4ER7A

Crystal structure of human dot1l in complex with inhibitor sgc0947
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
339
structure length
326
Chain Sequence
KLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic site remodelling of the DOT1L methyltransferase by selective inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
total genus 106
structure length 326
sequence length 339
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4er7A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4er7A02
2ZTHA 3RODA 1NBHA 4RTNA 3DUWA 3F4KA 3KU1A 3PX2A 5CVVA 4YUXA 2ZCJA 3MGGA 4C4AA 3I64A 3MCTA 4CKCA 2ZZKA 2P40A 3PB3A 3IV6A 2OYRA 3ELDA 4BLWA 5K0FA 4DA4A 2FK8A 4ER3A 2LD4A 3FUVA 3IYLW 4AZVA 3MB5A 2I9KA 2IH4A 3LKDA 4GOMD 3Q87B 4YUYA 1JQDA 1KPIA 2UYQA 3B89A 3GRZA 4X60A 4XUEA 2NXNA 1RI5A 1RI4A 3CBGA 3KQMA 3NVMB 4C06A 2ZWAA 2ZBRA 4P7GA 3T0IA 2YVLA 5GOZA 2IGTA 2EJUA 3OPNA 4RVDA 5EOVA 4YUZA 1BC5A 4KWCA 1XDUA 5EQJB 2NP6A 5K0JA 1EIZA 5EMLA 3LCCA 4Z2YA 1KYWA 5M5BA 3FPFA 2UYCA 3V97A 3B3JA 1ZQ9A 2Z6UA 5HIIA 2OO3A 1XCJA 4ATNA 3KPJA 1EQAA 3LCVB 5KVAA 1R00A 3R0QA 3KQWA 5K0BA 3IHTA 4OX9Y 2I62A 2ZFUA 1YFLA 1RJDA 5DM4A 1VPTA 4E30A 4RVHA 4C07A 3MTIA 1DUSA 3DOUA 1HNNA 3BUSA 4O29A 3LX6A 4PINA 2ONYA 2AOUA 1G55A 1L9KA 2P3LA 1XTPA 4QQKA 5FTWA 4YV1A 5IKMA 5CVDA 4XCXA 5E8JA 3TR6A 3P2EA 4X1OA 2PKWA 1JG1A 2ZZNA 4KIFA 3HCDA 3TM5A 1NBIA 1ZHFA 3HA5A 1NW5A 5LQJA 2B78A 2HTEA 3FRIA 4JXJA 3TLJA 1JG3A 2WA2A 2P1DA 5F2NA 3DP7A 5GIOE 5K01A 4HC4A 3UWPA 2IIPA 3FPEA 4AUKA 4GUAA 3I58A 2BM8A 3LL7A 1WZNA 1Z3CA 2ONZA 4PYLA 5KQSA 4PNEA 2P8JA 3GRVA 3M33A 2P3OA 3P9CA 3R24A 4RTQA 3NMUF 7MHTA 1SQGA 1MJFA 3FUXA 3BGIA 3TOSA 3EGEA 3OE5A 1KP9A 5FHRA 1PJZA 4L7VA 2OB1A 4E2YA 3MERA 1EAMA 1XXLA 1G8AA 2C7RA 3ELWA 3ME5A 4RTLA 3OZRA 3EVEA 5HILA 3IEIA 3THSA 3DXYA 1UIRA 4MHTA 1KXZA 2FPOA 4WXHA 5H02A 4KVZA 4FT4A 3REOA 2UYHA 2G1PA 5GINE 5DSTA 3OU6A 2CMGA 4BP1A 2GAFA 3MAGA 4LWPA 3UBTA 2ZW9A 2VS1A 4GC5A 2CKDA 5FUBA 1KYZA 1O9HA 2WK1A 3OZSA 4KIGA 2PXXA 4P58A 1NKVA 3EPPA 3EVBA 4PYMA 4DMGA 3KR1A 5T64A 5K8VA 3AJDA 2KW5A 5HOQA 2G70A 4DCGA 5EKXA 4PGHA 3G5LA 4NECA 5DSXA 4FZVA 3BGDA 4PGGA 4E70A 2PBFA 3GIWA 3PS9A 1G6Q1 2ADMA 2IH2A 3HA7A 1YZ3A 3TRKA 3DMGA 3C0KA 3OE4A 5EIWA 5P8WA 4RTMA 2XVMA 1X1DA 3HEMA 3KQSA 4PONA 4R6XA 5K0NA 3ID6C 3UA3A 2JH9A 1F38A 2P7IA 1SUIA 3EMBA 5E1DA 3VSEA 3A4TA 2PX5A 1VQ1A 2GB4A 3JWGA 3LCUA 4CXMA 2Q41A 3EMDA 3FZGA 4HTFB 5GP1A 2NYUA 1I9GA 1NW3A 2PT6A 4M37A 4EVIA 4OBWA 4HG2A 2C7OA 1G60A 2QE6A 5ICCA 4KRGA 3NTVA 3DTNA 4OA5A 2Y1XA 4CTJA 5EPEA 2HNKA 5FCDA 3KR0A 2AVDA 2ZBPA 4F86A 1ZGJA 2JH8A 2YX1A 5BW5A 1PRYA 3FRHA 2HR1A 2PX4A 4EKGA 2OBFA 2QM3A 1XDSA 3B3FA 4RSRA 3HCCA 1D2CA 1D2GA 2PY6A 4BLVA 4RV9A 3PTAA 3LHDA 1ZKDA 2Z6QA 1X19A 2ZIFA 4PYOA 4E31A 2B2CA 3LDUA 1Q0TA 2IP2A 3G88A 4ER5A 2EJTA 3OFKA 3FPGA 4GEKA 3GRUA 2EX4A 1TW3A 3LDFA 3DMFA 3DXXA 3GDHA 5DTRA 1QANA 4H0NA 5EVJA 5C0OE 3EGVA 3PT9A 1N7IA 3NDJA 2ERCA 5LQUA 2VDUE 3G8BA 4QVGA 3SVZA 5FWAA 4R8SA 3HP7A 2PLWA 1L1EA 3KQTA 1ZG3A 2QRVA 4FSXA 10MHA 3NWBA 3E7PA 5EG5A 3SSMA 1UFKA 5CVUA 2ZZMA 3NDIA 2YXEA 3NJRA 1VL5A 2JHCA 3BKXA 2VZ9A 1QAMA 5F2KA 5ICEA 3NVKI 3UJCA 4MIKA 4EK9A 2G8NA 1X1AA 2OY0A 3E23A 3LSTA 3E8SA 5U4XA 3O4FA 1B42A 1NV8A 2HMYB 3ORHA 3KR2A 4PIMA 3UZUA 2AOXA 2PXCA 2ZWVA 5DPMA 3UJ6A 5MHTA 5D1HA 2P7HA 3HCFA 4GOND 4G56A 3OFJA 3LBYA 2HV9A 5DTQA 3CC8A 4KW7A 2NNWB 2OPBA 3JWIA 4E33A 3BKWA 3G89A 1KPGA 3UJ7A 1DCTA 2YXDA 3FTEA 4QPNA 5HIMA 3LKZA 5FHQA 3NWEA 1AQIA 5HEKA 1NT2A 3ERCA 1WG8A 1F3LA 3HVKA 4M36A 2G71A 5ICFA 1WY7A 3G8AA 2AOTB 3EVGA 1NW8A 4QQNA 4GBED 1H1DA 3SM3A 3GO4A 5EMKA 4P7JA 3TMAA 2OB2A 3DXZA 5EEHA 3UJBA 2E5WA 2PV0A 5KYGA 5LSAA 2O05A 1G8SA 3H2BA 4QTTB 3THRA 4MQ4A 5EZSA 4IV8A 1XVAA 3M6VA 2YUIA 3PFHA 4PYNA 5EHIA 4AZWA 4C03A 1R18A 2Z6AA 5EIFA 3KQQA 3CKKA 1SG9A 3BWYA 1OR8A 2ESRA 5FWDA 2CMHA 3UJAA 1O9GA 1NE2A 3VC1A 4RTSA 3DULA 3M6WA 4PCAA 5DLYA 5EKUA 5T67A 3SMQA 3SSNA 4YUVA 4DM3A 3HVJA 2AVNA 3GRYA 3MTEA 3QOWA 4ER0A 1TPYA 2GS9A 3LDGA 3UJDA 1NV9A 3DH0A 2QY6A 5E9QA 3BT7A 5DX8A 5DRYA 4CKBA 3GJYA 4HGYA 8MHTA 3B5IA 5C9ZA 2FHPA 4QDKA 3G2OA 5BP7A 3UJ8A 4F84A 4V0QA 4BLUA 3HCBA 2PX8A 5B1SA 5DTMA 3EVDA 4PWYA 5DRTA 4PYQA 4AZTA 1M6YA 4RX1A 2FK7A 5CVEA 1IY9A 5G02A 3T7SA 4RTRA 2BR4A 3CJTA 2UYOA 1INLA 4CTKA 5FA5A 3M4XA 3A26A 2XBMA 1EJ0A 2PGXA 5GIPE 2C7QA 5K05A 3BWMA 1R74A 4R6WA 4DKJA 4DF3A 2HWKA 2C7PA 1XJ5A 4HSGA 5HFJA 3FUWA 2ORED 3M6UA 2OKCA 1L3BA 3HCAA 3FUUA 3UFBA 5DM0A 3HVIA 3L8DA 3KQYA 3BGVA 5CM2Z 2ZIGA 2CL5A 3KPWA 1V39A 1R6AA 2BM9A 2BR5A 1VBFA 3KQPA 3LECA 4LECA 5FULA 4CKEA 5DM1A 2JG3A 2UZ4A 2PX2A 1JTFA 4BP3A 5KQRA 3LGAA 4FS8A 2B9EA 3KPYA 1L3CA 3SR4A 2DPMA 4BY9E 2P41A 2IDKA 4Y2HA 2A14A 3FPJA 2IPXA 2AN3A 2P3QA 3EVZA 4E32A 1EG2A 1I4WA 3GXOA 1RI2A 2N47A 3R3HA 4GOLD 3TPZA 2PXAA 1KIAA 3FUTA 4M7RA 4RTJA 2AR0A 5D1NA 1KPHA 3ANXA 4X61A 5DWQA 2YQZA 5CVJA 1QZZA 4PCLA 1JTEA 4FR0A 3A7EA 5CIYA 2QYOA 1YUBA 1JR4A 2K4MA 1SVUA 3GRRA 3KQOA 4V0RA 3VC2A 5FQNA 1VE3A 2H11A 2PWYA 4C05A 1YFJA 3G2PA 1X1BA 2I6GA 1MHTA 3EVFA 2V7EA 3ER9A 5ICGA 3PLAE 2JHPA 3LPMA 1IXKA 3P2IA 