4ER8A

Structure of the rep associates tyrosine transposase bound to a rep hairpin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
165
structure length
165
Chain Sequence
b'MSEYRRYYIKGGTWFFTVNLRNRRSQLLTTQYQMLRHAIIKVKRDRPFEINAWVVLPEHMHCIWTLPEGDDDFSSRWREIKKQFTHACGLKNIWQPRFWEHAIRNTKDYRHHVDYIYINPVKHGWVKQVSDWPFSTFHRDVARGLYPIDWAGDVTDFSAGERIIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TnpArep for protein
publication title The processing of repetitive extragenic palindromes: the structure of a repetitive extragenic palindrome bound to its associated nuclease.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein/dna
total genus 51
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2012-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 4er8A00
2EC2A 2F4FA 2A6MA 4ER8A 2VJVA 2XQCA 2VJUA 2XO6A 2F5GA 2XMAA 2VHGA 2VIHA 2XM3A 2A6OA 2VICA 2FYXA
chains in the Genus database with same CATH superfamily
3NGRA 5KFVA 3LP2A 4OV1A 1R89A 4P72A 2AYBA 4N76A 4ZVPB 1SCJB 3THVA 4IRDA 3FSXA 1AFIA 3SQGA 2N7YA 3IR6B 2ZEJA 4RO0A 4BWJA 4KIAA 3DRXA 4X84A 1BMQB 5J2MA 1IQZA 5L9XA 1SQEA 2D3ZA 3GONA 2PN6A 4KHRA 4ED2A 2HNYB 1SKWA 1V5IB 3ZZTA 3OVSA 4DV3F 1GFWB 4DSFA 1TKTA 2DHSA 2CWKA 2HZAA 2MQLA 4J9KA 2RQKA 2B4UA 3NXZA 3OHAA 2VG7B 3CCMS 1U0SA 4ZCMA 4OHYA 5LMUJ 4WIQA 4QIFA 4CP5A 3DGPB 3R2CJ 4GKJF 4PABA 3H5SA 1RT5A 5D4LA 2AX1A 2ABYA 1A0OB 3DOMA 4F2RA 2EFPA 2LQJA 1M1KT 2FVPA 1NAQA 2I5JA 3SSQA 4NCAA 1FX4A 4NASA 2C2EA 5IV4A 4WYWA 3HLUA 3RRHA 1LWEB 1S0VA 6FDRA 4EYHB 4Y2KA 4JYAF 3ZTSA 1EETB 3POTB 3LPYA 4DG1B 1JJHA 3V4IA 4N56A 3IXQA 1Z4UA 2AEMA 4Z37A 1VR6A 3LALA 4WTOB 1S48A 5EWFA 2XO6A 2DY1A 5F0WA 4TNOA 1IKYA 4XPEA 3HKZD 2CQHA 2JDJA 1HA1A 4CLFA 3CF5Q 3NAHA 1QE1B 3QNWB 1CBKA 3M8PB 2VG6B 4ZDNA 3TJAA 2BJEA 2BE7D 2I2YA 2FD2A 4F67A 2E5JA 2QEXS 2Z2ZA 1HYSB 3BREA 4I69A 1KR4A 2H9ZA 4OYMA 5ETTA 2BJ8A 2UXDF 5KFDA 2HGMA 2QFJA 4NLVA 4F36A 5L8RC 4DUZF 4GVBA 3GJSB 3OLAA 2HQDA 5E7OB 5E3CA 4O0NA 4ES3A 2JFKA 4ECUA 2E9RX 3A13A 2C2ZB 2PMHA 1RCOB 4DL5A 4QCLA 4WU3A 5A8KA 1M0SA 5HBMB 5L38A 3P5TL 3UCGA 3HP6A 2CPJA 3KHHA 1N5VA 4KRWA 4F0HA 1JLQA 1QSYA 2RVJA 2R3VA 5A76A 1C1CA 1HBNA 2YH1A 1FNMA 2OMLA 2YNGB 1WC3A 1N5YA 1FI4A 5C25A 2YKMB 3GYGA 5EN1A 5HP1B 2G2OA 2XWYA 3KDNA 4NA3A 2W4DA 2DKOB 1IKVB 3W62A 1EQ0A 2R8GA 2F8EX 1KKHA 3OFGA 4UT4A 3BR8A 1SL2A 2F8MA 3DFEA 2DYAA 2BKOA 3A8EA 3Q8RB 3HJVA 1WSRA 2Z57B 2FZKB 2IVFB 2PMZD 2ROEA 3TWZA 2AHOB 1FESA 2CQ2A 2VV5A 1QAXA 4F7VA 1D1UA 4B9NA 2YWGA 1KFSA 2FY1A 2M52A 4P6QA 4CO3A 5K8OA 1S0MA 2M8HA 4E2FB 3SXLA 4MK8A 2Y1LB 4CRJA 7AT1B 3LUYA 1TAQA 4TN2A 3MCMA 5EX0A 3R27A 3VQSA 1AUDA 3TVZA 5K8MA 3GJQB 3EZOA 2XTJP 3S8SA 2OEKA 3QO9A 4JBCA 3AHPA 4KHPF 1UA0A 1TL3B 1WDTA 2DIUA 3PKMA 4O4GB 2EFOA 2Q3PA 2W8LA 1SXLA 2RMLA 5IC4B 1O5JA 4B9TA 2BW7A 3PV8A 2X51A 2CPIA 1FTCA 1RAAB 