA 3K9NA 5J43A 3GQBB 4GMFA 4XI9A 5H81A 4EHHA 3JZFA 1BW9B 2OZVA 4X63A 3KQUA 3CNLA 3R77A 3N39C 1ODCA 5HF9A 3QFRA 1PFUA 3DHNA 5CCBA 2WE8A 4I08A 4JJIA 3CG0A 2AQKA 2V6MA 5GONF 1Z2CA 1N5MA 5CDSA 2MSDB 1WPGA 1LBEA 1WXGA 1H4TA 2QX8A 3IS3A 2P8JA 1N57A 3F6YA 3G7UA 1AUQA 4YFYA 5BWNA 4RSRA 3RKUA 3G3EA 1VC2A 1Z2AA 1ZK1A 2G9NA 4BP1A 2XCJA 5CVDA 1R4NA 1CNEA 1A5SB 2F3QA 2PH3A 3M4JA 1I7DA 5L8VA 3R09A 3NR2A 4II3A 5AXCA 1H94A 4BNHA 1EX9A 3AUXA 3O8CA 2W8BA 4KLRA 2ZTUA 4QUGA 1MQ9A 4G97A 3T7KA 4GYYA 2CV1A 4IFEA 4F5ZA 1M7HA 2QTMA 5B37A 1VG1A 5LJLA 5EIFA 1N36B 4RLQA 4Z0PA 3OF2A 9LDBA 3LK7A 1WXXA 1M6YA 2A9OA 1LY1A 4YJ2A 2VRBA 3QEAZ 2PUHA 2AWOA 3KE8A 3OJEA 1IY9A 2QIPA 2VT3A 1AZWA 1BTOA 1Z13A 3GELA 4B9EA 3AB3A 2EJVA 2LCVA 1LCCA 2I6SA 4RFLA 1A1VA 4YCJA 4B3DA 4EKDA 3O47A 1GRQA 4DMFA 5K4AA 4NS4A 1W8DA 3RW9A 1HYGA 4U9IS 4M46A 2TMYA 2BFWA 3UCXA 3M5PA 4ZO7A 5A06A 4JK3A 4RK0A 4XGQA 4O8ZA 2IEAA 3N53A 5I7VA 4ZPXA 1FL9A 1RSZA 1AXRA 5FQOA 1NP6A 3SJCA 2D7JA 4JSRA 4QODA 2PXUA 5MF6A 1RMQA 2JHAA 3FUCA 3JQ7A 1M34B 1DTWB 1JKFA 4P7KA 1L5VA 2ECOA 3B85A 4IDDA 4TQGA 5CDTA 5JJLA 2GAJA 3N8HA 4WECA 4ZMBA 2H65A 4C6HA 3FGZA 4M9UA 1SCDA 1T3GA 4H1HA 4JROA 1O7JA 2COKA 3MJVA 5ALMA 1Z25A 2A7XA 1TC2A 1ISGA 1GTVA 4M9XA 3S70A 2FQ1A 3H5OA 3WP0A 5C4IA 2KEJA 2C29D 3NV7A 4P82A 4WACA 5TDHA 3RS5A 4F1WA 5JH7F 1H3NA 1XU9A 2RBGA 2XE7A 4RNCA 2HRRA 2I6QA 2GRMA 3SBEA 5ARBA 3WYFA 1O87A 2D7DA 2LVBA 1BKSB 2FW9A 4OK5A 4UEOA 2IWRA 3QLTA 4FEAA 1ZJ4A 3JPWA 1JZTA 1PFYA 1PJBA 3I1YA 1LX6A 1F51E 1XNJA 5GOTA 3VYRB 2FAXA 2A5LA 4TL8A 4X6YA 2IYAA 1U0EA 3FZQA 3I01A 4C7XA 4EMTA 1AB6A 3CPEA 1QTNA 1IWBB 3C3EA 4QTXA 4WCFC 2PZEA 1XEAA 4FNAA 1PL6A 1C0IA 2Z57A 3MJTA 3Q9UA 1JAXA 2FN4A 1C3OB 4KQCA 4QFMA 1CNMA 4TQUS 1MOQA 1NOIA 1G2IA 2FZVA 4KQWA 2RJ3A 5FOQA 4NPCA 3QMMA 3G23A 2GAAA 