2O0LA 5GM2A 5GWXA 3M70A 3I5UA 3G2MA 3KPUA 2R3SA 3M6XA 2QRVB 1RI3A 3C6MA 3E05A 5EC8A 1KHHA 1G38A 2PJDA 4QTUB 3SGLA 3TQSA 2DULA 3CJQA 1P91A 4YMGA 3B7PA 4FP9A 3GCZA 1UWVA 1QAQA 9MHTA 4EQZA 4ZTBA 4WVLA 2YXLA 4E2WA 3CGGA 4B17A 3P9KA 3EGIA 1R8XA 1JSXA 3QOXA 4FT2A 2G72A 3X0DA 4K6MA 2ZSUA 3C6KA 5CCXA 3R9XB 4EKIA 2YTZA 4XUCA 3KQVA 2AOUB 1I1NA 1YB2A 3NW9A 2JJQA 3QV2A 5E1MA 2PVCA 3P97A 1FJXA 3KR9A 5CD1A 3RIEA 5E8RA 1YF3A 5JR3A 4P7FA 2PWPA 5E1OA 1QYRA 2JHAA 5E9JA 5EZQA 4YV0A 2GLUA 2NXJA 5LR6A 3HCEA 1FP1D 5DXJA 1FPQA 2PSSA 4KDRA 2FRXA 3TM4A 1R8YA 1SUSA 4A6DA 2H00A 4R8RA 3MHTA 1XCLA 1JQ3A 2Y1WA 2XYVA 4LG1A 5T6BA 5EMJA 4POOA 1EJ6A 2P35A 3HNRA 4IKPA 5CUQA 1P39A 3DMHA 3SSOA 2PT9A 2O57A 3ELUA 5HZMA 5LQRA 1L3IA 1O54A 1RI1A 4GF5A 2BZGA 4OBXA 3A25A 5DX0A 4Y30A 4EMSA 4UOEA 4RTOA 4AZSA 5HIJA 2IFTA 4DQ0A 4R05A 5BXYA 5LQAA 5IH3A 3VYWA 3KHKA 1SQFA 2AOTA 3Q7EA 4X63A 1N2XA 1TW2A 1P1CA 1JSZA 1RJFA 4HGZA 3FTFA 4X41A 4RTKA 5FQOA 2BH2A 3I53A 3HM2A 1KR5A 3B3GA 4RVFA 5JUWA 2I7CA 5EEGA 3EEOA 1FBNA 4U7TB 4C04A 2NXEA 3BZBA 2IBSA 4KDCA 4MTLA 5DM2A 5ERGB 2V74B 2EG5A 1M6EX 1VP9A 2O07A 5GM1A 1T43A 4YMHA 5K03A 2GPYA 3C3YA 5C1IA 2R6ZA 5K0CA 3P8ZA 1JG4A 1ZGAA 5E1BA 2AOWA 2CWWA 3DR5A 4FGZA 4GQBA 4QDJA 1ORHA 1XDZA 4QVKA 2WA1A 5E2BA 3C3PA 1IM8A 4YUWA 4IWNA 3A27A 2GH1A 3PFGA 1NW6A 1BOOA 3TKAA 4LWOA 3P9IA 3S68A 3TFWA 4HH4A 3JWHA 1VLMA 5FA8A 4E2XA 3FTCA 3EVAA 2AZTA 5BW4A 2FCAA 5LQCA 3D2LA 3V8VA 1Q0SA 1BKYA 3G7UA 1HMYA 2BR3A 4AX8A 5LQNA 1VIDA 3A7DA 1DL5A 2FYTA 2OZVA 2F8LA 3JWJA 1WS6A 2IBTA 1JG2A 5CCBA 3CJRA 3SX0A 3U81A 4U7PB 2XYRA 3FYDA 3K0BA 1NW7A 5K0GA 3MCZA 3KKZA 4GC9A 2VDWA 3AXSA 2AOVA 5E2AA 3G2QA 5K09A 4PYJA 3O7WA 1VP3A 2IDJA 5K0EA 4MWZA 1X1CA 4M38A 1ORIA 3DLIA 2YR0A 3BXOA 3T7RA 1FP2A 2IH5A 4OQDA 3P2KA 3UJ9A 1BHJA 4HTFA 2B3TA 2H1RA 3HA3A 5E9WA 3SXJA 3OU2A 4FSDA 3PX3A 4OQEA 2GA9A 2VDVE 3OZTA 2XYQA 3I9FA 4C08A 5KS2A 4A6EA 5DT2A 3KPVA 3BWBA 4HRAA 3GWZA 1U2ZA 3RW9A 2ZVJA 2B25A 1RJGA 3P71T 3GU3A 4P7KA 4CWAA 5LQKA 3K6RA 2NXCA 3HVHA 5DX1A 3FTDA 2ZLBA 3FYCA 3O31A 4QPPA 5K0LA 5EMMA 5F2OA 5FADA 3T7TA 4RTPA 3OU7A 4DZRA 5HIKA 5DXAA 4ER6A 2AN5A 3LBFA 1RJEA 4PYIA 4RWZA 5EGSA 4F85A 3CVOA 4GOOD 2ZULA 2ZBQA 2AN4A 2AS0A 3GNLA 3TKYA 1D2HA 3CCFA 3BWCA 2NP7A 3R6TA 1SKMA 1WXXA 4DCMA 3ER8A 3EVCA 2O06A 5EHGA 3MQ2A 4E2ZA 3HTXA 4XUDA 3G5TA 4IV0A 3WSTA 4RYLA 3EEYA 3FPHA 1Y8CA 1JQEA 3DLCA 4ISCA 1QAOA 4OA8A 3ELYA 4YV2A 3AXTA 2XVAA 4RVGA 1YZHA 1N7JA 2EFJA 2OXTA 1AF7A 1M0EA 3OCJA 2VP3A 4PYKA 4PIPA 1WXWA 3AY0A 3AWIA 3PVCA 3UA4A 3GGDA 3P9NA 1AQJA 1P1BA 1AV6A 4ER7A 2ZIEA
chains in the Genus database with same CATH superfamily
1YVPA 1H42A 2V58A 3STXA 2PRJA 4Q3KA 2DB3A 1C41A 3DMRA 3QK7A 4WVFA 3VR4H 2BONA 4GZ5A 3A8TA 3GFQA 4K81B 1JV2B 2J7PD 2P40A 3PB3A 1O95C 3DEJA 3ZWBA 3ZWDA 2ATVA 2FK8A 4N1AA 1ISHA 3F49S 4NG5A 5HTKA 5JLAA 1KE2A 3GN1A 3IYLW 2Z8YM 4EB6B 3MYRA 2V3CC 2P9TA 1HWYA 4C3VA 3BH0A 1T0BA 1KDTA 4B09A 1FYEA 5EJ8A 4A8JA 2C98A 4PHGA 3V55A 3G2KA 4IHJA 3T0IA 3GJQA 5CYGA 2ZRMA 4TKUB 1U8AA 1RRMA 3D4IA 4PNPA 4XM1A 2OZLA 2KEJA 3U7QA 4IIFA 4GI7A 3X1JA 4XEHA 5C8DA 3W5DA 3EDOA 1TCBA 1SXGA 4WBXC 5BQFA 1IM5A 3E81A 1T2FA 3WGKA 3NRJA 1A7KA 1BRTA 2JGJA 4C3ZA 1TEZA 1Z63A 4MW6A 3SJAA 4CEHB 3ZY5A 4CBVA 1NWCA 2CD9A 1VPTA 4YDHB 3I92A 3NM5A 2E7ZA 3COWA 4RYLA 1SOWA 1AT1A 1IG3A 3EBOA 1F51E 4HLUA 4HQLA 1IL0A 4ESEA 5B7PA 4PX9A 3RT1A 1RMTA 3I8OA 4FQ5A 3I52A 1GGHA 2R7MA 3HCDA 3DOFA 5BV8A 3CROL 3NOXA 5CK4A 1UUFA 3GVPA 3L3BA 3OZBA 1JDSA 1S8AA 5KYWB 3OCWA 3WGTA 1R0RE 4YMTA 4J1QA 4W1QA 3FRIA 4DLKA 2KI5A 1R1DA 1IHOA 1P4AA 2XNDA 2YDYA 4KREA 4L4XA 1A5SB 4GSKA 5DEOA 4RPHA 4C0XA 1XA0A 1ZJYA 5I7FA 1QTQA 2RGBA 3DCIA 2HBYA 4NABA 1OT5A 1V95A 3D8BA 4KUEA 1E66A 4DQXA 4R0MA 4ZDJA 2IZOA 1R6UA 2QYHA 3JR7A 1VL0A 4J16A 2OP0A 4OXNA 4S35A 4YN3A 4HLQB 3U60B 4K28A 2DQKA 2OBYA 3BJEA 3CX4A 1QO9A 5CTAA 2OPHA 1GZ6A 1JQKA 3TIXB 3IAFA 5HZHA 1GCAA 3V42A 4RTQA 1SQGA 4P3OA 1HX7A 3ZWYA 2VTBA 1SA0B 3G0TA 2ZUVA 4R3UC 1IUPA 1CQIA 1NNI1 1V45E 3ELWA 4FFPA 4D6PA 4G1FA 3OZRA 5IVPA 2YVUA 4A0GA 2DVMA 1PUXA 4BCBA 4D4GA 3ESBA 3WQHA 5IU6A 4GKJB 3PC6A 4XIGS 4CCYA 2YV1A 4V1CA 4O4IA 3AVVA 1DEOA 3UM9A 5FH9A 2CMGA 4EJSB 1ZUNB 1YQXA 5G4LA 4P33A 1QPGA 1R15A 3TX2A 2J7PA 3D3WA 4ZGGA 5DW3A 5A1TA 1QORA 1MT3A 2BZ1A 4OM7A 4EA6A 3U3JA 3MINB 2CUZA 2J4FA 4K6GA 2IY9A 1VYUA 4OREX 3WGUA 1Z5PA 4ALNA 4I2NA 3ZHCA 1B0NA 4YO7A 2H8RA 2PZJA 2WNSA 4HQOA 2ZYDA 3DWIA 3PSHA 1ZK2A 5EE9A 3U80A 1AA9A 4CZ2A 1WRBA 1RVDA 8LDHA 1G6Q1 2C9OA 3VAAA 5JO0A 2C5AA 3DMGA 4AQ7A 1V7CA 2WIJA 1E1QA 2Z5GA 4UBJA 5F1OA 3ZWMA 5K0NA 3ZHYA 2OFXA 2FX2A 3RSGA 4GZ3A 2P7IA 1WOMA 4IDQA 4RJTA 2CYBA 3CNQS 1NPTO 1N2CB 2BBTA 4AJ4A 1DWPA 1QIIA 2Y93A 1SIUA 1QQAA 2G76A 3KTAB 1RAHA 4GWGA 1D0IA 2D4AA 4G1EB 2F59A 2BGJA 4DDTA 1DKRA 3GZTB 2WV9A 4GKKB 1E9SA 4Z59A 3JQ8B 1SHTX 1TCAA 2QE6A 3T1HB 4Q47A 3WGQA 4XSGA 1HKHA 1NM5A 1QB2A 2PD4A 1L7DA 3G1WA 3OEEA 4FNOA 3VH2A 5ILOA 1KDVA 4CKZA 2AVDA 4F86A 1PRUA 1ZNZA 2CSUA 1EJ2A 1U0TA 1V9CA 3O75A 1KJNA 4OGLA 1R27A 5E4YA 3SK0A 3VI3B 4AP5A 1XQ9A 4U7WA 3KB2A 3QLVA 5LUAA 4W5QA 1UK8A 2QVBA 4HHEA 1T6BY 1KRWA 