4WU2A 4IH6A 1AROP 3MI7X 4PEOA 5KFCA 4Y2IA 1E6YB 1FEHA 4UOGA 3BBBA 4UZCA 4USIA 1SJQA 5J1NA 2H5IB 4DSEA 1NSKL 1RYSA 2W7PA 1UETA 2GCFA 2QE5A 3TUZC 4J9MA 3GCXP 4YFUA 5B0FA 2XCAA 2G4BA 3D0GE 1X5SA 1EP4B 1O8BA 2BE9B 1BWVA 4S0MA 1C0UB 3P5BP 3MTKA 1NK0A 1QUVA 1CJKB 2NREA 1T9XA 2I1RA 4CNZA 1XN9A 3KG4A 3JTOA 2GC8A 3TJ9A 4K2JA 4DV0F 1OYDA 3GFHA 3DRYA 4WP9A 3M8WA 1RHJB 2VKZG 3AJ1A 2MB0B 3PDNA 3EDRB 4AL6A 4PQUA 5J2NB 1ACMB 3TO8A 3HK2A 1N36J 2CPYA 1CQMA 2DGXA 2GGPB 4RUCA 4FF3A 2GAHC 3W5XA 4DR6F 4DR1J 4OI2A 2M7SA 4DMZA 3J81Y 2KXNB 1KOOA 1NSQA 2NPFA 3Q24A 2MKCA 3O6QA 3BKUA 3UI3A 2PT0A 2MDAA 3T19A 2YNIB 3LP0A 5HMYA 4MKYA 2VL1A 4M5KA 2KHCA 2V4JA 2MZSA 1HMVB 4LSNA 2ZH5A 1XMOJ 3RR7A 1VQ7S 3D67A 2M4MA 2OD6A 2J0WA 3CGIA 1T05B 1QLNA 1M5HA 1NEEA 4M5IA 3HSDA 1X7VA 1CVJA 5E0OA 2CRLA 4MT1A 3SV3A 4ZPTR 4YEAA 1ZAVA 1N52B 2B9WA 4PG6A 3OBIA 3CCJS 4BLGA 5FDLA 2QZ8A 5B7WA 1REVA 1HARA 3HX9A 2WONA 4IFYB 5HI7A 2ZJPQ 4RW8A 3QRQA 4LIRA 4B3TJ 2OSRA 1RE1B 2RSQA 1GEHA 2EG1A 3T1AA 4KY3A 1DQ9A 3I0RA 1S6QB 4HHUA 2GHVC 4KFBA 1YRTA 1VDHA 4IG0B 3FEYB 2UXBJ 3EXYA 1Y3KA 2HLUA 5E2QA 4Y3CA 2DNRA 4CZCA 2DR6A 5JJBA 4ZA1A 1U0HA 3B82A 2R2UA 5KFTA 3ZNJ1 2OFHX 4LVOP 2BRLA 1AZSB 3HFKA 1CPZA 4RUBA 4ER8A 3FFIA 1SH0A 3GIIA 4JI6J 4B3SF 2AEJA 4NL5A 2X7IA 3KK1B 2O01C 2R7VA 1ZZFA 1HWKA 2QGFB 3M9MB 2DR8A 1AUSL 3BN4A 3PW0A 4RNHA 2GO9A 2OPPB 2VFVA 4QJVA 3PX0A 1IWAA 4OYZA 2V63A 1X5TA 1SC3B 1R0BG 4O3SA 3CTRA 3CCSS 1LKZA 2GMJA 1S49A 4DR5F 1JLFB 3BM7A 4ZP7A 2CIMA 5D3GA 4ED3A 5U47A 4DV4F 1WJ9A 4DU7A 1H72C 1CS4B 1FRXA 1Q16B 2YY3A 2HGNA 1TL1A 3GIJA 1H74A 3I4PA 3NP5A 2CZ9A 2LDIA 1BQMA 2W2PP 1QSSA 2GQQA 4DV5J 2ZITA 3CCLS 2IVYA 2VPZB 1RWNB 2E5LF 4LSLB 2D9OA 5ETSA 4F02A 4CO2A 1TKZA 2CPZA 3MEEA 4ALZA 2PE8A 2MLZA 5LXYA 3ILIA 1S59A 3NS6A 3BH6B 3V6KA 3ZTOA 4YB5A 3CIMA 4ECZA 4C0HA 2XG8A 3S7RA 3MFHA 1LK5A 1DHMA 3ZZYA 2RIJA 3OTOJ 4MMOA 1WHXA 3L95X 1U6FA 1RZMA 1WKLA 1P8GA 2IFXA 3C8YA 2N3LA 1T0TV 3IRXB 3OSPA 1TELA 4ZHRB 1QTMA 2J7UA 1T9VA 1K44A 1S1XB 4PAAA 2QA1A 3DLGA 5KT3A 2AIRB 5K8NA 3KK2B 1M5OC 4N77A 2DPJA 2AEFA 5J1EA 4NCGA 4WBFA 4G6VB 2ASYA 2OPQA 1JLGA 4LF2A 1YTYA 3P8BB 3H59A 4ZPCA 2FC8A 2GAGC 2ZM6J 2HK2A 4R5PB 2R8IA 4TY8A 5G0RA 3R5JB 2YX7A 2GHPA 2WSCC 2L9WA 3EICA 2H65B 4HT7A 3TEGA 4B3OB 4IOAQ 2CPXA 4DQSA 1UL3A 2QV6A 2MY7A 1NJWA 3GFXA 4NPOA 4CCHA 4JV5J 1X0PA 1FD2A 1UVIA 3M30A 3T5HA 3LH2S 4DL0C 4C11B 1KP6A 3FDSA 4L3NA 2VH7A 1ZTTA 5KG3A 5HROB 1H0HB 1NB7A 2B51A 1QTNB 2V67A 3CCTA 3HXMA 4IG3A 5D4OA 3D3BJ 2MJUA 2W24A 5M2PA 1GTHA 4MKAA 2MXYA 3FZBA 4QWDA 2HW3A 1KHVA 1MWYA 1X9WA 3KG0A 3S1TA 1VQSA 4LR9A 3T41A 6AT1B 2VOOA 1PYTA 4FXDA 4K5SA 2EKYA 3EVMA 3V81B 2G2ZA 3JSMB 3GG1A 3LF0A 1H2VZ 5AJ3J 4D3HA 2IMWP 4DSIA 2DNHA 1UVJA 1VYAA 2X1BA 3CJ8A 3MAAB 5A8RB 2IBOA 4JI8F 1CQNA 1G7CB 4ID8A 1UEKA 3CMES 3CD5A 3PXGa 4FYVB 1HNZF 3I9V9 3D28A 4HDGA 