5DTQA 3A1TA 1U8TA 3OESA 3PRYA 4KXMA 5H82A 3RS0A 5KTRA 2XSDC 1J8FA 1YK0A 4UUBA 4ZA2A 5GTDA 1GZHB 5AJHA 4FYVA 4RA6A 3VYSB 3K0CA 1QHFA 3GRCA 4L5BA 3ZKCA 5ALTA 1L0BA 3PD1A 4OP1A 5COQA 3C3YA 4I3GA 1I0IA 2O8FA 1LXCA 5MDHA 4UHEA 5A1JA 1Z63A 1A4RA 3AUKA 2GNOA 3UWOA 3B60A 3IYLW 1RYZA 4C05A 3F8WA 1O77A 1VBFA 1PT7A 1XK7A 1RRVA 1QQ7A 3ONEA 5LZ5A 3RC7A 5JASA 2LCFA 3LBIA 1KDYA 3OWOA 3OP4A 2CLLB 3VU9B 3IOEA 4UFPA 4E0BA 2RGAA 3D6JA 5A0VA 3IPAA 3ZCQA 4BO3A 5EZ5A 4YLGA 3IVMA 1R9MA 4TMZA 3MCAA 1XCPA 3NP7A 4RIGA 5SV2A 3G85A 2EZTA 2V1XA 4EHFA 1ZUWA 3TB6A 2HY7A 1VB5A 2RHJA 4Z5XA 2HCFA 4CIAA 2JCBA 5KQRA 2YBEA 3MBIA 3Q85A 3RYFA 3KIPA 4KR6A 1DV2A 1ZOSA 3NTRA 4PYMA 4R2KA 1PBNA 1T9CA 2DF8A 4GPIB 1LW6E 3W5HA 4YRZA 3SC2B 3PQDA 5HG0A 3GLGA 2GO1A 1JG1A 2Y27A 4BJ6A 2VHEA 2QIOA 1Y8CA 2IKSA 5TY0A 4RPIA 3DDSA 1DB3A 4LXQA 1DW9A 1WKCA 4BQSA 1N2XA 4TTVA 2CT8A 4BU0A 2KYRA 5FI5A 3OPMA 3TIFA 1GAJA 4H4EA 5K3EA 1LSSA 1TGVA 2J0SA 1IVNA 3FDJA 1OSNA 5DT2A 2GF2A 3HY6A 4Q66C 4Z7NB 1NR1A 1LJUA 2GI4A 4P32A 3OHMA 2WY2D 3C3CA 1Z39A 4BO2A 4OMUA 621PA 4S1WA 4Z1OA 1DAKA 2XHZA 4BO9A 2PX0A 5DT9A 3ZOZA 4LSMA 5IAGA 4H7PA 3L05A 5AVRA 1CYEA 1KAQA 5F2KA 1EWKA 1Z2PX 3RC2A 4I6UA 1E9FA 3TIVA 1NBWB 1OZFA 4B4OA 3K5WA 1RYYA 4O4LA 2B36A 1JA9A 4XQ9A 4WESB 4WE3A 1P29A 2VQDA 3C16C 4HDAA 1B00A 1VXRA 3H04A 4B40A 4C7MA 3EXG2 4MUNA 5E95A 5KPJA 4ZAVA 1JFFA 2GAOA 1G8AA 4UJ3A 4Z99A 3ICEA 2CUTA 2DUMA 3G2OA 2ZSHA 3IXLA 3JZDA 5K51A 2IYZA 4G65A 2BONA 4LMBA 1H2XA 8ADHA 4OU5A 9MHTA 5EZSA 4P7GA 4LV5B 3RV4A 1KETA 4KQHA 4QLOA 4UDNA 1PZFA 3COJA 2PRYA 3RHFA 5C2JB 5IASA 1Y6FA 4AJ4A 3CE6A 2VK1A 1PHRA 3ND7A 1P39A 1VJTA 3WGKA 3QVJA 3ZK8A 4XWOA 4CEJB 1Z9BA 3P4UA 4PN7A 1P0FA 1W36D 1FQOA 1KI9A 2CL7X 2GZ1A 4LJSA 1XCLA 1MGOA 1I51A 2EJTA 3MGKA 2SHKA 4HUQA 4JFAA 1U81A 3GJ4A 4Q3NA 