3U7HB 2ZIFA 2IHZA 2DPYA 2KB0A 3KL4A 3OM1A 3ICEA 2B2CA 2WU8A 4LRQA 1Q0TA 4V0NA 1W8DA 2F1IA 2X42A 4JN6B 1KAEA 1LGYA 3C8ZA 4KYTA 3G5AA 5TY0A 4B44A 3UH0A 3NKLA 5IJWA 2LXNA 4HFJA 3N0VA 1GCUA 2WYOA 4JITA 3TW6A 4UPEA 3NHWA 5LNK6 5LDHA 5J43A 2ZRFA 4L9AA 4MI6A 1ULHA 2QLBA 2Y71A 1IN7A 3PV0A 5CFOA 2PLWA 3IP9A 1DLIA 1ODJA 3H3XA 1DBSA 3HDTA 2DTDA 2FTKE 3OZVA 1TCCA 5J4YA 2RHOA 1SCIA 4KI0A 3U17A 2PBLA 3QBJA 2P2DA 5F3WB 3FWNA 2Q6OA 1SHZA 2HK7A 1BRMA 3FBTA 4XYBA 2CV0A 3MFQA 3R74A 2Z95A 1J06A 2HWUA 1P1JA 3G49A 5CBPA 1NV8A 4WMLA 4C88A 2I99A 4LSGA 3V3KA 5HRAA 2ZWVA 3PJRA 1R4MA 4U8HA 2REQA 4JBGA 2P30A 3OFJA 2ENUA 3BB3A 1MUUA 1QR6A 3CC8A 3TECE 1KO4A 4E33A 4R9VA 2MMCA 3C3DA 2DPXA 3ANMA 1O87A 1I2CA 2GN9A 3PPIA 3JD3A 4GX5A 1HPLA 1XAIA 2OC9A 4D6XA 1K7XB 4NNJA 1DEAA 3ERCA 4EQ6A 1NT2A 2ZI5A 1YJQA 3AUJB 4AJNA 1T8SA 1JEAA 2X19A 1J2TA 3HKCA 1FRFS 1TM1E 3K96A 2GHQA 2Y0BA 3QPWA 3QUQA 4R2KA 4HPJB 4JWTA 3T9EA 1GUFA 1XLVA 2NTVA 4EI9A 2Z58A 4G81A 5JDIC 3AILA 2XV1A 3O8OB 5BSTA 4BKQA 3BXXA 4R68A 2PG3A 3PE3A 1JW9B 2C4HA 2OV2A 2EF0A 2P9HA 3H6GA 3KCQA 3A1CA 3QW2A 5JV5A 5K99A 1ZK0A 1I8TA 2YUIA 5CHEA 5EJGA 5F51A 5FBWB 3NUGA 5ES4B 5DF1A 1XZBA 3IERA 1T3SA 3LOUA 2X5XA 5FPSA 5IMBA 3V46A 1SG9A 1ZWLA 4XR9A 1OXXK 1ZBDA 2XOKA 3NTXA 4LHWA 5TDHA 2NO6A 2LLVA 4RTSA 3O74A 1DARA 2QRQA 2GKGA 2I2XB 1QPZA 2XWQA 2C78A 2H52A 1U99A 2PFSA 4ZN6A 1RWNA 2A5LA 2A5DA 2Z6VA 3I34X 1T26A 2CKMA 2QB5A 2VBCA 2POQX 2YY5A 4FOPA 1HF0A 1DC5A 4M0PA 5E9QA 3H1PA 3TLBA 3ZDRA 5FUMA 5IKEA 1ZXXA 1VPVA 4FB4A 1YOVA 1DEXA 3LFUA 1YRYE 3GZNA 1BFUA 4FX5A 4IRXA 2WNHA 4U7JA 4LDRA 5B1SA 3U9SA 2N0SA 4PWYA 5A9SB 2XCRB 3C39A 1NQWA 1GKIA 4L15A 2X0FA 2F3PA 5ETJA 5F7ZA 4D5EA 1FP4B 1L5LA 4CTKA 1QTNA 2NO1A 3RH0A 5LU9A 3QEAZ 1ZI6A 2W7TA 4BECA 4G86A 2HTFA 1R37A 4KKXB 3KEQA 2GK3A 4O4HB 1W0JA 5FPTA 1L7AA 1Q0UA 1WTAA 3CN7A 3DMPA 1GY8A 3MG9A 4HSGA 5G1OA 4ARVA 4TVKA 3KEOA 3FUUA 5HS6A 2QZSA 2KQUA 3L8DA 2R8XA 1LBTA 1E4YA 1UJ4A 2XT0A 3QOYA 1CY8A 3OIYA 4HRXA 3HCPA 2O2GA 4PLGA 1R6AA 1KSJA 4YJGA 4Y6OA 3DMYA 4DMUB 2G07A 3U39A 2DY0A 1IN5A 2PX2A 4MUGA 4DR4B 6REQA 3N0RA 1IUNA 2PA3A 4TS1A 3ZHMA 2GKSA 5FNVA 2WM8A 2ZITA 4KB5A 2NU8B 5C1BA 5DBIA 4QPCA 5L6LB 2YBEA 4CFZA 4WASA 5CDFE 4RHUA 4EBBA 1J8QA 2ID9A 5M34A 3PR2B 2C29D 2PXAA 1Z22A 2ZB7A 1JB1A 2O2EA 1FXSA 2GPWA 2QP9X 2OG2A 2VPXA 3O83A 1E99A 2PNJA 5KTPA 5CVJA 2AXZA 3HGTA 4XGQA 5E95A 1TEVA 3ZGLA 1YA6A 2QYOA 2R4TA 1E7RA 1X2BA 4ND3A 4XWKA 2R1TA 3AP1A 4RADA 3FPCA 4CF3A 1IVSA 1HLPA 1KAGA 1W2HA 5F77A 4Y2VA 4OMDA 3HUDA 2PAAA 1WDWB 2BI4A 3ER9A 4B85A 3N2IA 3PFNA 1IXKA 4JJ8A 4JEUA 2BF7A 2Q5CA 1RXUA 4MWBA 2OUIA 3ZWAA 5IF3A 2L17A 3OHMA 3I4CA 4QTUB 1RAGA 2P9FA 3SGLA 4RPGA 4ZOEA 2E55A 3I2JA 4YMGA 2CVOA 2HUPA 2Z8XA 3CPSA 4FOLA 4X94A 4KR9A 3WLNA 2EBYA 3FFWA 3W8EA 4B7CA 4F4FA 4IVNA 4KMOA 3HXQA 4C7OA 5BMVB 3I01A 4JI0B 1UDRA 1M6VB 4NBKA 1E2IA 4E2WA 3QBDA 4FT2A 1UAAA 2YJNA 2ZSUA 3QNMA 1BHQ1 3IKVA 1Y7TA 1WZCA 2C3OA 4HB3A 5D51S 3HR4A 3QHPA 5CCDA 1DINA 2QTFA 5EWLA 5TQ2A 4TPKA 4KWHA 4LZAA 4UCXA 1ESDA 1D9ZA 3N87A 2R6GA 4YGYA 5JDIA 3WA6A 2C9DA 4BBJA 2ZS9A 5I8ZA 2WHQA 2H00A 5FO0A 3HCRA 4O8ZA 5IZCA 2QAGA 4KZKA 3O2SB 1V6AA 4HNAA 5EMJA 4CKXA 1QDEA 3AUFA 3O8OA 3PWSA 4KN6A 3CKLA 4X44A 1B93A 4EO4A 2EYUA 5AP9A 4WKPA 2PT9A 5AICA 4ASUD 4WADA 5DN9A 1RI1A 1O54A 1XEXB 4OAQA 521PA 3P9RA 1U31A 2CXSA 2GPAA 2VWGA 4LI0A 1X9GA 1W34A 2XWJI 3DLPX 3CUVA 2GEBA 4NZOA 2IHNA 5ECWA 5SY4A 5BSWA 5LQAA 2YS7A 1C7IA 4GPIB 2D54A 2OAEA 4ZAZA 2Q8PA 4Z49A 3B7HA 1VCMA 2X9QA 5DHAA 5KU1A 1C2TA 3LQ2A 4RH3A 5EINA 3QE2A 4RTKA 1X8LA 1HFJA 2XH8A 3LY9A 3EPRA 3HV2A 3OJXA 4ZAYA 4YLYA 4CUKA 2ZDQA 1ILWA 4HLCA 4PU3C 5EERA 2VLBA 2CHQA 2WUFA 2C04A 3LX4A 5I45A 3O90A 5KYKA 1KL7A 4BXOB 1NBOA 3O4HA 1A77A 3PHBE 3UT5B 4DDHA 1XTVA 2EG5A 2QXYA 2WHXA 3T1TA 5KYUA 1NI4B 5DTEA 3VTZA 5ENVA 2O54A 1A0OA 2VPZA 2HAEA 2CWWA 4PPNA 1ENPA 4JOQA 4F9TA 1MTZA 4JVOA 1PL6A 3M6FA 3R23A 3S2UA 3VOAA 1JI0A 1UK7A 2XNKA 3AV0B 1OV4A 5J3JA 3TF5A 3NU1A 2JFFA 2OORA 1HY3A 2GXUA 1Z13A 4TXJA 2G5TA 3K8ZA 4JDPA 4GLLA 1LD3A 3CW8X 3NGMA 4IMJB 3IQIX 4KLZA 4AX8A 4XWOA 3DE0X 1MOPA 4BMDA 3OPYB 2QTTA 3VSAA 3C5EA 2GVDC 4ZVQA 1Z17A 1W4CA 2OV6A 3HXOA 4KYIB 4KDFA 1SUEA 3C85A 2IBTA 3P0JA 2O7RA 1JG2A 1M5RA 3LISA 3U4QB 3WK7A 3NOVA 4GQAA 2BGKA 2ZTSA 2PXBA 3MUEA 3ZGVA 1OXSC 3LNCA 3FYDA 4D0SA 1R3DA 1M0WA 2CCGA 1EFRA 2CHGA 1JNXX 1ZMTA 2E4XA 3ODPA 3F8WA 3RVOA 3ZVLA 3HL0A 1PR5A 5D8DA 2LWIA 2OHOA 3BD1A 4EG8A 2IDJA 3RLFA 4F5WA 2CGEA 2H1IA 3E5HA 2ASEA 2AFIA 2Z8ZA 3T7RA 5FUQA 1NXVA 1QTRA 1V7ZA 1Y8RA 4DJDC 1WBDA 3KWMA 3ZWXA 4LDNA 3VJKA 1KA9H 1TZ2A 2Q5FA 3M5WA 3NVAA 3WWDA 2ZRCA 4LY9A 2VDVE 2CMFA 2IYLD 1RIFA 2P2LA 3EQ6A 2GRLA 2BEUB 4NV1A 4B3XA 1CZHA 1OW3B 2M6KA 5BPFA 4Z8YA 5L3RA 2NXCA 3NS7A 3AX6A 4MI1A 1VXRA 2VQSA 1Y80A 3EQ7A 3HVHA 4NL4H 4OXQA 5SICE 3RVLA 4BZWA 1QJCA 2VPYA 3AG6A 2DZDA 3F46A 4BL5A 4MV8A 3W06A 2O2YA 4EPRA 2Y2UA 3OMXA 3HUTA 2AFHE 2A30A 5IDYA 3UK0A 1IJFA 2YZGA 3VTAA 4A8HA 1CRLA 4L8VA 2G77B 2YFQA 5CLHA 4HN4B 5EP1A 4ADSG 4CMCA 1I51A 1HE1C 3OCYA 2QF7A 1SN7A 1TM2A 4P6VF 1U65A 4RCVA 2BSQA 1WXXA 2O9JA 1WL8A 4FYXA 4HEA6 1YE8A 2I66A 