3NNCA 3ET6B 5H1SV 3MR2A 4OYOA 2EC2A 3GZ7A 4LF4F 2DISA 1X5OA 3M32A 2P9CA 5CYJA 1B70B 4Q44A 2ASDA 3MR7A 2CADA 3BSCA 1NHKL 4B02A 3PY8A 4I2PA 4R0EA 3SCKE 2BDPA 2HFVA 3HSGA 3R7BB 4ZKAA 1VJWA 1X5PA 5C42B 3A8JA 3CC7S 4DR4J 3TI0A 2O1PA 4X4OA 1Q82T 1WC4A 3FBFA 1RP5A 4C7QA 3UNGC 2Z8QA 3HSZA 1LXJA 2W1BA 4K4YA 2D3O1 1TV6A 3O1LA 5L9NA 4OYBA 3K5NA 5CYMA 1RABB 2HMIA 3NOCA 4ICLB 2C3PA 2K7KA 2YNHA 2HZCA 1UWBA 2YKNB 2B9EA 2J9DE 2I6WA 1JLBA 5I42B 4CLSA 4ECQA 4URGA 5K20B 2W9CA 1I6JA 1HLWA 3C14B 3DDKA 3KJQB 4J5OA 1L5UA 4DPUA 2IA0A 2GZOA 5KG0A 1NXIA 1VQKS 1BXNA 1CJUA 5LM7E 3H5YA 1N34J 1MN7A 1RAEB 1WORA 4DPOA 4O3RA 2L3MA 1X4EA 2WZ1A 3UN5A 3KLIB 4WTYA 3KLGB 3QGGA 2NSBA 4GKKF 2RRAA 2HQIA 2ADBA 1G2EA 1UAWA 2HNDB 3BPDA 1BE4A 1U1QA 5HQ8A 3E01A 4JI4F 3I6PA 2DB1A 4I0WA 1VQ6S 2Q6CA 1IN0A 2RU9A 2IYGA 1FXDA 4W90B 4JI5F 4IRKA 1R8AA 1I5OB 2FJEB 1LWFA 4ZVGA 4BC7A 2Z2MA 4ILLA 4QR1A 3G4SS 4OI0A 2EFQA 5M2RA 2VASA 4DR3J 3NS5A 1D8YA 3I31A 2CPHA 3OJSA 2E1CA 2HS0A 3KG1A 1S5ZA 3X1LB 3EX7B 4M5NA 5KFJA 1SC4B 3OVBA 4NZ0A 2LQ8A 3PX6A 4LF6J 1JLCA 3TAMA 4ZLPA 1PBAA 1Q7LB 3OD2A 3V4MA 4DZDA 5A0YA 5I3UA 3M05A 4PWWA 4HI1A 3ZTQA 2X1AA 2K3IA 2NZCA 2IM0A 3VAKA 1K8AT 1E6VB 1RHKB 4JI3F 4ANCA 1RT3A 3MM7A 4LQ9A 3FQLA 1WOPA 5I3PA 5D0GA 4O3OA 1SV5A 3PJWA 2CNNB 2BACA 1YBTA 4EBEA 1YBUA 1RTJA 1YJTA 2W7AA 3OL6A 2FLNA 3AFGA 1PJ5A 3PW2A 1S57A 3CJRA 1GXUA 2DGTA 1NK9A 4K2XA 4DLEA 2MQMA 1MW7A 2G13A 1ZTWA 2XNRA 4H4OA 3VAIA 5DETA 2FZGB 1DLOA 1FK9B 2JX2A 4Q8FA 1N32J 2JJ4D 2QMWA 2F4VJ 3T1YJ 4KO0B 4X64J 3P6YC 1CLFA 5IM0A 3DKDA 4TQRA 1S77D 4A8WA 2OTLS 3NCQA 3MR5A 3N6MA 4DI6A 2OEMA 4DFMA 2R4FA 4FXWA 1B4SA 2G0CA 3Q23A 3P49B 4B3RJ 3AODA 4YY3J 2AGQA 5HANA 3MMCA 2ASLA 2EK1A 3MMAA 4MIAA 4YOEA 4DJBA 4CO4A 4B9VA 3EPGA 5ITHA 1JLAB 4PWDA 4M8LA 3B6BA 3DNCA 4RL1A 1HW9A 1HBOB 2K7JA 3P3DA 2IMOA 1AA1B 3KOAA 4OMFG 4YHHF 1RT6B 1NK8A 3J81U 1PAUB 1VOMA 2R7QA 4HL9A 2RDDA 4JV0A 2W4PA 4D3GA 2XM3A 4GC7A 2L9DA 1RT4B 4LRBA 2KH9A 2FLLA 3UD4P 4CLTA 3R5DA 4PCQA 4C8MA 1YVFA 3LP2B 4EFAC 1DJ0A 1HPZB 5ETMA 3K5OA 3JQKA 4UUWA 3SQGB 4P7TA 1FO1A 2PI5A 2MLYA 2K3KA 3Q8VA 4DDFA 5EUHA 2ROGA 2HHUA 3BB5A 3UD3P 1XTZA 5B0DA 3WQPA 3B54A 2CZVC 4USWA 1X9MA 3D3CJ 3HVRA 2YPYA 4PRFA 1TKTB 2HWTA 2MHNA 3GV7B 4ED1A 1CC8A 2UVRA 1RADB 1HNIA 1Q8BA 4JI7F 1TUVA 1WG1A 3OT9A 1RWMB 4P2MA 1RWWB 3ETMA 2HVIA 1RT5B 2GS8A 3KLEA 1AXQA 3KHGA 2XZWA 3DOMB 3UDEA 4JUZA 2ZZMA 2I5JB 2P9GA 3MCSA 1F2HA 3PHTA 2C3YA 3HVWA 1UPMB 4X4QA 1QY7A 3PO4A 4DS4A 7FD1A 2B6AA 3AA8A 2VFRA 1S1TA 1PBUA 2HVZA 1KSPA 1VQNS 4XIUA 4J9OA 3J81j 2ZH7A 2QMUB 5KT6A 1RTDA 2UUWA 1RWPB 3GR1A 3DU5A 4QU6A 3RAMA 2BJ3A 3V4IB 3C2PA 1EQMA 4OHXA 3UQSA 2HAFA 4ZLJA 3OSNA 5E3AA 3KLVA 3CD0A 1WHYA 1V5VA 2Z0GA 1IKYB 5IQ6A 2COLA 3PW5A 4EO8A 2NCKL 3ICLA 3UCZP 4ZJLA 1RXOB 1FXRA 5IT9Y 1ITPA 4X4RA 4X4VA 2DR5A 3DRRA 2AGOA 4DU8A 4RW9A 2QLWA 