4XQ0A 3VPAA 4CDNA 5LSAA 3GJQA 4QRDA 2DCMA 2VJQA 4PYLA 3CZ4A 6Q21A 1RCUA 1E8NA 5JLAA 3VR4D 4BVLA 4D43A 1UJ2A 4YV0A 3JARA 4OAQA 1Y9AA 4EB8A 3CUEF 1DXHA 1P1IA 1NXPA 4EY5A 3G0HA 2BOVA 2PX4A 3FYMA 4F1JA 2PUFA 3I8SA 1E6CA 1Y82A 2IHKA 2IUSA 3HKDA 3FLBA 2P6NA 3EGOA 3MW8A 4K7JA 4M7RA 3SFZA 3HNPA 3NDBB 3DT8A 1ZN2A 2LZ0A 1I1HA 4YR7A 4F85A 1UP4A 1ILWA 2J59A 3FOWA 4CMKA 3FPJA 2WHQA 4UARA 4FU0A 3LS2A 4YUAA 1FNMA 4HEA6 4GRDA 1S7CA 1YQEA 2Y9MB 4KE7A 5JS6A 3PC4A 1SU7A 1JI3A 2LYKA 3N2LA 4HNHA 4ZAZA 1QHHB 3RU3A 1QK3A 2O48X 2VJLA 3E5MA 4TMTA 4Y1RA 1JFVA 1VRCA 3ZWDA 421PA 4DIKA 4KGZA 1LNZA 2DJIA 2IYSA 5HF8A 3CVUA 2G9RA 2P62A 3WLPA 4B7ZA 1WHTA 1UMBA 1CDDA 3LSYA 221PA 4WKCA 3SKXA 3V3KA 4BTVA 2WQ7A 1CUHA 1P1HA 4R8SA 3H83A 1P2UA 2QJTA 4YMSA 4B3TB 3L93A 3BC1A 3TO5A 3DBHA 4NCXA 7REQB 1PS0A 3KT8A 4UD2A 4DC0A 1E9SA 1XYYA 1G291 3WBBA 1CQPA 2BGNA 1QIHA 5LP6A 2BZGA 1BMFD 4EKIA 2XYQA 4AM8A 4XD7D 2BGLA 2WZDA 2YHAA 3IRVA 4UVGA 4NKRA 4XUCA 2YWCA 3ACDA 1Y33E 1Y7PA 3DEZA 2IV2X 3ICQB 3JXEA 2AEMA 4Q82A 2AXZA 5T4EA 3LT5A 1TW2A 2C99A 3IP3A 2G40A 3C8UA 5EMKA 4TXLA 2IKQA 1F3OA 4PO8A 2IC5A 3CLRC 3JY6A 4DLVA 4QT4A 2ZYWX 2YHSA 3AF5A 1U8XX 5JS1A 4I1IA 1BKDR 1RYDA 4JJFA 4W9NA 2OYRA 3GD5A 1J2UA 1OA0A 4UTPA 4YJ3B 5IJ9A 1DZIA 3AF6A 4NNPA 4NOKA 4B17A 1MFQC 5HIMA 5KVQA 3UC9A 1M33A 3BDAA 3JWEA 4R69A 3MCTA 5TQ0A 1SA0A 4DQDA 1LZKA 1VSQA 4MUIA 4A82A 5FTJA 3D6FA 4Q7MB 3P45A 4Q4AA 3QLVA 4ZRNA 2REQB 4MGEA 3OAAD 5FNVB 2C7PA 1NXOA 4V3BA 3U44A 2A7QA 3ZVMA 4C5BA 4B4KA 2UYGA 1CS4C 1O94D 4IRMA 4RK7A 3FYSA 1H69A 3T7SA 1GU0A 1RHQA 4FYHA 4GI7A 4Y30A 2XUAA 1O97C 3COYA 4KQ6A 1E9RA 3W6OA 1WSBA 4BAUA 3F6WA 4D9HA 1MFPA 3GT7A 3BS4A 5JFOA 2IY9A 2C0QA 2AHOA 5EP4A 1QO0A 1H8ED 2V7BA 1KS2A 3AHIA 5I7UA 3PUKA 5K0SA 3NP9A 1OT5A 3FLAA 1QYIA 1K88A 4WCFB 2MINA 4DNQA 