3EC2A 3P2JA 3CRRA 3MQ2A 3BIOA 1I3OA 4UBKA 4TQAA 3WSTA 5AK3A 3F90A 2XJ4A 4NBUA 3EEYA 3K6JA 5LQDA 2WD7A 4F9FA 3L6CA 4OH1A 1JQEA 5A71A 1GPJA 4JHLA 5DHTA 4ZZ3A 4EMBA 1ZIYA 2VNIA 3AXTA 4J0HA 2YRXA 5HRCA 4G5RA 4WUTA 4UM8B 4JI1B 2OWEA 1GVNB 1KBOA 2G9UA 3TGWA 4MKFA 2QL9A 1FMLA 3OJFA 1P1BA 2VRCD 2Y1OA 4DCJA 4HNSA 4UMFA 1P9LA 1WSDA 2WT9A 2XCUA 2I3DA 3KM0A 4FINA 1P9NA 3L0BA 3CR3C 4QPZA 2PXLA 1UBTS 3ROPA 3I5XA 4BRWA 1D07A 2PWAA 3FXAA 3VDNB 1Z9BA 4JLWA 4WGGA 2LYJA 4P53A 5K0FA 1BE0A 2WJAA 4OO3A 1PCXA 1PWXA 3QELB 1PRVA 5AHXA 3AVYA 1DJOA 1XK6A 4AZVA 4G5GA 3X44A 2RGRA 3JWEA 4RIHA 4RH1A 3DOHA 4F8YA 2PSJA 1SIOA 2PV7A 1HL3A 2XQVA 3SS7X 3OMWA 1HNXB 1U3WA 2EX1A 1QV6A 3HKBA 1MJ5A 3RFCA 4C06A 1GRVA 4XTRA 3RS5A 4P7GA 1YJCA 2DPLA 1X70A 4QFBA 1KYQA 3N39C 3TX6A 1V1RB 1ADRA 2XSZA 3OPNA 4XIIA 2JGKA 4JLAA 1N5OX 4G25A 4CMIA 5DGIA 1VHLA 1EIZA 1M1UA 5FWYA 2OECA 1UXGA 4R5MA 2GYVA 4OQYA 5KNBA 3GHHA 1FDVA 1D8TA 1L8AA 3BYZA 1C9KA 1R00A 1R5JA 4CLOB 5JAHA 2RD2A 2XB4A 1YZQA 5JY6A 2CVPA 1F2VA 1G21B 4UFNA 3RJTA 2WU0A 1VB5A 3MQFA 3P94A 3QVWA 4PZ9A 3T38A 3WGMA 4ALMA 2K6GA 3OOSA 1DUSA 3ZV3A 4HI0E 5CB8A 1GPUA 1C3LA 1SAYA 2DF8A 4XX0A 3L43A 4MPPA 2P3LA 3VC3A 4DYVA 2C54A 1LJUA 2ZVDA 1JHOA 5JXGA 5IFKA 3CR7A 2R2GA 4DQVA 1PDOA 1GCGA 1G6OA 3HA5A 1AUOA 3PKZA 5DLEA 4ZCMA 1JJIA 3DSRA 1K98A 5GJBA 5TS3A 5EHXA 1U04A 4K03A 5A02A 2OD9A 4UNPA 4TYQA 4IVQA 4JGBA 3SQLA 1BOFA 4DCSA 1NASA 1NJFA 4BAUA 4CFSA 5KSZA 3N8DA 4L50A 4PG5A 5ADVA 1JDUA 2LPMA 1RAIA 1XVUA 4TT3D 1Z3IX 2XLCA 3N05A 2UAGA 4HEQA 3T5GA 4DE9A 3SXUB 3E5NA 2O4AA 2ONZA 5H3HA 5KQSA 1BH2A 1FFAA 3VC7A 3PQCA 4B71A 1U80A 1V11A 3TOSA 2OYSA 4PN3A 1U9ZA 3FMVA 4ZOQI 1HQDA 1KARA 1QFMA 4TQUS 3SIWA 1YTLA 4LW8A 4FZJA 4LRWA 1JKJB 3ESRA 2XXBA 3B3AA 1PLKA 4BB0A 2KYRA 2M98A 4EECA 4LJ8A 5L3ZA 4MPTA 3G0BA 3KKKA 3IUYA 4I8XA 3TNJA 1AUXA 1BQEA 2A92A 5E7QA 1LDEA 2CC2A 1F6WA 5G3YA 2HMVA 4H2DA 3W5BA 1KYZA 3KZXA 4B6OA 2OL4A 2ZAIA 2GYUA 4H6WA 4IVZA 4DTIA 4KSCA 1ENYA 2YFHA 1EK5A 1MZVA 1T1JA 2HT1A 1PG2A 1X13A 2H0RA 4MWCA 2JL1A 2RAFA 1RHQA 1WHSA 2QA5A 3PA6A 2X0JA 4BV3A 2QW1A 5D2CA 4M86A 5GZ1A 1TTHA 4MUBA 4AMBA 1U7XA 3PGXA 1G16A 1YZ3A 3IXQA 3OCCA 4FXOA 2G9NA 4IJ6A 5IXSA 4WJKB 4NHOA 4Q82A 4MULA 1HC7A 4XUGB 4UVIA 2JIDA 2F9MA 4C29A 4F4CA 4AI6A 1NPDA 3AFHA 3VV3A 3AESA 1M5UA 2YRWA 3A4TA 3UXEA 4R9UC 3MGCA 1BO6A 2VDLB 3CSDA 3EE6A 3VU0A 3EC7A 2YY7A 3LCUA 2GHIA 4B40A 3HWX1 4WPGA 3C15C 3HZOA 3EZ6A 2ZP1A 3TLGB 4E6PA 3DT6A 4FHZA 1T4CA 3ZY4A 2VAXA 3JYLA 4XX1A 1XKQA 2Z2YA 3DPUA 2NYVA 4KX5A 3EZ9A 5E0KB 1A88A 3NHBA 3TELA 5IC4A 4RIGA 3IESA 4FZRA 3W8RA 1N3BA 4MUNA 1IN4A 1SU7A 5E6RB 3C7CB 4JI6B 2DMRA 4ND6A 3FRHA 3ZX5A 2HR1A 4YCLA 2IZZA 2E3JA 2OBFA 3CV3A 1LCIA 5EIBC 3BJIC 4MV4A 2GNPA 4MS4A 1EM6A 1FVOA 1ZKDA 4PEVA 5HCUA 1E94E 1H3NA 4QU5A 4LHSA 4L1KA 2YY6A 1SM4A 1I0LA 1VLJA 2DAPA 3I28A 3IAM1 2OXFA 3K31A 4I8IA 1KEEB 1CUUA 1N2IA 2P5UA 2VQFB 1KS2A 4AL4A 5I4IA 3P9YA 3QEMB 2QSZA 2ET6A 4GT1A 4YVFA 2TS1A 1B43A 2D0OB 3LDFA 2Y67A 4R3WA 2ZBDA 4MA4A 1QANA 2ZBEA 1CJCA 4B5LA 2XUFA 2W2TA 3A9CA 4I6GA 3NDJA 2HQRA 2VG8A 4XM2A 4YAGA 1CXZA 1VHTA 4S12A 4WLUA 3T41A 1FU4A 2LUOA 4G63A 4Q9DA 1T5IA 5BW6B 1CUBA 5CIQA 7ABPA 1BXRB 3NWBA 3W3AA 2WHRA 2JGAA 2CYAA 2Y68A 3SSMA 2QMUA 1E2FA 3M4NA 1LK7A 3DO6A 3O1HB 3PK0A 5CGQB 2W70A 5JC8A 3C1TA 1PZFA 1ZC4A 3B85A 3BMCB 2R47A 2FWNA 1N2OA 4QEDA 4TKLA 3P20A 1CX9B 3CONA 3KOXA 2OO7A 4JEIA 4L3VA 2GRJA 4OHKA 3JZIA 4QXAA 5BSGA 2HSDA 1ULBA 4AJ9A 5MHTA 2P1ZA 2C4TA 4YAEA 3PD0A 4Q24A 4TXHA 2R66A 4L0QA 5D1HA 3TTSA 3C1UA 3K0SA 2I6TA 2AJCA 3IP8A 1HXHA 3A70A 4JQYA 4KW7A 1KWGA 3NNDA 4KWIA 1SB8A 3JVVA 5J47A 4N8DA 3HJRA 1HLDA 4YRMA 4G2TA 2Y1DA 5LOVB 1AKMA 4S0ZA 4DWVA 4QUEA 5CLFA 2HWYA 2YXDA 5AM1A 3H9JA 4ZCTA 5HIMA 3RUPA 2HIMA 3AIIA 4XQ0A 5JCJA 2EFCB 4FEYA 4NMXB 4WN3A 1EH5A 3UNXA 1M2VA 2Q3BA 2HJSA 4G4SO 2YZ7A 4FMBB 1LLFA 4OHBA 1E3SA 1N6PA 1VL6A 4HH0A 2O3RA 2IYWA 2XWSA 2O7QA 3D7RA 1FDTA 2XT6A 3QJGA 1HI9A 3ENWA 2P5YA 3PQ8A 4FGJA 1Y3BE 2HSGA 2FWBA 4LJAA 5JYBA 4R8LA 3LQ1A 3KOOA 4MQ4A 3I5YA 1U0RA 2C2MA 3V4SA 2WVAA 2JIQA 4KQHA 4I6RA 2CMHA 1VOTA 5AI8A 3UTDA 1LV8A 4AY3A 4JYCA 3HU3A 2JJ2D 4JBHA 4G0YA 5LA6B 2PUCA 3IAM6 4PRYA 4P4TA 4MARA 1JDBB 4Q34A 5BSVA 2OAQ1 2ZPAA 2XYHA 1TJ3A 4JVNA 3R7FA 2PT7A 4AYXA 1ZD3A 2PNFA 3SBXA 2J9GA 1YSEA 3RYIB 3ZV7A 4P3PA 4QDKA 3RSCA 3TLMA 3T3NA 3DBOB 1BVUA 1GFSA 4BLUA 1P2GA 3HCBA 2FUG6 5CDTA 1C3VA 3RK4A 2ZR0A 3R7NA 5BWMA 2LYQA 4JQSA 3PIIA 2WMDA 3SYMA 4UKDA 3V2GA 4MLDA 1XR3A 2P4QA 2WG2A 3JQQA 5DWVA 2P2ZA 3FLAA 1CNFA 3V5NA 3MJHA 4IHKA 1PJTA 4AJLA 5KNDH 4PU4C 3DHWC 3VUFA 1NZJA 4ZICA 3GUUA 2JPDA 1PBNA 3EEBA 3IDOA 2BEWB 4B87A 3AEXA 2PO7A 2H4HA 5ALFA 1H1LB 2XA2A 4D9HA 3CVVA 3GNQA 4RVUA 2GO1A 1WCYA 2BR5A 3THYA 1Y9QA 4G9EA 5BMOA 1JFFB 1TECE 1ZN9A 3OF5A 3F6SA 4QPDA 4BX9A 1VDMA 1ES9A 5FPKA 3GNTA 2D1RA 5AESA 1JBQA 1W2GA 3NUZA 2X9GA 3GA0A 4IGEA 3UMSA 4BQNA 2H1LA 3HEAA 1XTIA 1BZYA 1POXA 2DPMA 2H08A 4FSHA 4I4TA 2A86A 2FZ5A 4Y2HA 2QNRA 3RSZA 1GKLA 1I2DA 4JROA 4QEZA 3DHVA 1EG2A 3JV7A 3OX1A 4GOLD 4TTPA 4WSOA 3M1YA 3RFTA 2IVZA 3AKYA 5JATA 3U7GA 4ZHQB 3T0GA 3RASA 1MB4A 4OAOA 3PYLA 4BVHA 