5F8LA 3T1HJ 3GIRA 2R7UA 1VQ4S 2JC0A 5FIIA 3E2EA 4U7UK 1W2IA 2GMHA 2PIIA 2X3GA 4HHHA 1PKUA 1RI7A 3GJTB 4GVBB 3D1OA 1RAGB 3QSIA 5LMUF 1N5TA 3D5MA 3J7YI 2B7BB 1U6ZA 4LF8J 4C8ZA 1I1GA 3V6HA 4OX9J 3NMAA 2BV3A 3MR3A 3TAQA 1UCNA 5A8KB 3SCJE 5DG9A 2JEIA 2MKYA 3AB4B 4UY85 2AU0A 4QWAA 4UZBA 5IQQA 1JNZB 4LBIA 3QGPA 4J9PA 3BN7A 3SI8A 3DRSA 3DU6A 2V8VA 2FGCA 2CUYA 2M0GB 3W8GA 2VPWB 1NUEA 1C1CB 2HHTA 4I1TA 1HBNB 4H54A 3PTWA 1N5YB 2LMIA 5C25B 3DLLQ 3PCOB 5T14A 2HFZA 4DCJB 5ETPA 2IHR1 3D6TB 2EFNA 4L73A 4LRAA 2YWWA 2E1PA 2YWEA 4UW2A 1Q95G 2FVRA 4OHWA 3TQEA 3H0PA 3T5KA 2ILYA 3GR0A 5SZTA 1X4FA 2U2FA 1HD0A 3AQOA 1S10A 2ROPA 4IR9A 2ZNZA 2CG4A 3PFEA 1D0EA 2VIHA 4B9LA 2CJYB 4QYZJ 1VBZA 4HDHA 4NLTA 3H2LA 2AQ4A 3RAXA 1S7IA 4Q8EA 4ZOSA 1B0PA 2AYGA 2QTWA 1LWCA 2E44A 3MGJA 4HR2A 3J7YU 1XEZA 3RRKA 4J9SA 3RW7A 3QO9B 3OR1A 2BMBA 5KFLA 2MKIA 5KFSA 4Y28C 3T9NA 2Z2LA 4LF5J 3QJPA 3VHQA 4K5RA 1QM9A 1TL7A 5L1IA 5F8NA 3DOKA 3MAQA 2RRBA 5CHCB 2M88A 4RKUC 2DVIA 1VHFA 2HIYA 3KLFA 2QSWA 3KHLA 3GQCA 1ZOTA 1NSPA 4Y34A 2ZVSA 3NGSA 2MZRA 1UKUA 2WBRA 3O2IA 4E98A 1WEYA 1RWKB 3BKTA 4O3QA 3JB9k 5BJRA 4K4SA 4ECTA 3C66A 2IM2A 3S01A 1LFPA 3LTOA 3AA9A 3K5PA 4EBDA 2G9OA 1FRLA 3ZO7A 1UZHA 1FTRA 3IBWA 1YJ9S 2R2TA 1HL6A 2OJ3A 2UUBJ 1Q4RA 2OH2A 2ZBCA 3RYLA 3T3FA 1LWXA 2QSFA 4TLQA 1WELA 1L3VA 4OFZA 3OL7A 2ZJQQ 2EW9A 1RLDA 3BF4A 2FJWA 4OYPA 6FD1A 1XMQJ 5DM6Q 1KC8T 4A4JA 3FK4A 2IPOB 2E1MC 1DTTA 1MROA 3U1MA 1FJGJ 1G6BA 4A46A 4RUAA 3I82A 4QU7A 3QLHA 2M8DB 2HRUA 3U27A 5KG2A 4X4SA 3THTA 2I38A 2M70A 2GJ2A 4Z2XA 4WYLA 3LP0B 2DRBA 4MAKA 3CMQA 3H2UB 1ELOA 2V4JB 4Q43A 1TUGB 4LSNB 1ZBTA 5F8JA 4DBQA 3K8VA 3IR5B 4FZVA 1SKRA 4ELUA 5IC6B 3ZXWA 4NEZA 3BDPA 3AXKA 2V5HG 1DQAA 1WI8A 5KFUA 1NZ8A 4W4MA 3K89A 1NH7A 1FERA 4UOHA 4ES1A 1FRHA 2ZFHA 2AJFE 1G3OA 2NXCA 5D4PA 3ZTPA 1RT2A 2YTCA 2K2PA 1BD6A 5FDLB 2OI2A 1REVB 3T5JA 2QL5B 1WHVA 3UE2A 2DGSA 3UDVA 2WONB 1BUXA 1CULA 1J2VA 4RW8B 2HHWA 4OZ2A 1S9GA 3C6UA 1NK6A 4DOZA 3EGZA 1TZ0A 5ETLA 4NMLA 4KFBB 3CJTA 5AXKA 2HVHA 2KL8A 2HRYA 2XZTB 5M2UA 3CDWA 1P9YA 1U0HB 2CVEA 1JX4A 4KT0C 2RF2A 3NNAA 3MPUB 2DGWA 1N36F 4CLZA 2MKJA 5D6GA 3OJUA 3B4DA 3FFIB 2X1FA 4P7VA 4PKDB 2XS7A 2OO4A 2MZJA 3MUTP 3EUNA 4DR1F 4A8SA 1VBKA 1SIWB 2CFXA 4IH7A 1FXLA 2FHMA 2FUG9 4NLRA 4Y00A 2YX4A 1YJUA 4W92B 4KH1B 1U24A 4I7FA 3MEKA 1WUUA 2HLTA 1VBYA 1XMOF 5DLGA 1H38A 5D3GB 3SCLE 1T9TA 2VBYA 2J6SA 3VAGA 4ILMA 2MZ1A 1UTAA 4KGMA 3GFZA 4DV1J 1TL1B 3DDIA 4XTTA 2QC3A 2KFYA 1BQMB 2Y1IA 1FVQA 1DY3A 1U48A 3V2UC 3OTDA 1TKZB 3RBEA 3MEEB 1FRIA 2N3OA 3M2UA 2L9NA 2CQPA 4UOFA 1KQKA 2VICA 4ECRA 3GB0A 1NDLA 3U1LA 1D9AA 4UUXA 1RA6A 4B3TF 1HKAA 2FLPA 4IDKA 2VB6A 4LRDA 4GC6A 4YN3B 3V6DA 2FHKA 2JEFA 4L6V3 3TZZA 2KXFA 4FF4A 3QSYB 2NQPA 3H5XA 2UXBF 3HDSA 3W61A 4KGXB 4MKBA 3TA1A 5KFHA 3W60A 2YX1A 2BYCA 1TK8A 1LV5A 2CQ4A 3CMAS 3LGHA 3MAHA 