3BGWA 4DJEC 1GV0A 3EF1A 2FW8A 3MZ0A 4L0MA 1N0UA 2BFNA 4DA0A 1Z0IA 3KQWA 2RJNA 4WNYA 1ZVMA 2E7ZA 4X61A 2PUCA 1BVYF 4FN3A 4GMGA 1MO5A 1EUQA 3UB3A 1SUCA 2YOHA 1VL6A 2W6JA 3FZYA 4A2PA 5F7XA 3QVKA 4KWCA 4Z4HA 3AR8A 5LU9A 2ZIXB 3QE4A 4Q39A 1SWVA 2V0NA 1UBNA 4EM6A 1DJPA 4K86A 2Q2WA 5LYJF 3ISVA 3RUCA 1EPUA 5BV0A 1JLHA 2RCNA 4HAUA 4F96A 5GIOE 2NO4A 3RVNA 1ODKA 4QXMA 4Q7JB 5K3CA 1M2VB 3TD9A 3NCHA 1JZQA 4FJ2A 1QH0A 2ZTLA 3PXAA 2GK3A 1ORTA 2HIHA 1W5EA 1O5TA 4V0ME 2GZRA 4C3OB 1LX7A 1W0JD 2RH8A 4RESA 5FOUA 5JZBA 4IRUB 1YVDA 1A50B 1KFKB 1NE7A 2KSQA 3HZHA 4C4XA 1CERA 4OEHA 4DLNA 2R8XA 3QBDA 2ZROA 2PQ2A 4P4NA 1E2LA 3EVTA 5A5FA 1FDRA 1HT1E 2P9JA 2QRVB 5F4BA 3SS9X 1BW9A 2PKQP 1X57A 1GGMA 2EBFX 2YXLA 1LTHR 1G0NA 2JGRA 2QPOA 3T41A 3WTCA 3ADCA 1DAOA 2JCXA 3G17A 2ID8A 2IEBA 2XT0A 2YN2A 4ROTA 3VVCA 3R3ZA 4ALLA 3K1JA 3IDSA 4FFOA 1JHAA 1FF9A 1XVIA 3KQSA 4BLOA 1CUZA 4X1KB 3PWZA 3DLPX 3K31A 2OVBA 2R8RA 3L07A 4JKOA 4YRMA 3PX3A 3HA3A 2GXSA 3IIJA 3OP1A 4GLOA 1P62B 5DW3A 3OOHA 3WLAA 4BBAA 3UHFA 4Q2JA 4ZFNA 2YWBA 3GDWA 3CVYA 5CLQA 2NYAA 2XCRB 5K6TA 3WLTA 3WZLA 3ZZMA 1I6KA 2ZBQA 3HU3A 5BSWA 4GVXA 3DB1A 1JG7A 4UXIA 4F2DA 2AMLA 4X4GA 2D5AA 1NW9B 2HTFA 2XA1A 3JWIA 4HPJB 5FBRB 3ILSA 3T5MA 4CMIB 3T52A 2VTEA 3KKLA 4ES6A 1BX1A 2PUTA 3GRAA 2WUEA 5D85A 3SS8A 2CY0A 2AG1A 4BFYA 1AX9A 5C5IA 2JZOA 2X0IA 1AUOA 4R3UC 3N87A 3PGKA 3ZWOA 1RLTA 2XGOA 2NP6A 3QF3A 4OD0A 4XSHA 1ULAA 5C3UA 2XUPA 5I9BA 5TLSA 1KQOA 2Z58A 4RDXA 1AUXA 4TPKA 4Q3DA 5TMPA 4MUFA 3DV0B 4N40A 4RMNA 4JA2A 4ZU6X 4BEVA 5JSFA 4Q3CA 1V1MA 2HWWA 3DBOB 1QMPA 2A1UB 2GM5A 1JSLA 3C7DB 5K6AA 3MD0A 5G0VA 1NN0A 3NIDB 3HGQA 5TV2A 2ADMA 3NNNA 1R27A 4Q1VA 2ZVJA 5CA0F 3ROFA 3W79A 3HI6A 4UM8B 1PV4A 3GDHA 1T5OA 3PXCX 2ARKA 4K9QA 5ALZA 1M34A 3VMFA 1DTWA 1BXGB 1NASA 1LK7A 2AOVA 2XD9A 