4MO9A 1MB3A 4JL8A 3HJAA 4QKQA 3PE5A 1DQYA 3DO5A 4DR3B 2HRRA 4QJ3A 3N8HA 2CF5A 4UAJA 1P6XA 3ZNQA 5ALRA 4CUJA 4RGYA 5JQGF 3HFGA 4HDSB 1G0OA 2CDRA 4E4YA 1C1XB 3KYDA 5A6SA 3LPMA 1XKXA 4LCJA 5BSUA 4B6JA 4IJWA 1U3VA 2NQ2C 2RI1A 3R3JA 1YB5A 4FWBA 4IOMA 3TINA 1F1BA 3L92A 4ZCSA 1QBGA 4J0EA 3RANA 1LTKA 1VG9B 1ZLXA 1IQUA 2DBQA 1Q21A 2G7MC 4L3WA 4PTYA 4X20B 2O8BB 1E20A 2ZSJA 4HH3C 3H0KA 3IRUA 5IBPA 1G8KA 3RG2A 3RREA 4B7AA 2MEZA 2Z2JA 3OE7D 3L46A 4HAVA 4Z9FA 1OROA 2PN1A 2A9RA 1COWD 1FS4A 1JDPA 1YHYA 3AQIA 3COZA 3KQVA 4L0DA 5FBLB 4H35A 3WSVA 2RH8A 4K3VA 3TCKA 1QWOA 1T13A 5E8RA 2ZZMA 1NAHA 2DKFA 3HXPA 2ATEA 1N2JA 5DNUA 2H31A 1KQ3A 1DE0A 2QTRA 1QM5A 1KF0A 3GL9A 3DHYA 5IDXA 5J23A 3OP9A 4CIYA 3NZLA 4X93A 1VHQA 3TM4A 3N9IA 4FQ8A 5KJ1A 4N18A 3G2HA 4BFZA 4DGSA 5K3SA 1KK3A 3ZNPA 4B48A 5T6BA 3NM4A 1T2UA 5KOHB 1BVHA 2RSLA 1U9CA 2HZBA 1UXCA 3GT7A 4XB1A 3F3MA 4LY3A 2D1QA 4WLFA 1QXSA 3K9BA 3FA2A 4CIVA 3CRMA 2F1RA 1GA4A 3TCNA 3BL6A 4F3CA 4W7HA 1BU5A 1I01A 4V24A 1HM5A 2YRFA 1NVFA 2RARA 4C30A 3WNQA 1CJUC 1ZDMA 4JJAA 2E4YA 4E13A 2BW0A 1J8FA 4QRIA 3TTWA 1D4ZA 4LZNA 4AP9A 3H2GA 2DU8A 4P7BA 1JVSA 3G6WA 2AOTA 4EX6A 1IBMB 1SC1A 3VVMA 2FEAA 2AJBA 3Q0IA 3JVEA 4IH9A 2PMDA 2E6KA 2NZ2A 1QQ5A 1SHUX 1YH3A 2BE7A 5J4VA 4O4IB 1WX1A 3DDWA 3ZJ5A 3IP7A 1P1IA 1QQ6A 2W83A 2GSWA 4XWTA 3FYHA 4C04A 5JC1A 4DDKA 5DULA 5AHRA 4OHWA 3DW3X 1KFBB 1PU2A 1M6EX 3ZK7A 1UMBB 4NIMA 1L5OA 5JH7B 3MINA 5GM1A 2C03A 3STTA 1SHJA 4AN4A 1DPFA 1XFDA 3K2IA 1B41A 1M66A 2VXBA 2CNLA 1BYIA 1O5IA 1J2YA 5E1BA 5ABPA 3A6EA 4OHUA 2MYNA 3I2KA 3KVYA 4QVKA 5DOVA 4TS9A 3UT5A 2VRBA 1YIAA 2P75A 1YI0A 4IWNA 3EXIB 3E9RA 1U1DA 4OKNA 1F14A 2Q2QA 3KTDA 3A1VA 3QF4B 3TXAA 3F5DA 1QE3A 2EFGA 3MYYA 5F2EA 2WVJA 4TV8B 3V8VA 1Q0SA 1AC5A 4UM7A 3RS4A 4BU0A 1N9ZA 4IDPA 4AG3A 2XYPA 4DC1A 3DVQX 4OFBA 3KUXA 4J75A 4BVGA 5KI6A 1IEXA 2WJ4A 2ZREA 2QT0A 3HV0A 4J1WA 1P7VA 2SHKA 2O1XA 1ZPDA 4Y6GB 4LYHA 2RAPA 4TV9F 4H27A 3S2ZA 3P9XA 4H16A 3T7CA 3D8SA 2AG8A 2J3JA 2BKXA 2QUBA 4N6OA 4IJUA 3LHSA 2C0QA 4CDRA 2BC9A 2BMVA 3O5AA 3U6KA 2IH5A 1MAAA 3OZUA 5J4HA 2B30A 1Z0IA 5IKPA 2B3TA 3O2QB 2WUEA 2A5FA 4ZO6A 3LLVA 1IJEA 1GN9A 3DMNA 1OJLA 3FH0A 3MM4A 5GJWC 4D45A 1YK1A 2NADA 3B52X 3IFSA 4YMWA 3HY4A 4BQSA 1RZSA 1LBIA 3K0FA 4QQFA 3L82B 2JFGA 5DDIP 1RIIA 3AIMA 2O8CB 5DX1A 1T0JB 3IJPA 4S1TA 1IH8A 4AZ3A 5K8UA 1NN1A 5BUSA 1PQPA 4AT1A 4MQEB 4B8WA 4X20A 3ZQUA 1FTYA 3GZDA 3E2IA 1GYQA 2JBWA 3I0NA 4ER6A 4E22A 5I9LA 4N3NA 4MICA 5EP3A 3G0CA 3CVOA 1H2XA 2AN4A 4JEHA 2IYRA 4RQTA 2ALJA 3BIXA 3C8MA 1G19A 5ERXA 4YAKA 4I5DA 5C51B 3CCFA 4OMCA 2HF8A 1TUBB 4KN8A 1OXMA 4L5IA 3SBEA 1WUYA 3OMLA 3O1LA 3U37A 3ITDA 2H0AA 3MA0A 1F8GA 3D2AA 2QJTA 3ND7A 5F73A 2H4FA 5FPQA 3ZS8A 2WWYA 1UBKS 3FPSA 2ES4A 2J9RA 2PS9A 4OIMA 3T52A 1LPOA 4C0BA 2RGGA 2XADA 4AX4A 2RIRA 3N59A 3KDAA 4HN2A 4RHCA 3CEHA 5LLSA 3K1JA 4RGBA 4ISCA 3WGGA 4IDAA 4K8RB 5JJBA 1E7SA 3KXPA 3A9SA 4RDXA 4LZZA 3L2OB 4AN1A 3HDYA 5A3VA 4TMZA 5JNVA 1JFLA 1N7JA 3LLUA 1WNTA 3LY8A 1VMAA 3DYIA 1WUTA 4MUKA 1K7SN 2MQKA 1Q15A 1UC8A 3AWIA 4G5QA 2EJWA 1UP7A 3VVCA 4DIFA 2IIVA 2X7XA 1H9BA 2GFQA 1AV6A 4YRZA 2VDJA 3L7CA 3SYTA 1SBHA 4LZJA 4BO6A 1OVGA 3VU1A 3EGDA 2C3MA 2OCAA 2UUCB 4F46A 2ZCJA 2WP8J 1U8YA 3MGGA 1XWIA 4WLEA 1XP8A 4BRSA 1L7VC 5AOAA 2I1WA 2WFAA 2WY2D 1R5BA 2XMPA 5D00A 4U0KA 3DV9A 5ICSA 2B7LA 1PLJA 3C5CA 2LD4A 3W5IA 5K3AA 4C43A 4LF9B 5BVGA 3L8FA 2NUBA 3HADA 1G8GA 1JQDA 1OE0A 1P4GA 2HJVA 1XYVA 1S01A 2QGNA 4D0GA 4E1AA 2XLBA 2FOIA 4LJRA 4Z5CA 1BN6A 2XD9A 1Q1NA 4YG7B 1R64A 2ACKA 5JTUA 3GFTA 1Y6GA 1H0KA 2FN8A 3LJKA 3FPAA 2VA8A 3H99A 4OB7A 4N40A 1NJ2A 1YRHA 2G3YA 5EMLA 1LLDA 2RBGA 3FKSD 3OC6A 3SDBA 1ZM9A 3DG9A 3EYAA 4GX1A 5LYJF 1F7UA 1A5BB 2C0PA 2ZWMA 5IKXA 1RZUA 3UWSA 2FZGA 4DLTA 3IVXA 1UFRA 2MSEB 2XUJA 4ZCIA 2V8OA 3CRZA 3DBRB 3HB4X 4IH1A 2Y3IA 3SDZA 1H8HA 2IYAA 2MINB 4HBZA 4Z5XA 4O29A 1HNNA 2O0KA 2H48A 5E4FA 1G55A 3V8NA 1BX1A 2R8RA 4R8VA 4B3MB 1I1OA 2C5HA 4HQKA 4FGKA 1T1RA 1S1CA 3IVCA 3QMVA 4PYRA 5H16A 4XB2A 4ENSA 3KB1A 2GEUA 3GUYA 1S7GA 4KQKA 2B98A 3I1FA 5T57A 5LCXA 2WBLC 2HA3A 2J3IA 3VI4B 3B9PA 3DBLB 4J9VA 4Q6WA 1E1QD 3S29A 4H60A 3AHIA 4QDUA 4QARA 5DBHX 3K0KA 3EISA 1MRZA 4RESA 4M0FA 4MW0A 3QWIA 2HF7A 3DP7A 4LYAA 3WNBA 4HC4A 1KJ8A 4JDUA 4PC3A 4RM2A 1E1DA 1E1CB 3FYUC 3IBGA 3GARA 3PEFA 4RCZA 2JLYA 1L4BA 1NSFA 5F98A 1U2SA 4B3GA 4YRAA 1F5NA 2IE0A 2BEVA 3AOEA 3WTCA 1SWVA 3LS2A 5JRJA 1Q77A 3NMUF 2WF7A 3CTPA 2YCLA 3WQBA 4PF1A 1O58A 5B36A 4LRYA 3LL4A 4X7BA 1PJZA 5FHRA 4PAWA 2AMLA 4GOJA 3BN3A 3BZWA 3C8UA 3CPHA 4XFJA 3UY4A 1XCOA 2D2IA 3WWPA 3DE5X 2GM4A 4S1PA 3TLKA 3TUJC 3B48A 4KCGA 4EY8A 3EF3A 4GMHA 4OXKA 4DBLE 4NPCA 4E7OA 1LH0A 3DDNA 3HYLA 1UEJA 5FUBA 2WK1A 1EFPA 2YS6A 3BBLA 3E3MA 3WIDA 1U2GC 4EB0A 2ZS7A 3EPPA 3QUBA 2HQBA 3BDNA 3RIMA 5KYUB 1ZZGA 1KAOA 4GMXA 2JRLA 2VYVA 1MPXA 2VHQA 2BEWA 4M99A 1JU3A 1H3FA 2XGOA 2PMEA 3TEPA 2JFYA 4OBMA 3AY6A 2JIRA 3K05A 3GLFA 1GO2A 1CF2O 2GHRA 2XDAA 2H2GA 4Q7EA 5CYPA 4BO9A 3PEYA 5THKA 4AQDA 3TVDA 3UMCA 2IVQA 2FEKA 2W6JA 3EAFA 1TO2E 1TM7E 2I76A 2VWPA 3BEDA 3F67A 3GYBA 4ZXPA 3S1AA 3Q6IA 2IEAA 3CY6A 3P9QA 2SNIE 1JA1A 