4ZN1A 3GYNA 1OY9A 1RHRB 2IRYA 3EMTA 3KUEA 2ZBIA 3AQPA 3O8WA 1ZA1B 3LAKA 4JI6F 1UA1A 1WC6A 2XLKA 4PUOA 3DLGB 3ISZA 5FJ4A 2BA9A 4P2XA 4M5GA 3NGKA 3W64A 2XMKA 5J1EB 4NCGB 2A2CA 2NXJA 3PG9A 1Q78A 4CTAA 5F9LA 1NO8A 4ZP9A 2OPQB 1JLGB 2B5JA 1U4BA 2KZMA 4ATNA 1RJJA 3QGIA 3IM9A 1M1HA 4F3OA 2CJ9A 4TY8B 5G0RB 1F3FA 2CNOB 3K58A 3PX4A 1ZM4A 1U1PA 2R2SA 1R0CB 5C7PA 3THPA 1BY9A 3Q8QB 3D7SB 3FMBA 5KG6A 4V19X 2KN4A 3CJSA 3TA0A 4DV5F 1HNWJ 3DLBA 2LQ5A 1U45A 2BABA 4OQJA 5JVGQ 1S1WA 4HH1A 4MYTA 1TKDA 1MMDA 4FNIA 2RS8A 2ACYA 1P1TA 2DR9A 4IG3B 5DQHA 5DO2A 2BKNA 4DR2J 1VFJA 2DNZA 1NBEB 4ETXA 3OFEA 4EUVA 1YZ7A 3OTOF 3PEJA 5E3RA 1YJVA 4LJMA 4ZVEA 3ELHA 4I6YA 4CLKA 2Y0BB 5IT0A 4WFAQ 4LQ3A 1U7LA 4P2FA 1JXEA 3TAPA 2LLZA 4FKYA 3TVKA 1RAOA 2ZOMA 4OLPA 4C3KA 2A10A 3CCQS 3PNIA 3MUMP 1NJYA 5HVFA 4EZ6A 1YG0A 5DDRC 4LUBA 2B43A 5GVQA 1IBKJ 4C48A 2AJQA 4OYIA 2GVZA 2DNNA 2ZKUA 3H42A 4ZJQA 3H4DA 4RBTA 1N33J 2CDRB 4NYOA 1NCLA 5L1JA 1M90T 3QT5A 3M32B 5JMNA 1HHTP 2ZM6F 4DL7A 1T02A 1M5VC 1VRTA 1M5PC 3IAM9 2DNQA 4GRSA 4RJVA 5T41A 2XMTA 2HFNA 3NG8A 2FPHX 4MH8A 4I2PB 3I56S 3BBCA 2BBEA 4IO9Q 4FP9A 2O3DA 2ZH4A 1GH8A 3VGSA 4XDDA 2ZH8A 3PIOQ 2ZOGA 3DXSX 4LSZB 3CJ5A 3Q2TC 1URRA 5CA5A 2KG1A 1TV6B 3K0JA 1SH2A 2DH7A 1F6TA 2CNLB 5CYMB 3OTBA 2AGPA 2DNLA 2H51B 4P75A 2VPXB 2HMIB 1EKSA 3DHWC 2YNHB 2JOQA 3VAMA 3ILLA 2FY8A 3M8RA 1UWBB 3GIKA 2XO7A 3O3LA 3JSBA 1PCAA 4ANEA 2ZE2A 2AD9A 1FJEB 1JLBB 3ENQA 2EBEA 2MHEA 2NUUG 2W9CB 4Y6IA 1NSAA 5CXTA 5IT9U 2E5HA 2EK6A 2ZHBA 3C6TA 4HVZA 3RU0A 5F3TA 5AJ3F 2IC3A 2OPSA 1MMNA 1LEOA 4KH0B 1CJUB 3QIPA 4ED0A 3QJJA 4M5DA 1X4CA 1KVIA 1X8DA 4W98A 4ZVQB 4JI2F 2C3OA 1S99A 2QRRA 2L08A 1Y10A 3EDQB 1K1SA 2V4QA 3E01B 2QYCA 3V5RA 3G8TA 3TZWA 3MM9A 1YITS 2MEWA 3BPSP 4KHPJ 4PG5A 5HLFA 2A6OA 4GO5X 3KNGA 2LA4A 3UDLA 3WIUA 2RILA 2V34A 1LWFB 3D66A 2HBRB 2DNGA 3F44A 1HQEB 5KFYA 3Q22A 2Z30B 3KK3A 4OZNA 2YVSA 4DR4F 4MIBA 3N28A 2GFFA 4N8NA 1SJ4P 3NMRA 2IY5B 5BR8J 3AOBA 4LF1A 3WX4A 5K14A 3OFHA 1JNRB 3IG1A 5KG1A 1R0AA 2M9KA 3RJMB 2VF3A 3W2WA 2XWXA 2RQCA 3CCRS 4HTIA 5HP1A 4X66J 1DURA 2CPEA 1HHQA 3OTEA 1R43A 1JLCB 3TAMB 3GIMA 2EEYA 1X9SA 3CT9A 1PC4A 1W25A 2A18A 5A0YB 1C1BB 4U9RA 4DF8A 1UJ6A 2DXEA 4O3NA 3CW2C 4M63A 3UFCX 2YPZA 2R7WA 4G65A 5HMWA 4F0MA 2KT2A 1GX5A 5LSRA 2KTQA 2QT7A 1VHIA 3MM7B 2MSTA 2RDIA 5CD4A 2LXIA 2RAQA 3K7RA 1N34F 3CSKA 1DQ8A 1SV5B 4KYZA 2ATLA 2YWFA 1NDCA 2AF6A 1VC5A 2Q66A 5EHHA 2ZBPA 4ERDA 4ZK7M 2QG9B 3GJRB 4A47A 1RTJB 1NJXA 3TUIC 2JSXA 1XNRF 5F8IA 1IM6A 5I4MA 2V9WA 1B64A 2C42A 3JS9A 5B0CA 2Q6BA 2ZUAA 3BYRA 3D2WA 3R2DJ 1SUQB 4H4OB 1DLOB 2KDOA 2FTRA 1U26A 4FYWB 4KPCA 4H4MA 4WFXA 1LW2A 4F3QA 4MJKA 5J1PA 1YSJA 3C3LA 1EX8A 5G4DA 1T3OA 4MKVA 5J2QA 2W7OA 5IM0B 2UUCJ 2P2CB 4OI1A 2HNZA 1VC0A 3FBEA 3OUYA 3SFGA 3VCDA 4DR3F 5HMXA 2DR7A 2MKKA 4LT6A 1IWGA 1KLMA 5IXUA 3MM5A 3LANA 3UR3C 