4GI2A 5LD2B 2J7WA 4OH1A 3E03A 3WBJA 3LVBA 1B3RA 4PGMA 3EULA 4S2UA 3NYRA 5G4LA 4NFHA 3K8OE 2IHTA 1MP0A 1ZZEA 2X13A 2OLJA 1ZS9A 2Z2IA 5EG5A 5ETJA 3AWIA 1MTOA 4WBXC 4QG3A 1LFDB 2YS7A 3C1TA 5EE5B 4EPYA 4V3CA 2JFYA 2WTNA 3PJGA 3HN6A 4R1NA 1U3UA 2DPHA 2VP6A 3CX4A 3I9V6 5CAEB 1AURA 4TWAA 3RU7A 4LHEA 2J5QA 2VSFA 1E61A 3GQVA 4IF4A 5E4YA 1YMUA 4EBBA 4Q93A 3HJUA 1RTTA 4QLBA 5IDWA 1AB5A 1KO5A 2W2OA 3PUIA 4Z2AA 4R68A 3IEVA 4EW2A 3WADA 3NHZA 4TN5A 2ZUVA 3JCZA 2JLWA 2FPRA 2PBRA 3FJ1A 4MYSA 1P7VA 2Z8YM 3A1VA 3OOYA 3KJEA 4QOSA 1NT2A 3K2IA 4FD3A 2DR3A 2DQYA 3LK6A 1JAIA 1X94A 4YPOA 2FWPA 1YZTA 3VHLB 5KPDA 2DBVO 3ESZA 4DWVA 4A23A 3D7NA 4TTJA 1ETUA 2LXNA 4C2TA 2GWRA 3B3FA 1PNQA 2XNDA 3EY4A 1EE2A 1XD2A 2FPUA 3I76A 4JDPA 2XNKA 2GZUA 3WIBA 3WHKA 4BBZA 1JEOA 2FP4B 1Z4OA 4NC9A 5B4UA 3JQCA 2Q7XA 3TCXB 3UPUA 1ZZCA 1JXMA 2QT0A 3Q3HA 3S28A 4C7VA 4M1ZA 4BQQA 2G5CA 3HCPA 1QC5B 1D2RA 4X7PA 1I2AA 2TYSB 4GPAA 5JC1A 1YFLA 1JDTA 2W4QA 2FWRA 5FUXA 2BKUA 2H5JA 2JLRA 1H9CA 4RAQA 4A6XA 4DSTA 5KSOA 3AL0C 2WHXA 1GAXA 2I9KA 4HH1A 1E6KA 2VH5R 1H5NA 2B30A 3MM4A 1XKQA 2IU0A 1OLOA 4IHQA 3ESAA 4L4RA 3VU9A 1I2BA 3KPWA 3PC3A 2YV4A 5J4KA 5IEBA 2C82A 3UUGA 4C43A 1NZDA 1FDOA 1S1MA 2ZGVA 1N1DA 4JKYA 2OPHA 2IHBA 3M6XA 3LXRA 1HBJA 4DG8A 4M6WB 3I5AA 3EPJA 3GDOA 4AWXA 3HBJA 1SQ6A 2ZBFA 3KL2A 2QB5A 4C07A 1ONOA 1SCIA 2A59A 3D0OA 4PNZA 3SF0A 1BWQA 1XTTA 4X20A 4WASA 3RIXA 2BFMA 1YR9A 2OQRA 3KOXA 4PG8A 5HWSA 5I45A 1RPJA 1VCOA 3LQQA 4JJ7A 5CH5A 4KXQA 4YCAA 4E3WA 1MJHA 2V8BA 1X7DA 1NAHA 1LNQA 4X1YB 3EF0A 1QUEA 3K1ZA 1GTL1 5EPUA 5T5QA 1RBZA 3SC2A 3WICA 4C21A 2Z3VA 1ZK2A 3JASA 4DLBA 1T8TA 3I34X 4AZWA 4RZUA 1PBTA 3CLUC 5B58C 1YR3A 4UBLA 4I8IA 5KNBA 4EQ6B 1QK4A 3G2KA 1IJEA 3LLVA 3HL0A 4I8DA 3GD7A 4JLWA 1PWZA 4QG7A 5D87A 2H3EA 1ZVQA 1A4IA 2BLNA 3LISA 