3ID6C 4R6XA 3NO4A 1W85B 1V4BA 1KOJA 3V4ZA 1IJKA 1E6LA 2Q6VA 2ZI3A 5IN4A 4B4DA 3WQSB 1KP2A 3I9JA 4N5NA 3UV3A 3X1YA 1PHPA 1NG1A 3A3YA 2EEPA 4EVIA 3N8NA 1E3QA 3CKYA 5CNMA 3TLYA 2FZCA 1WDLA 3BILA 4FCTA 5EJ7A 3IAXA 1WXHA 2Y92A 3PPXA 3ZIAD 5IVKA 2V4MA 4N48A 2PQMA 3GH1A 5JBQA 3OHPA 3SCZA 1PHRA 3RC1A 3FI9A 1XCBA 4CTJA 1VJTA 3MTDA 3Q3GE 2E5LB 5BN3B 1IOWA 1P4HA 1ZGJA 2FVYA 2IYTA 1CHNA 3DR3A 1T1EA 1BX3A 3EZLA 1OA1A 4G41A 4KR0A 1LB1B 1Y5IA 3KJHA 4PXYA 2G1AA 4NCNA 4B4WA 2O3TA 5JFGA 1CY1A 4LF5B 5T6MA 4BNIA 1CJMA 4M9SA 3L0SA 1I6LA 4RFSA 1ZX1A 4WCFA 3TJRA 4TOIA 1M1NB 1MABB 2WEKA 3MLAA 1ZZ8A 3EQ8A 3IIMA 1QOZA 4DUGD 2VA9A 2FPRA 1QKIA 4HX2A 2GMWA 1W4RA 2VRNA 3DXXA 2GPSA 3O03A 4QBGB 5FXMA 4XDGA 2V7QA 1DW9A 2WIKA 2DECA 5KTNA 2LIPA 5CB4B 2OV1A 4XCQA 3T3MB 3RTBA 4CMGA 4WECA 3WWZA 2MSKA 1M1YA 2BDUA 2PIDA 3ABSB 2XRZA 3KVVA 1UANA 2V59A 2FZEA 4URXR 5ICEA 1E6CA 2GAOA 3FOCA 2I4NA 4XE5A 1R0YA 3GP3A 1BX0A 4FMPA 1EB9A 1ECFA 1PQYA 2WHEA 3O4FA 2RB4A 1MZPA 3ILSA 3SJZA 4C0QC 1ZUGA 1JSRA 4JKOA 4JX8A 1KVTA 1IZ9A 2IHUA 3P1JA 5DPMA 3LKVA 4ZCLA 5IXYA 1US8B 2BP7A 4REQA 2Q8QA 2NNWB 3JWIA 3H05A 3RRBA 1HT1E 4JVLA 5AW9A 1JXAA 3QXXA 4FGWA 4P0QB 4DR6B 4YPVA 3NETA 1C7EA 4RETA 3RU2A 3FSRA 1Y1TA 2DHRA 3TSAA 1GL3A 3NWEA 3IOEA 4LRXA 1ZRHA 3UXYA 2FR8A 4EY3A 6CHYA 1WIZA 3FOAA 3HVKA 3T99A 1X86B 2UUBB 3Q41A 1DP4A 2R9VA 3T3IA 1X7WA 2F2TA 2OHFA 4NYIR 3D2CA 2RC6A 4G24A 1EM8B 2AMVA 5H3LA 3MWGA 7ADHA 3TQFA 5JCOA 2X0DA 4EUSA 3CVXA 3PC4A 3P19A 5LYYA 3SAJA 4F3RA 2O2DA 4QT0A 1GR0A 1PGNA 1K0FA 2ECOA 5LVAA 1R0XA 2R4QA 3EQ9A 3OLCX 1FLVA 4CU5A 3QKSA 3R4VA 2Z3VA 2A7QA 3JQPA 1ADFA 5H80A 4BO0A 4GQMA 3GAAA 4OB4A 3FIUA 1BDMA 1GRCA 1SK9A 3UB2A 2Q4BA 3ZG6A 1SVOA 3CISA 2Q4TA 1BMDA 1V8DA 2OEPA 4PCAA 5IBCA 5K9ZA 5LP6C 3HVJA 3GRYA 2AFHA 4JYMA 1UOEA 2QTNA 1UPXA 3UJDA 4QSHA 2XUZA 1JDNA 2X4IA 4CL0A 4AKIA 4PLTA 1A8SA 3GJYA 4CKBA 4IJVA 1T0IA 1P0CA 4IO0A 3EPLA 4YECA 1A71A 3H9CA 4MYSA 1Q57A 2B4TO 1T9GS 1W30A 1NE7A 4ZV9A 5BVGB 4V0QA 3KJZA 4CLOA 3PNKA 5ESRA 4KTTE 3IX7A 4PYQA 4F04A 2ECPA 3GN2A 5EUCA 4LNAA 1RLUA 1ONOA 1WLSA 3CJTA 4CF5A 1PT5A 1TJNA 2C1XA 3DC7A 4NU5A 2C7QA 3AERA 4PX2A 4W5WA 5FOWA 3FVVA 4CF4A 2V7QD 1T4BA 2EJBA 3O26A 2XZOA 1YRWA 3ZDCA 4LF4B 1VI5A 2ORED 3JQBA 3RRFA 2OKCA 3N7UA 2RH9B 2VHWA 4AJ2A 2HDHA 3HVIA 3VNBA 3BXHA 1R6DA 2AXNA 3AUSA 1PGPA 3BCHA 1VBFA 2PUDA 5HKOA 2EIHA 2QRKA 2TRSB 2EWWA 1QGED 2G28A 3CS3A 3JZDA 2Q5QA 3TW8B 5FOSA 1U6KA 3CLSD 2QTMA 4HAIA 1E9CA 5CJPA 4BEBA 5C81A 2IKSA 5FOXA 3KCNA 4MUJA 1AKTA 4DG5A 5A3JA 4CIBA 3GFFA 1W96A 3TJZA 3TR5A 3EVZA 2UYGA 2NSHA 2C7GA 2QR2A 2V6GA 2ONJA 5JAUA 2YKGA 2XZDA 5BY2A 3UAVA 1XA4A 4E14A 3OOEA 3NUQA 1EVKA 2YQZA 2BJHA 4LJ5A 2CJWB 2Q4OA 4RIFA 1TI7A 4II3A 3RS2A 1KVRA 2ZCVA 4PFSA 3COPA 4X8MA 1F9AA 5JEDA 1SVSA 1A9XB 4ZU6X 4F96A 1XRSB 1AHNA 1LZLA 3ICOA 4C05A 4BEWA 5AM0A 1YFJA 1F6DA 3PHHA 1SHKA 5M2QA 2PH3A 3CNBA 1QRAA 3HABA 2JHPA 4F7WA 3GJ0A 4IQGA 5AK0A 6YASA 2IHKA 3M70A 4DB2A 1L5VA 1CKEA 2WJHA 3M6XA 3E05A 4WACA 2X40A 1GZHB 1OU4A 2D0IA 2LP4Y 1C4WA 3MMXA 4DM7A 4KMMA 3MWEB 2I4TA 2HLPA 4UAVA 4XGKA 3EXHB 4LDZA 4IS3A 1K88A 1B6SA 1OWLA 4I81A 5K3FA 1Q5PA 4TVSA 1CJKC 3OA2A 3FTQA 4Y18A 2PL1A 4YY3B 4B17A 2VPTA 4IEFB 4WBNF 4EJSC 4OIFA 1J39A 1ODKA 2EVWX 3CSUA 3DE6X 3V6LA 4Q02A 4EGAA 2YWGA 2G8LA 3S8QA 2QNBA 2JJQA 1SVLA 1PKXA 3QV2A 4BGEA 2B4AA 3ABQB 4Q37A 4ZI7A 4INAA 4IXMA 2JCXA 4K46A 4L5YA 2C7PA 1UBGA 3JVIA 5E1OA 4TYYA 2CNWD 4EHNA 1PW5A 1Z34A 2IYZA 3G1UA 1E1RD 3M83A 4CM8B 4XASA 3PQEA 5JNUA 5HZGA 1DRWA 1TXGA 3KX2A 4R8RA 4TV8A 4TTTS 5WRFA 1EM8A 2OZKA 2XYVA 3BRWA 3IA7A 3AVQA 1L7MA 3F8SA 1HEUA 3EG9B 3OJ0A 2QPOA 1VIYA 3OT1B 1G64A 4KBGA 1Q7RA 3Q2OA 4HWKA 1E96A 1AQ6A 1EUCB 1UMKA 2C9BA 1P39A 4IFEA 4RQAA 3SSOA 4DLNA 4ETMA 4YCCA 1XZ8A 1L3IA 2R8EA 2NO4A 1NDQA 2C2XA 3DA8A 1C9EA 4B3FX 1T10A 3A6JA 3M5DA 1ESEA 4JFRA 4BLPA 7GPBA 1XAHA 1RXVA 4CKCB 3WS7A 3NFRA 1S4MA 1E7WA 1NX6A 1QHIA 4MRAA 2WINI 1Y1LA 4WZBA 1FDUA 1GZ3A 1OOEA 4X63A 5KVVA 3W9YA 5CHYA 3N5CA 2JKVA 3KZ3A 2QJFA 3I4LA 2QG6A 4JJEA 1Z39A 4ZALA 3TB6A 5JHGB 4GPAA 3MPOA 3NHPA 3SQWA 1ISJA 4MTLA 5DM2A 2AE1A 1FSSA 3QMPA 4DJFC 1EZZA 4IFIA 4B6FA 3EIOA 4HMPA 1OBFO 1YKFA 1P1KA 1PT9A 1TU4A 2Q5JA 2C0CA 3CVJA 3MNFA 2Q8NA 5TT0A 5K3BA 3VZPA 1K8RA 3AOEC 4AP6A 1GDHA 3MUNA 3DR5A 1RWKA 3RQSA 1WVGA 3E3OA 2V3WA 1F20A 2QENA 1IY2A 4N39A 3I9V6 2IWHA 2F9FA 2AMYA 1SQ6A 1WEKA 1J25A 3HFRA 4I4CA 4LXXA 4NRDA 3WL4A 4QGHA 2AZTA 1E1CA 1VYTA 1YMQA 1ZEMA 2W8BA 4ZCPA 2ZT5A 1Q0ZA 2FETA 1KEUA 2FLVA 3OKZA 2IELA 4J7XA 3DBHB 1EU1A 3H5TA 3GR6A 4B2IA 4OK6A 2FYTA 1UFQA 4YUAA 1YMUA 2BFPA 4YAWA 5JEEA 2QMOA 2DPGA 1WH8A 5AW8A 2OTCA 4X8LA 2QVGA 1U7TA 1BA2A 2X22A 3G82C 3G5MA 4G5YA 3TI9A 4YV0A 1GXSB 1ADCA 2G36A 4A8TA 3FR8A 3OI7A 3LVRE 2IHVA 1XZGA 2AYZA 4ZAGA 4KXXA 2GCNA 2J3KA 3PHCA 2ZWPA 1DT5A 4MS4B 3SU8A 4E6EA 1JR3D 4X66B 1JAHA 2ADFA 3KJFA 3ZYZA 5HNKA 1WXGA 3OU2A 4NZNA 1Z4QA 5DNDA 3PFWO 3RABA 1ZVKA 3NBXX 5EYPB 2Z5LA 4BIMA 4PZEA 1CUJA 3BWBA 2D2FA 3IQFA 3AFOA 3LX5A 1RJGA 2F9LA 3GU3A 1CEXA 1IIRA 1UXIA 4FE3A 5FKJA 3QKUA 2ZLBA 4OHFA 1XU7A 4NAVA 1TL7C 2YASA 3U16A 5IWAB 2CLSA 4LYFA 3L1VA 4URWR 2CB9A 