2WRMA 2YWHA 1Y0HA 3UWTA 2P8IA 1GK8A 2F9JA 1M5KC 2GNKA 1VJQA 3MMCB 3UDCA 3QJLA 1UJ5A 3NNHA 1F1BB 3MMAB 2Y0SD 2QA4G 2OIHA 2HK3A 3GG0A 4LF6F 2JLEA 4BHQA 4NLYA 3W65A 4DQPA 2CDQA 4NXMJ 2AX0A 3TR5A 2CVIA 3G8QA 2FVQA 2J76E 4J9LA 4PWDB 4ELVA 3R5GA 2GQCA 1VLYA 2ZBQA 1VISA 3RB4A 3OXLA 1OJ4A 4OX6A 3Q0AA 2F8HA 4O44A 1O6XA 2IDEA 2NXEA 2HS4A 3HSJA 5CYQA 1HWIA 1S12A 5JUMA 5KFRA 2XB2D 1L3UA 3DLJA 5CQGA 3BJYA 3MPYA 5B09A 4RPFA 1GAOA 5GMEA 1Q8LA 1JK9B 4MFBA 1I51B 3T5LA 2VDIA 3H90A 2ZOFA 3IS9A 2GHWA 3KJNB 1RA7A 3ZTRA 4NXNJ 2VFUA 1RAIB 2XHCA 5A8WA 1N32F 3MXHP 1HMVA 3MPWA 1NZAA 1R8PA 2F4VF 3T1YF 4ED6A 5KFBA 2DRDA 1RTHA 4AUKA 2RU3A 4C8KA 2G2YA 5K5MA 3W7BA 1VQ8S 2EWHA 2YKPA 3PVXA 5HVGA 2QMXA 4ZIVA 3VAFA 3DN9A 2QIFA 2VBWA 3OFFA 1HNIB 4OZLA 5DG8A 2RHQB 4B3RF 1T9UA 3HHLD 3JXOA 4CNYA 1J5OA 4ZITA 2FIUA 3J80Y 4Y65A 1Z2ZA 3HZEA 4IR1A 2D1CA 3QFWA 3KLEB 3AH6A 3DM2A 2PA3A 2I0XA 4OZ1A 3RG6A 1ZAWA 1F5AA 2ZD1A 3FNNA 1T03A 3KDOA 1QVFR 1G4CA 2F5GA 3TYTA 4PZVA 4NZ7A 1SJ1A 2B6AB 3N01A 3CPWR 5L1KA 3OHBA 4OI4A 1S1TB 1RYRA 1RLCL 2HURA 5H9EK 1RTDB 4LFCJ 1K0TA 1PIEA 1YWXA 5HN0A 2DGVA 3H2VE 3WC2A 2K8GA 2KRBA 3CVKA 4DR7J 3JSYA 3MEDA 4DCPB 3GPAA 1W26A 4AXJA 3N4WA 4KR0B 2IIHA 2LEAA 1FFWB 5KFOA 2A6MA 1N6QA 3G9CA 5HATA 2DO0A 3C16A 2RE1A 2F3JA 2J9EA 2HFUA 3DRRB 2DT9A 4I6AA 4RW9B 4WKYA 4OLOA 4HYKA 1VQ5S 1IVZA 1RK8A 3V6JA 1MG7A 3DLEA 1NHUA 2HVDA 5DDQC 4OV6A 2XULA 2YWKA 3O5TB 2UZAA 3C15A 4RNNA 4RNFA 4WE1A 2C2OB 1B7YB 1I3OB 3PRBA 2L48A 3VF0B 1I94F 2X1GA 2JL9A 4U7UD 4DSKA 2UP1A 2HBZB 3QAUA 2UXCJ 2A2DA 4J9NA 1Y5NB 3UN2A 4PXEA 3FEZA 3LQVA 3DRSB 3IR7B 3PRDA 1N4LA 4B9SA 2XMUA 2BJ1A 1PO6A 4ENOA 1H6KX 5RUBA 3Q8UA 4NLQA 1B0VA 1ZS6A 1VIXA 2WVEA 2PD1A 1RHUB 3QBCA 1OYEA 3CNQP 4RWWA 1T11A 2KU7A 1PAEX 2B8PA 1RSCA 1HIYA 3KXDA 4A8YA 2IJNA 4DWIA 4OZ0A 4P9SA 3PYFA 2NYIA 4DPXA 2HHXA 3IBCB 4KE5A 2PEHA 5AE2A 4DXLA 3TRGA 4KSEB 2LEPA 4DL3A 3LPEA 4CM0A 5KG7A 2RQMA 3EXCX 3BGRA 1OWXA 2KZZA 1HNZJ 3TX8A 3OL8A 2W8KA 1LWCB 2FVCA 3BGLA 3MR6A 4CDIA 4F8RA 4U96A 1VC6A 2HZVA 1D9DA 3OW2R 2O67A 3T1HF 4KTQA 3W1YC 2WSEC 4QWBA 3OR1B 1YJ7A 5LMNJ 4EI2A 1WG4A 1TL7B 3DOKB 2OEJA 2LP4A 3DGVA 1LW0A 1S6PA 4FDFA 2K1RA 2D3OR 1SKSA 3KLFB 4OX9F 3FC9A 4J37A 4WP3A 3EVWA 2HGLA 2OUGA 4OZ3A 2RB7A 2IDLA 4RW4A 5CZVA 1F60B 1D3WA 3A1YG 1Q81T 4WFBQ 5ETRA 1S4EA 1DFDA 2YKOA 2IA6A 2HIQA 4USJC 3WX8A 4X4NA 2D69A 4HI2A 5F8HA 3LO3A 3SFUA 2B3TB 3LOUA 1DBDA 1JJCB 4PYAA 2QJ3A 5KFZA 4BBYA 3GSIA 1KD1T 5KFXA 3HHNB 2VQFJ 3WZ0A 3V81A 4J91A 3CEDA 4N47A 3DLKA 1FDBA 1WEZA 3CXCR 3RBZA 4B9UA 2OSQA 2V2KA 1WHWA 4MYUA 1RKJA 2WW4A 1SIZA 2HRTA 2P6TA 3GSDA 2FVSA 4KAIA 3GWCA 3QT7A 1X4DA 1URNA 2XBPA 4DF4A 1NDPA 3Q8YA 1Y3JA 4DFJA 1UVLA 1DTTB 1MROB 2C2NA 4F26A 1N8RT 2XS2A 5BYQA 2MY8A 3QLHB 4X65J 1X4HA 1R27B 2LDYA 2FHJD 4LF5F 3GP9A 1WOOA 1U2CA 2V8GA 5GAGI 1HBMA 2MQOA 4UF4A 4DX6A 3G6XA 