1JDZA 1I3MA 3KELA 3CU5A 3KV1A 4I6JA 4NF2A 4FGKA 3RSOA 4E08A 4EJSC 5BT8A 4URXR 4QIHA 5AW6A 2EV9A 2VUHB 3MJCA 5KYUB 2PT6A 4PZPA 4DYDA 3GLIB 2GXAA 2W2KB 3FVQA 4MCAA 3E4CA 1JF8A 1ZXXA 1AKRA 2C84A 2HHAA 3UCFA 2AR9A 4H59A 1QU3A 2KEIA 4X00A 2BE7A 3F9IA 1XLWA 2JQEA 2GJ4A 5D01A 2ZCJA 1M6HA 2OQIA 4WESA 4D79A 4HEJA 4IXWA 2DBQA 3UMYA 4BNJA 1USUA 1HEIA 3TQCA 3FGOA 3BCRA 1YJBA 3P27A 3TDKA 4TL7A 3WKEA 1ZUD1 1OY1A 2NTVA 5BR7A 1H2RS 4O4HB 1GRNA 1XVLA 2FR8C 3A1NA 2MJLA 4M1YA 2QUJA 5EIWA 3ZU5A 3MNFA 3WRXC 3CVWA 3P1JA 1TZ2A 3PGJA 3LUAA 2L17A 4EUKA 4PWYA 4XLLA 2OHIA 3JD2A 4LGYA 4D0RA 4JCYA 4OI1A 4CEJA 2VPXA 2C4TA 4L5IA 1S2MA 5AKIA 2V3CC 3BIJA 1OZGA 2LDBA 2QM8A 4LE0A 5M34A 4BS9A 1UQUA 3TB4A 1J0DA 1U6IA 4IH9A 5H1YA 1M9NA 2PWZA 4YJHB 3V1KA 1H8HA 2JFVA 4B4VA 5MGNA 1S3SA 4QEZA 2CZCA 3B13B 2V0GA 3N0XA 4XIGS 1R69A 2QA5A 4D3XA 2JAXA 2B3DA 4E3ZA 4IPTA 2A0YA 2FP3A 4ZVRA 4IZHA 4BFCA 3CR7A 4XVQA 2PLNA 5BWMA 3FGPA 3K3PA 3VVBA 3EZ7A 3ZQ4A 4D9FA 4O4IB 2I87A 1XDSA 3SDZA 2CJFA 3FFWA 3KVYA 2W2TA 4PN3A 3KG2A 1KSHA 3CKLA 2BJWA 2JJQA 4Q1DA 2X76A 4O4LF 2AR7A 3EE6A 1ABBA 2NUPA 3NVKI 5DGIA 2VTVA 4UTZA 4JBGA 4KYTA 4GS5A 1P5FA 5EWLB 4M1SA 1G8FA 3M82A 4RDIA 4B80A 2X6QA 4RJTA 2XAUA 1FJGB 1CEEA 1F8UA 2CLEB 2PL5A 3JALB 1GNPA 4V0KA 3H0KA 1T0BA 3SR3A 3FUVA 3UH0A 2OFFA 4KR2A 3U6KA 3QG1A 1N2SA 4TYYA 4ZEVA 1QIDA 2QAGB 3AMVA 1GNTA 3I05A 2Y0CA 3LHKA 3LLMA 1YAJA 4KSCA 3LZ6A 3ASVA 2AJ8A 3KBOA 1BAPA 2FGKA 4AMZA 1QHHA 4RM3A 4DMKA 3PFGA 5C37A 1JEYB 3A6EA 3K9GA 3TW0A 1WEKA 3ZDAA 3R40A 3IODA 1O89A 1Q1NA 3RFTA 2X7HA 3L82B 4MKXA 1WS6A 3CG4A 2WJJA 2QYTA 4WLOA 4KFRA 4PBTA 4J3FA 4P58A 2RCYA 1CFZA 2XI4A 5FUBA 3VR3A 3S81A 1FXWA 3MHTA 3SVLA 4YG7B 1C5KA 1FFSA 1LJLA 1N2EA 1V43A 1H65A 1NL3A 4IIDA 4PPYA 5JNTA 2V7TA 5T67A 4N6NA 4LGMA 1YZHA 1RBYA 4TGLA 2D2XA 1U2ZA 