4RTPA 5AM2A 2TYSB 3F98A 2AN5A 2O7NA 3A9VA 4LVNA 4PSKA 3HI6A 1PR6A 2YWRA 3OCUA 2ZIZA 4JFAA 2N42A 3OQBA 1NOKA 5JOQA 1D0SA 1OHHA 4ILEA 4ZC8A 5AUOB 2PD3A 4G01B 5F1PA 3EF1A 3TZEA 3NGLA 3DTVB 3BWCA 2R1ZA 3MOIA 4I4TF 4LRUA 1YR9A 4Y9TA 3R7LA 3T5TA 4CLDA 4FHDA 3KK0A 1TZMA 2XMGA 1L4UA 3HTXA 3FWYA 4E1VA 5K5EA 1S1MA 3W6OA 3HKEA 3PFFA 2IUOA 3S2GA 2R7KA 5IM4F 2PEYA 2BTQA 3O93A 4HRYA 4TLLB 3BVPA 3DLAA 3QXCA 4HQ6A 3QG5A 3ELYA 3GT3A 3ZXXA 1P62B 3DL0A 4PWZA 1TLLA 5L7YA 4XD7A 2EFJA 4PBTA 4UATA 2ZYWX 1ZGZA 3ICVA 3PHLA 4S05A 3ENKA 1MDFA 1H2RS 4PIPA 3UA4A 4O4IF 2WB2A 4D8XA 4HUJA 2JCGA 1ISPA 2O49A 1P3JA 2R8ZA 1XDDA 3JYQA 4IJKA 3ODGA 3F4KA 3KU1A 3NOQA 1CDZA 2OBLA 1RRCA 1C30A 3EXG2 3UAXA 3T5MA 1GJRA 1J8DA 2W98A 3SJBA 1QX4A 2GJ8A 4MDFA 3ZE0B 2AW5A 3LH5A 4YR9A 2CK3A 2O0JA 4AJKA 5IC5A 4RQBA 4X7RA 4R31A 5TF0A 4DUPA 3GRZA 1EVJA 4I5GA 4QYSA 2IYFA 3VR2A 1Y6RA 3GJXC 4EITA 2L1PA 2XAUA 4ZK6A 2PPLA 4LA4A 4YYZA 4JLOA 1P6UA 5EOVA 3MT8A 4QOSA 4E51A 4YUZA 4KWCA 5KJFA 3WG9A 1FNMA 3FSJX 4DLZA 3N07A 4G1BA 1F3OA 2FFHA 2BLNA 3FNEA 2VJCA 4Q9HA 2XTZA 1RC0A 4QM7A 4UPVA 3C6XA 5E9AA 4W6QA 3H4TA 1H93A 3IHTA 1V3QE 3L49A 3WAGA 3VGJA 1X38A 4RF4A 4UW9A 3T54A 3K1AB 1UM9A 3LUAA 1YTUA 1EFAA 4IIXA 3I3OA 1J09A 4W5TA 2AQHA 2GEFA 1U1EA 2P5SA 3EHDA 3S55A 1X0VA 5EL0A 4QQKA 5CM8B 3HP1A 1T4CB 1NN3A 5F1KA 1X7DA 1ACMA 4C7OB 1W48A 3GN5A 2OSBA 1UXJA 2SCUB 1LCCA 2XSZD 3FZQA 2DR0A 3M3PA 3DDHA 3EXHA 3DQZA 5LQJA 1R8QA 3JQGB 1DBQA 3CH4B 1G3IA 5IX8A 3HXTA 2FU5C 2OC4A 2CZCA 3KKMA 3IDSA 1VL8A 1KC3A 1ZCJA 2FI1A 4G6ZA 1MAWA 2N1MA 2A0FA 4MW4A 4XGRA 2G09A 3P9ZA 3I1YA 3BQNB 2ZSIA 1WVMA 3C3KA 4ZEVA 4Z4GA 4J7CA 4OB6A 2JDIA 2QTBA 5IK2D 4W9RA 1NLZA 4IKOA 2B2XA 4DHEA 1TIKA 3GLTA 3I2YX 4QLOA 4G0MA 5L4SA 1NVTA 4LGMA 2GBFA 4G8JA 3AW8A 3FNBA 1UPBA 3H2KA 1Z6GA 3M9LA 4XI9A 1PL0A 4ZWNA 4E2YA 4JI7B 2FPXA 4IP0A 4E5MA 4EDFA 4RTLA 3KWFA 4HWSA 4YV7A 2W6NA 2XTJA 1TTTA 1MTOA 2Q5LA 2PZBA 4PO9A 2CLCX 3H83A 4BGVA 2G1PA 4WT7A 3DKIA 2HRDA 2AE2A 5DSTA 5BSFA 4X1KB 1LWNA 1MQAA 3QA9A 5ADHA 3TQOA 3T4PA 1O9HA 2XMRA 5CLIA 3C16C 4H7DA 3RV3A 1LFAA 4JUBA 2BGUA 4D2IA 1MA0A 3CF4A 5F5XA 2BNNA 3DAOA 1XZEA 3Q9NA 4PGGA 5DV9A 4AZ0B 5IDVA 1U1FA 4XEUA 3ZHQA 3PS9A 1SXJA 4P4SB 3FMFA 3M1AA 4U2DA 4EEKA 1GRRA 2PQ6A 4OLFA 4QFMA 3FSEA 3TTTA 1KXJA 2VZ0A 4J3JA 4X7MA 1WMEA 1Q14A 2IE8A 3OE4A 4UU7A 2IVGA 2ILTA 2I6UA 5G53C 5HE8A 3JW8A 5P8WA 5J5CA 1L5QA 3UHPA 4QIHA 3ZU2A 1UQTA 1KAMA 2FJUA 3HO8A 1NC3A 4ZVTA 4PANA 4ZYYA 1U1IA 2SKCA 4HTFB 3SJUA 2L2QA 1I9GA 1NW3A 1OMOA 1EHYA 2XIQA 3T3PB 1CPYA 4E5KA 4OQLA 3EUEA 5B2ZA 3SF0A 1TDJA 4CRWB 3IAUA 2PKQP 3ZHZA 5LA6F 3NROA 2VDKB 3H9QA 3LOQA 3NEJA 4RA6B 1GPNA 5BP7A 4ZEWA 1QHSA 1AV7A 1QK3A 4L9WA 1UZAA 2R8OA 3A4LA 3DZBA 3F7NA 2JLBA 3PDHA 3F51A 1A72A 3G0DA 3MSXA 1VE1A 5IAKA 3GJ7A 5HJ5A 1T8RA 1YDEA 5CYFA 3NI2A 4ZVOA 3MTQA 1LRLA 2ZAOA 2PY6A 4XYGA 2Q50A 4BLVA 4YAOA 1KI6B 3OTGA 4RORA 4AM8A 4CKBB 1BXGA 4PM4A 4NDWA 1UADA 1R4NA 3E18A 1C7QA 4AUMA 3AI3A 3AF0A 3ZCXA 2JLQA 1H4QA 4ER5A 4Q1VA 2O3JA 1I7PA 3ZW9A 3EA5A 4IV5A 4J0CA 4ZVUA 4IOJA 4B80A 4TUYF 3UHAA 2GERA 4KBYA 3ML1A 3AR7A 2P2YA 2V97A 2IX3A 5KYVA 3L4EA 1BU8A 4LHYA 1EXVA 3AUKA 3GEHA 1GZDA 2ICAA 3NCTA 5HKLA 1Z5WA 3IVMA 1U0SY 3AJAA 4LV6A 4XVCA 2ZRQA 1FXWA 2B3DA 3QVUA 1NP3A 3BKXA 3LT5A 2ZM5A 1OIWA 2UYYA 2HBZA 2B20A 3I4FA 3EVNA 4W63A 5AVYA 3PGMA 5JD4A 1JLSA 2PTHA 3OY2A 3CUEF 4IOKA 2YWHA 3B60A 4FX2A 2BFOA 3LVQE 3ORHA 4ZQFA 2ZSDA 3QVSA 4C6SA 4GPTA 5HJEA 2B4RO 3LU1A 2H7YA 4X00A 2C5BA 3PCRB 3LKBA 4DMHA 3DCNA 4HDRA 4S04A 3R1IA 5ER6A 3TTXA 4DUZB 5DTQA 5TVGA 2Y1EA 4Y98A 1W87A 2DUUA 5JPCA 3SNKA 2O0MA 2UUAB 2PL9A 4JA2A 4GOKA 2H7CA 4QUIA 3B9RA 4IWRA 3WJAA 1UMBA 4MUEA 4DL9A 4F5EA 4DIKA 2ODBA 5JH7A 4OB8A 4QPNA 2FQYA 1QYWA 1JHYA 4G5SA 4IW3B 3DWGA 1G20B 3KKEA 2GPTA 1ONPA 1P2DA 5H4GA 4QQNA 4GBED 1OLXA 2O1SA 3RIYA 3W2EA 1C9NA 2P67A 3H3FA 3MJSA 3QJYA 2HKIA 1VTKA 2NSLA 3ECSA 4H7KA 4O1HA 1KI6A 4YP5A 4ZO9A 1TF2A 4XQCA 5A5VA 1SOAA 2O05A 4HVLA 5ALVA 1JYEA 1UZLA 2Y99A 1LBHA 5EWMA 5TMDA 5KYWA 3ILYA 3LIPA 3D4OA 1VA5A 4F8DA 5EE3A 2P6OA 1XCPA 2X4DA 3AJEA 3I76A 2AFIB 2O5VA 3DOEA 1HTWA 4RHYA 2PXPA 4K9PA 3T5DA 2NXWA 4AJ1A 1A9RA 1Q84A 5JFTA 1IB6A 2H1CA 1T34A 3K9FC 1RIOA 1ZJ6A 4Z53A 2XMZA 2GTPA 3PQ5A 3NANA 1UOOA 3EK2A 2RJNA 1E3WB 4IIYA 4CG0A 3ON5A 1U98A 1CQJB 3MK31 2E4ZA 1QVWA 1N8TA 1X7ZB 2PSFA 5BR1A 2ZE8A 2NVUA 4KXLA 1AO3A 3OUUA 4ZTUB 3A2LA 1IY9A 3E6AA 3WIUA 3UV7A 1AH2A 2H6EA 3BWDD 5G41A 3W8DA 3F5FA 3L01A 4IHJB 4JIGA 1JDTA 3A26A 4K9QA 4C7MA 4CODB 1EX6A 4OHMA 5AK6A 2Q28A 2QN2A 4TKUA 5K05A 5KNCA 4Q03A 4QUHA 1W75A 4UXHA 1QS0A 1UPTA 4QJBA 3V8PA 3KBOA 2CV2A 1RPJA 4BFCA 3M6UA 5KPDA 3OA0A 1L7OA 3QU2A 2AK2A 3DL7A 2JZNA 3AHFA 3EZFA 4J3NA 3L0OA 4MJ3A 5FA6A 1DMRA 1P7CA 5F35A 4CIWA 1DQSA 5I9TA 3VKUA 4EJSA 5JYCA 2C8KA 4MVJE 2ZKIA 4ALLA 4FS8A 8ABPA 4RCYA 1WR8A 4KEAA 1V2GA 1YQUA 3F47A 3N6VA 2R1TB 1UCFA 1P0FA 2P41A 4N0PA 4PC1A 2OYCA 2F8SA 3DVAB 2IPXA 4RIEA 4QDXA 2JEZA 2WAMA 1XZFA 3FJYA 3H8WA 5FTMA 3VKVA 5ULLA 1ZVQA 2PVSA 1RYDA 1EDZA 1KIAA 4E3WA 5C8YF 5KQLA 2B5VA 4MW7A 1N8NA 4X61A 2JD2A 3HGMA 4IA8A 2D5LA 1TJPB 2PJUA 1ESMA 2PRSA 3CQ9A 