4UY8T 4K4ZA 3HHLC 3W63A 4I2QA 3VGUA 2YXLA 4NI2A 1NPRA 4J9RA 4PWUA 1KWMA 3AD8C 1FT8A 1ZA2B 4YS2A 2XSJA 4QBUA 1MWZA 2WHOA 1IBCB 2XMJA 3NEKA 1RT2B 1AFJA 1UW4A 1TVRA 2CQCA 3TP2A 2GV1A 3CJ0A 1KVJA 1CULB 4HKQA 3FRYA 4ZCKA 8AT1B 3R9LA 1GXLA 1S9GB 4K0KF 4DN9A 1NU4A 3C6UB 3D6HB 5I42A 1S6UA 4KKOA 4YQWA 5HJYA 2UUBF 3LGMA 2HG4A 2J0QD 3JYTA 3VZHA 3IMQJ 1R6YA 4OJGA 1RU1A 3ZZUA 2BM0A 4WXWA 1R31A 3F0NA 4YDXA 3ETOA 2RF2B 1XMQF 4JI0J 4C4WA 3CWJA 4EBCA 2AJ4A 2B9YA 4NMXA 2VDHA 2OKQA 5GAGU 3M8YA 1FJGF 4TYAA 2HFSA 3B8HA 1U1LA 2HQGA 3S6EA 3CCES 1RWVB 2B4PA 5GAEI 3RB3A 2HHVA 3VALA 2ACMA 4I7FB 1YQHA 4EO6A 3KTQA 4C8LA 2G0IA 3LAMA 1YGYA 1BQNA 3W3SA 1S6OA 2FJBB 4DCOB 2WB4A 3BDEA 4M5MA 2LCWA 4ID5A 3I5CA 4B08A 4G1IA 3T9ZA 5GAHI 4M95A 3CJKA 2DPIA 4XK8C 5MAOA 4KB7A 4IO1A 1S9EA 3TJ8A 5DLFA 1TKXA 3ZZOA 1VS3A 3KKFA 1P27B 2GIQA 3M2UB 4DSLA 4KBIA 3AY0A 4QIEA 2P6SA 3J7A1 3BGFA 2PEBA 2RNEA 1JLEA 4C97A 4RW6A 4X62F 2E7VA 2OPRB 4IDKB 1IJFB 3FQKA 2HQCA 3V6DB 4QR2A 5E3QA 1EHWA 2JRSA 2JLFA 1J5EJ 1HI1A 2OP5A 4PG7A 1FNOA 1VMBA 1PG5B 3W8PA 1SJRA 1S4FA 1KRPA 2MTLA 5GAEU 1RAFB 2O66A 1WTFA 3BGUA 1H73A 2KKHA 2ZJRQ 2GQ2A 3FBCA 2C22A 2AT1B 5AE3A 1FVSA 4JP8A 2R7XA 5C2CA 1VQLS 4QWCA 4PUOB 1FA0A 2XEXA 1MU2A 3RB0A 4FN5A 1XNQJ 4IKAA 1EJ7L 2UU9J 4CTAB 3ZNUA 2B4OA 4WJBA 4OYXA 5GAHU 3HMJG 3OR2A 1U2RA 2B5JB 1UP1A 2BJDA 5LSLA 2ALZA 1NB2A 2DH9A 2KJWA 4L74A 4ED4A 4RBUA 3OQ2A 2W2QP 4XAKA 1QSLA 3MWBA 4NLOA 4K50A 5EWEA 3CO0P 3D0HE 4NLUA 4DV1F 4DPTA 3CB4A 2RD5C 3JQJA 4AQYJ 3WIVA 4USUA 2CJKA 2MQQA 1PSDA 3HHLA 3H40A 3HFVA 3NL0A 2LXFA 3PJXA 3VR1A 4OIXA 1U1MA 1TAUA 1U09A 1BLUA 1S1WB 5LSOA 2BW2A 3HO1A 2KYXA 3FMWA 3UN3A 1P9QC 3SV4A 4DX7A 4RUHA 3HD1A 1X4GA 4PPZA 1ZH5A 3NWGA 3CC4S 1XMBA 3SEOA 1IR1A 1Y5IB 3PW7A 4L3KA 2GIRA 2DNOA 1KTVA 4J9QA 1UEUA 5L39A 2B8QA 3CCWA 3EZUA 3A4TA 2YKQA 2UVUA 4LMZA 2NPIA 1WI6A 3EJMA 2AYMA 3G86A 3H5UA 4FYDA 4NA1A 3OTCA 3SBMA 2OELA 2QN6B 1NKEA 1HPZA 1N56A 2HHPA 4I56A 1JMTA 3CJ2A 1FEEA 4C2MA 2VZ9A 2CG8A 2A1BA 2GVZB 1LXNA 2M3DA 2MMYA 3SZ2A 3ZC4A 1OSDA 2OMOA 4LF9J 1IJEB 2QLJB 1BC6A 2PFFB 4KGZB 3J80U 2F40A 1VRTB 4ZN3A 1C4AA 2DTJA 2HHQA 2BANA 1K73T 2CZ4A 2PFDA 1TR0A 4I67A 4PR6A 2R7TA 3TUPA 1PJ7A 5F8GA 1C0TA 1HNWF 2BE2A 1KBRA 4H4KC 3PEHA 4M5HA 2ZUGA 4WPAA 3HVTA 2LQBA 4OJ3A 2R8KA 1KS2A 2V2VA 2IAJA 1SC6A 1S9FA 1AT1B 3TW0A 5DGAA 1HNVA 5CCLA 3SYZA 4CLUA 2BEFA 4DR2F 2OLWA 4LR7A 4AT1B 1GTEA 1YRUA 5K9FA 4RBVA 4DX8H 2ZE2B 2X3DA 1UZDA 4QYRA 2VC0A 3NBPA 2AZ3A 1K47A 1FRJA 3UVJA 3C6TB 5ETNA 2IC3B 2OPSB 3PR5B 3QQCD 3TA2A 4Q2MA 4C0BA 3QIPB 4ZLLA 2BZ2A 2CQ0A 2FC9A 4M5DB 3MMBA 4PXBA 2WOMA 5DDOC 4PXCA 3LP1A 4I6WA 1WC0A 1IBKF 2JC1A 4QIVA 4ECVA 3DYAA 2XHWA 2MSSA 2F9DA 2WVCA 5THWA 1N33F 4A48A 4P52A 5KFAA 4CO0A 3MM9B 1ZETA 2EVZA 5HLFB 1IKXA 3MZIA 4KQZA 3FBBA 5DM7Q 4OX7A 1RACB 2V6AA 3QWPA 1MN9A 3BSAA 3K59A 4LFAJ 4FYXB 