1PK7A 3TH5A 2PLRA 3RIHA 5HTOA 4MRAA 1NNUA 1YJ8A 1SKAA 5HA5A 1XZIA 3PEFA 4I1UA 4PYOA 3SYRA 4WOBA 3OTWA 1P4SA 4OQYA 4WI1A 2QTCA 4R31A 1IIRA 4FHGA 3PDHA 3SSOA 1AKMA 2OD9A 1CYDA 1KS9A 3C45A 3IAS1 3QU7A 4KN9S 2I4NA 4KRXA 3LPAA 4QXAA 3K70D 2HWUA 5BQPA 3ZWCA 4R51A 3JQAB 5GM2A 1DEXA 4FLMA 1V9CA 4YJ3A 4I6TA 2GEUA 2QG6A 2CKMA 3QFTA 4XH9B 2BGMA 3WWYA 1ZKDA 1ND6A 4KYVA 1IH8A 4BGUA 5BWLA 1PT6A 5CCDA 1K5HA 2BUCA 2PSEA 2W2QA 3DZFA 3VZSA 2AZXA 3DL2A 3K9WA 1RXYA 1TPZA 3QITA 4MI6A 5EMLA 2KS6A 3RG8A 2WDPA 4GAEA 1HG0A 1KZYC 3GF4A 1O5IA 2BN4A 2DEUA 4DE5A 1AJEA 1C80A 2OZPA 2REQA 3GPCA 4Y1GA 5FNVA 3RSZA 1YDWA 2FXVA 4YUYA 3E8XA 5ED0A 4AF6A 3KHUA 4E6PA 2O2HA 3CX7A 5KYWB 5DO9A 4YRDA 3CB2A 4CI0B 3G13A 4U2EA 3O03A 1KHTA 3HM2A 1W1UA 2I2XB 3LVFO 3I2YX 4A26A 2LLVA 2YX1A 1E69A 2QX7A 3HUFA 4XX1A 2PZJA 5DNUA 4FFDA 3LCMA 1ZJJA 4H7FA 1ULSA 4YRRA 4PSVA 3L7BA 1TI7A 4BFVA 2ZPTX 4WCFA 2JCVA 2H63A 2Z3WA 3WL8A 4CM7A 4JV5B 1BNCA 1Z6AA 3ILVA 1POXA 4BAZA 1ZU5A 1CJBA 3H5TA 5ALWA 1L8LA 1EP9A 1U11A 2Q3HA 3ZLVA 3O92A 3VTFA 1XTBA 2CXXA 4AUMA 2CWWA 1XWFA 3PIDA 1E2EA 2FW0A 2ZTVA 4R71A 5HKAA 2AG8A 1SVOA 2ZJ5A 4CLRA 1G3RA 1A72A 2ZIXA 1U8AA 1SO8A 4DIUA 3O90A 1JDUA 3TIGA 1JJBA 2MWMA 1T3LA 5K0LA 5FEUA 1QVRA 2BKLA 4M0CA 2EW1A 2VNSA 2Q0XA 3GI1A 1OXSC 1QAMA 2VJMB 1K06A 2W6JD 1SBCA 3MJDA 1P6XA 2YY7A 3L7KA 2YRFA 2YDYA 4JBYA 1M2VA 4WEQA 1PT8A 5DSTA 1YIDA 5ALPA 3VZRA 4CCAA 4WN3A 2CBGA 1UC4B 3DFKA 4POOA 3CURA 4IDEA 4XJSA 3LE8A 1UZLA 4ZI5A 3NAZA 2XVAA 2OQVA 1UL1X 3TX2A 4DKXA 2C31A 3MSCA 3PHCA 4C0XA 4D74A 3WB2A 1KYWA 3QPAA 5K98B 4HRXA 2QXUA 3W90A 1MOSA 1P2BA 2I3BA 3EXFB 3B3JA 4IHJA 4OXNA 2PPLA 2QRVA 2XZPA 5DM0A 1JIQA 1NNSA 2NTEA 2C8VA 2CLMB 1Q74A 1JN0A 2GZHA 3EARA 1MXFA 1MQ8B 3KKQA 3NUZA 4I55B 4NZ9A 1TQ2A 2A35A 3SEFA 5AMXA 3DVSX 3FHLA 2FW6A 3MILA 