3PGA1 1F8UA 3B1XA 1C81A 4KRFA 4F5ZA 3O8CA 1Q0LA 4CV1A 4L95C 1JR4A 2D06A 2DHCA 3ZY2A 4BB6A 5BNIA 4XJXA 5EA2A 4AJPA 4TT8A 2PWYA 5FPHA 4F3YA 5H1YA 4X4BA 3C43A 3N3BC 2O8DA 4DBLC 4BNYA 3PLAE 4MQFB 1LPSA 1B7GO 1CRWG 1R3UA 2O0LA 5A3QA 4YCSA 1J20A 2HNBA 2AB0A 1OFGA 4L74A 5AW6A 1KHHA 2PJDA 2DQSA 4BLQA 2H9AA 2HPZA 5TRTA 1NVMB 4FP9A 2WNIA 2CE7A 4E5DA 4BHTA 2YOFA 2NTNA 3X2SA 3NVDA 1JMYA 1W0JD 3JQ9A 1S9HA 4J0GA 1NW4A 1U94A 1S3GA 2HCRA 3SYKA 1HMPA 3ISTA 3QEMA 3SG0A 3WOHA 1P2VA 4HH1A 3O8RA 1L7PA 1FSGA 3F9CA 4QO7A 5IZ4A 3C6KA 3LBHA 2FW9A 3EUWA 4H31A 3FMGA 2JFHA 4B9AA 2XUIA 1T2DA 3K16A 5DI3A 3G0HA 4WCDA 2X8JB 3RYHA 4LMAA 5GZ6A 3QVKA 1FQJA 1QP8A 5HBGA 4FE7A 2TSYB 4JBLA 5TNXA 2BZ0A 5FL7D 4UHKA 3A6PC 4JAVC 3GLIB 1TA0A 2DBVO 4I50B 1FPQA 4RK0A 1Q3HA 3PL1A 3WB0A 3L6RA 2JD1A 3AVTA 2QVZX 3P52A 5ALOA 1SUSA 2DH6A 2Y1WA 1PJ8A 3C3XA 4POOA 5EUMA 1O95D 1HDGO 1NMXA 3K73O 4H0CA 2MINA 4DA6A 5A5GA 4D1YA 3H5LA 5DN6D 1EIWA 4JBWA 4IDNA 4RHEA 4B31A 1K08A 2QTAA 1REQB 4GUDA 4ZKDA 3BHJA 5SYNA 2FKAA 1QOQB 2JCYA 2ETXA 3UK6A 2XQIA 2ZJ6A 2EERA 3ISJA 5K4GA 1I3MA 3LF2A 5AM4A 3ANNA 3KJIA 1W47A 3OSUA 5H5JA 3WQQA 4LJKA 2O8EA 2RGNC 4EW3A 4MRPA 1DFGA 2R96A 1K7CA 1LWOA 1Y1RA 2ACVA 2QYTA 4YDRA 4YRFA 3GMSA 5AKZA 2WWVD 4NJEA 3VTKA 4EJFA 2G88A 3NBQA 4C78A 1YQ9A 2SECE 4WKOA 4MV1A 1SQ0A 2W4IA 1MNQA 2B6NA 3EYWA 5K51A 4G0QA 3EEOA 3VH1A 3HFJA 4DT1B 1FVXA 3AP2A 2Q1YA 3J80A 1JHDA 3GUZA 5HQ3A 1ZWKA 2LYPA 2JKYA 3MGBA 1LZKA 1E59A 2P9ZA 1H0HA 5B57C 1LQCA 1P44A 5JIBA 2DM6A 1E4EB 4IYRA 5HM8A 1SELA 1X8KA 2AOWA 1XZKA 3VZQA 8ATCA 5K0ZA 4K0KB 5FB3A 1T9GR 1ORHA 1W25A 2CXOA 5KB3A 4RJ2A 3TZ6A 3SR0A 2F64A 4PGAA 1HZJA 4JB2A 4QJ4A 9GPBA 2QDXA 1GTSA 4OKIA 1ZOPA 4P54A 3PFBA 4R84A 2QWXA 4URUR 4YS6A 5IANA 2A33A 2ONCA 2EFEB 2HBQA 5G4KB 3VPHA 4XFKA 4X91A 1XELA 1RHUA 2QAJA 3IV7A 3FTPA 1UWKA 3QPDA 4CYMA 1NYTA 3CLRC 2QRMA 3PC3A 4EYOA 4ETNA 3ZW8A 3NT4A 2F3TA 1JDBC 2OZVA 4IINA 3EASA 5BORA 1G6KA 4GHJA 1N2EA 1A7AA 4WJZA 4S1OA 1JEDA 4L5AA 1RYMA 4LGYA 1BDHA 4CHTA 1B6GA 1UBJS 2QXTA 3L4SO 3R3WA 1JJFA 4L9SA 5DEIA 3DDUA 3WGVA 1EYZA 4FFVA 1W29A 2VATA 3FWPA 3VX3A 4F3NA 2HXSA 2H65A 2IU6A 1SCDA 5IJ9B 3VYVA 4DJJA 3NNSA 4PSDA 4HV4A 2ZTLA 1GGMA 1SXJC 4MIEA 5JSUA 1QVZA 4GZLA 4TMFA 1GCOA 3BIJA 2EV9A 1U0NA 1W85A 4IFTA 4KN5A 2PXKA 1BWSA 1QIEA 4TM7A 4DC0A 1CERA 5ITWA 2EBUA 2ZSBA 2D7CA 2ATCA 1GL9B 4IRUB 1EBBA 1Y3FE 1Z12A 3H19A 3Q8XB 4JVSB 4OQEA 4WV3A 3V8MA 1C4OA 3LT2A 4KR6A 5K2MA 1QGUA 2H5JA 4LTDA 1XPRA 2ODWA 2XVZA 1GL7A 1JU4A 2B25A 1PTJC 4W8HA 5BSRA 2C4MA 5K6AC 4HJRA 3PXAA 1LKZA 2NNLD 4UD6A 5AWFC 2WKWA 5KNBH 4C4PA 2YXPX 4UQOA 2D3WA 1F2TA 1YE5A 2YJ5A 4YDSA 3LQFA 4MR9B 3VU8A 4HS9A 5JMOA 2RIPA 2QD1A 4IWYA 1COZA 1KQGA 2C5GA 2C8JA 1H8ED 2QSYA 1NJ5A 3GGJA 5CK5A 3WBKA 7AT1A 4QGAA 3FKSA 2Q2OA 2DH5A 5AM5A 5F9HA 4KAFA 3JARB 5DHRA 1TO1E 3M34A 4JODA 2NP7A 4U5XA 2J32A 3R6TA 4D81A 4TMXA 2I87A 4JJ7A 4INOA 3FVQA 2LCVA 5FNVF 4FXPA 1BGWA 1YK0A 2JAQA 3KJEA 1E2PA 5BN5B 3UUWA 3ZY3A 5C8ZA 2QRPA 1H8HD 1GAQA 5NULA 1Y8CA 1OPXA 2XDWA 3HSKA 1N5LA 4PBRA 2CJPA 6LDHA 1A9QA 1XGKA 2XVAA 3IUNA 4Y1EA 3BSWA 2Q62A 4EFMA 2YN4A 2A0YA 1ZD9A 2D74A 1IM2A 2IXDA 2PLNA 1QIJA 4EB3A 1R0ZA 1SG6A 4I14A 3OFND 4F97A 2CLEB 4DMLA 2GN0A 4DHWA 1N2GA 4C0AC 4XVRA 1HLFA 2CNKA 1GNRA 1W76A 4HYTA 5B7GA 2YC2C 4DR7B 1GZ5A 3E4CA 5SZIA 1EBFA 3D64A 4DRXA 3MCTA 1V43A 2H59A 3NV9A 4HD8A 5LPNA 1LC0A 1GHTA 4BLWA 3HB7A 4NU8X 4DA4A 4O4LF 5GV8A 4FYWA 2IA5A 4XQGA 3SICE 2GTHA 4GOMD 5FR2A 5KQPA 4CQMB 1Z6YA 5FWXB 2BBWA 5T4EA 2NQ8A 4MV6A 1XZQA 2P5TB 3H11B 1COWA 1A27A 3QP9A 5IYZA 1Y9AA 1XB2A 1YC2A 3NLLA 3O91A 1AM4D 1YVRA 1MO5A 2O1EA 3UF0A 3MWYW 2IGTA 1YS6A 2IX9A 1XDUA 4L0CA 1GILA 3LCCA 2HNAA 4Z2YA 1IWPB 1V96A 5FOQA 5ICMA 5M5BA 1SXHA 2MWMA 2V54A 4LVCA 3IUPA 1ZONA 4O63O 4RS4A 4ZK2A 1ZD4A 4IWXA 1YZYA 1CDOA 4D97A 3FCYA 3QYJA 4QAQA 4BX8A 5KQGA 2GF2A 3PQDA 4CDNA 4IVPA 1RJDA 1GAJA 3AM1A 3GGGA 4MYRA 1Y3AA 2HPHA 1MA3A 2E48A 2XOKD 1DDOA 4WLNA 3KETA 2YV4A 1Q7GA 2ORIA 1OJ7A 5C4MA 2FSVC 2PZAA 4OYYA 4BN0A 3QVJA 3N6RA 2ZROA 1C0KA 4YV1A 5CVDA 4XCXA 2LCFA 4KNVA 4X1OA 1U9YA 5JPIA 2HI0A 3QNWA 2ABWA 1J70A 5K3FB 1L5HB 2XRYA 1F0KA 3QXJA 2JCBA 3HE3A 5A5EA 4JQCA 3NJ4A 1DBIA 3NATA 4OLJA 2XQKA 1E1YA 4OP1A 4EMTA 4N9WA 2OK8A 4ONEA 1VMEA 1ZRNA 3GQBB 3WLRA 1G4AE 1M0TA 2VT2A 4R7ZA 3UYLA 4Z4QA 5K01A 3GEMA 3O3MB 3VZBA 4DRXB 5ALYA 2ZUFA 2YZNA 4M1YA 4DA9A 4CNQA 4K05A 2Z0MA 4GUAA 1CZRA 3OIVA 3O9ZA 4IICA 4NQZA 4JT4A 1Z25A 1OIVA 3M33A 1EWYA 1SFRA 3RBAA 1U4OA 1ZINA 3BXFA 1ISGA 4POAA 4CQMA 5JPDA 3BGIA 1ZUWA 2PUWA 4JUCA 3VYSB 1XIVA 1KP9A 1VCOA 2QU8A 1Q44A 3KAKA 2PZFA 2GXSA 3FHJA 1P31A 1US8A 1HFWA 2BP7B 1XDBA 3KB8A 4TLCA 4MOWA 4Y2GA 3TW4A 4XYLA 2CSXA 2JLXA 1X1RA 2LW7A 2YWCA 2VRCA 3W3AD 2GM5A 3WWOA 3ECCA 4CM5A 3HDGA 1XN4A 3PUHA 4NAUA 3WKAA 3F6YA 2XCSB 1DX4A 2TECE 1VKNA 2PX3A 2CNOA 4X4GA 3QW4B 4XGIA 5FUXA 3HVRA 1NY5A 5KHAA 1YL6A 2OT3B 2P0AA 1W59A 3IKJA 3M4YA 2G70A 3BCSA 4P5DA 4A2PA 1AS0A 1KE1A 3QF3A 1KJZA 2WIDA 2NUTB 4YJFB 1V37A 3BGDA 2OESA 1OFUX 3LPCA 4B43A 1HDOA 4IFBA 1A76A 5AJZA 2IH2A 1RC1A 2BEUA 2I78A 4WUVA 4R1NA 5EKSA 1PK8A 1UPFA 1X9IA 4YPFA 3EGC