3BS3A 4PQRA 4OK6A 1LI4A 1MMFB 3A32A 3ABQB 3C24A 3AG6A 3MSXA 2H7CA 3QHQA 5CTJA 3WYEA 4HPWA 1OX4B 2BHRA 4X1KA 2O52A 3MRXA 2ZRHA 3Q1KA 2X4GA 1BH6A 1QS0B 1GUFA 2FDXA 1G19A 4DCOA 4C5AA 4KIFA 3V1TC 2BFBB 3G8DA 4JOSA 4Z9AA 2KHZA 2P2LA 1JIKA 3GLRA 2RI6A 4MB2A 4RMHA 4ETIA 2I3DA 1P4AA 1U2TA 2I6XA 4GECA 4I3FA 4EEZA 1BHO1 3DVLA 2SNIE 3IVAA 5CXQA 3OLVA 1DUSA 1TYEB 3E9NA 4A0GA 1DQYA 1JE1A 2H85A 3C7AA 4KXWA 1VMIA 4LTMA 4YAKA 4LZJA 5F64A 3CCCA 1JTEA 2JGDB 3SS7X 4CMIA 4DG9A 4CLDA 4BBPA 4QJ3A 2OFPA 1VE1A 5C8YB 5BPFA 2Q3EA 3FLMA 1FTQA 4H9GA 3QEOA 2XMGA 1Y5IA 5E7MA 1VP3A 1XCMA 2IHUA 4Z5CA 2OTCA 2X0KA 4ND4A 1K4KA 4AJ2A 2CVQA 1A96A 3LF1A 4RXUA 4LWQA 5L3SA 2A1UA 5TF4A 1T6YA 1Q44A 5JXGA 4Q4JA 4JR2A 4LDRA 2WICA 4RYLA 5C31A 1N2BA 3GGJA 4BB5A 3L9XA 4HXFB 5F5LA 4OL9A 3WWDA 3QX7A 2I6FA 1KGDA 3B38A 4WLNA 4B83A 3EWIA 1PAUA 1B41A 3ONDA 4UUNA 3AVWA 4NMMA 4WOJA 5B7NA 2HA0A 1CX9B 2WG2A 1BXGA 4LDZA 3FIJA 4FLFA 2PMFA 5DM2A 5E1DA 5TE9A 2R8YA 2P4HX 4BB6A 4HVCA 1T2DA 1NRXA 3NOVA 1TMYA 2B0CA 2WLSA 2GTIA 1X8JA 3B1XA 3IO5A 2AKYA 4LXGA 3OPNA 4FW8A 4MW1A 2A84A 3W04A 2C4HA 5FIUA 2H4WA 1JBKA 5U4QA 1KMHB 5A7FA 3SX4A 2PIAA 1A5BB 4AJJA 2G4VA 4UM5A 3TXYA 4D7AA 2Y99A 4QOFA 4AUNA 1KOGA 1PTJA 2LKCA 1G6OA 5IC6A 3VR5H 4HX9A 4LF6B 4OHYA 2VZLA 3M9LA 3ITEA 1JZSA 1QGED 3OM0A 4JWTA 4BWYA 4Q1AA 3SIXA 3IVPA 2J4FA 2ONCA 2PS0A 2ISCA 2XYVA 3CT6A 4MEBA 4EYSA 1WBBA 5JWOA 3GB9A 2ZRJA 1V3UA 1MHPA 1B73A 3Q88A 4E7OA 5DX1A 2JJ2D 4IJWA 3NH6A 1L5FA 3D31A 1NW7A 2EYQA 3BGDA 3SYLA 5JMWA 1YI0A 3B9BA 4DCJA 1U4OA 3IP8A 1V6AA 3P0FA 5FORA 2FP4A 4N12A 3BWDD 1A82A 3EGCA 3CF2A 4G01B 1WD5A 3WHPA 4MW5A 5E6SA 1TVCA 3JQEA 2XNDD 4ARCA 2LIPA 3LI2A 4LOHA 5TQJA 2JH3A 2VYVA 5ICGA 1RZSA 2I1QA 2W6IA 3ZYZA 5ALYA 5B1YA 3KFLA 2HHLA 3C87A 5IM5A 4KPFC 5ICEA 2JGFA 2WB2A 2P3OA 3AJ8A