1RHQB 3RW6A 4JB8B 4HTJA 2WVFA 4Q0BA 3KK3B 2IRXA 1HW8A 2NS1B 3A12A 2M5YA 4YB1P 1TFYA 4F4AA 4YR3A 2Q1LA 1UW9A 1NJZA 5LJ5Y 2QX0A 4WXOA 1BHNA 1NK5A 1Y00A 5K14B 8RUCA 1RAHB 2VA3A 3IG1B 1R0AB 2DNMA 3FEXB 2AJ1A 3W2WB 3WHIA 2XY6A 3BQ2A 2ZZTA 3NLCA 3GLJA 3K17A 5ETKA 1NRKA 2RHSB 2DHGA 2ERRA 1NHVA 4DL2A 1F3VA 3UPFA 3A3NB 3DRPA 2OFGX 3PO5A 5DQGA 5KAKA 2KFNA 4USKA 2W9BA 3MEGA 2DHXA 4LREA 2IJRA 4XO0A 5IWAJ 2GVDB 4N7TA 1IKWA 3W66A 3FCVA 3BSOA 2N7CA 4ED8A 2DY9A 3D68A 1UFWA 2NLWA 1BQXA 2C2DA 5BYRA 1HFEL 4BC9A 4LF7J 4ECXA 2VG5A 4O0IA 4PXDA 4NCBA 3OL9A 3K5LA 2DIVA 5LJ3Y 4NLPA 3VV2B 3EM1A 1D8ZA 3PR4A 1DTQA 3NRBA 1SPBP 1JKHA 1Q79A 5H9FJ 3DLHA 2PA8D 3R3TA 4H4MB 2FHJA 2V94A 1FKPA 1LW2B 2NUHA 3OV7A 3ZZPA 1JXLA 2V0NA 3QRPA 1H3DA 2KM8C 4DFKA 1ZM9A 3TUJC 5J2QB 1FWLA 2FGOA 1MNEA 1OY8A 2HNZB 3OUYB 1L3KA 2LVWA 5J2MB 2AJ2A 4F4KA 4DSJA 2LEBA 2Y3YA 3OPKA 5DRKA 1KLMB 4FF2A 3MM5B 4ZPDA 5BR8F 5B0GA 2JH3A 3WC0A 4H4KA 4HH0A 3DOLA 2E7XA 2VPYB 3VGTA 3CUNA 1PC5A 1YI2S 4X66F 1F0XA 2FDNA 1WF1A 2CJQA 2J8SA 1C2PA 4QZVB 2XMMA 3FUYA 4AL7A 5LT5A 3ULHA 3MPVA 5GMDA 2MQPA 4F4WA 2WSFC 2KVQE 4ZVOB 3KYLA 2M2BA 4ECYA 3HHDA 1SJ3P 4HHJA 4OI6A 3PM9A 3VVUA 4U6PA 1IBLJ 3MM8A 4O44B 2N4DA 4X4TA 5CYQB 2HHHJ 3G6ES 5SUHA 5F41A 2YNFA 1VK8A 1WF2A 3AAWB 2ALYB 1U8WA 4F25A 3M2VA 2Z58B 3PIPQ 4MFBB 1RKIA 4O3PA 3MM6A 2C28A 1IUJA 2PMWA 2PDAA 3M2RA 5I3QA 5F0UA 2MZQA 4WZMA 3IS9B 1T95A 4MK7A 3GU0A 3QAEA 2IBKA 3BH7B 3W2VA 2H1YA 2RS2A 1U47A 2D74B 5A8WB 3KLHA 1CJTA 3W5ZA 3A3OB 2CPDA 1RTHB 3N9UC 2BKPA 4ED7A 5DG7A 2UUCF 3H4BA 3FSYA 1S76D 2XYPB 4M94A 2CPFA 5E33A 4J9VA 3VWSA 1CSJA 3CJ4A 1HBUA 2R7OA 3KUHA 1J5OB 4A8OA 4P74A 3TNVA 1QVGR 1U8SA 1Z1ZA 3MD3A 3DM2B 3DHXA 3VAHA 4X4PA 1QD1A 2AV5A 4FXVA 5A6PA 2ZD1B 1H98A 4NXMF 1T03B 4DUTA 2SXLA 1FX2A 2ZWPA 3FKBA 1SB6A 3GFYA 1VLOA 2H4YB 2BUNA 1EZZB 4G1QA 5C24A 4QW9A 2EXUA 1JLQB 4OX8A 3IO1A 5D0HA 2AJ0A 1YRXA 5J2PA 2YQ1A 5FLXY 4XPCA 2ZH2A 4C3LA 5GMKa 1CJVA 3K2YA 1EAYC 5KT4A 4ZVSB 4ILRA 5CZXA 4O4RA 4A8KA 2HQ3A 3MEDB 4OZ5A 3W9IA 3US5A 2LYVA 2Y1RI 1WSVA 1N6QB 1L3SA 4ECSA 3C16B 1ZPVA 2UV8G 4NXNF 4NWBA 3JTPA 5AT1B 3U7JA 4ANDA 1HR0J 2LXUA 2YKAA 2FZCB 4OJHA 1RTIA 4DV2J 2VJUA 1S1UA 4LVNP 1NNDA 3AD7C 3QZ7A 3FGVA 3M8ZA 2CQ1A 3DLEB 4USMA 4DX5A 4PG4A 1ZYQA 1P6TA 1H2UX 4F0KA 4K4WA 4PYDA 2U1AA 3L7UA 3C46A 2E9TA 3PRVA 1HNXJ 2MQNA 3C15B 3QFHA 3SQOP 3FCHA 3I87A 4WE1B 2MJNA 2VKRA 1F9EB 2BQUA 1EB0A 2BRKA 2GW8A 5D0EA 4FNHA 4R8UA 3G71S 4K4UA 4KHMA 4PG8A 2CKWA 3RR8A 3SSSA 5EGYA 1NKCA 1T8EA 2C2RA 3KMSA 4HACA 5FD1A 3R5BA 1KOHA 2MYFA 1DARA 1U1KA 1RBLA 3CC2S 3U1NA 2HFOA 2HS3A 2RJZA 5EWGA 3HPOA 2R9LA 4ZVFA 1IBMJ 5E3PA 1K1QA 2D3UA 1TP7A 4LFCF 3BSNA 3I5AA 1NK7A 5KG4A 4CIOA 3WDOA 1ZZNA 3C19A 4DR7F 3BO2A 2QA4S 2DD8S 1YIJS 1OPZA 3N6NA 3KWMA 4NYPA 2E5GA 3G82A 2GO8A 5IFMA 1N88A 3D1QA 2UV8A 4B3MJ 1Q8KA 3BGRB 2KJVA 1Y9OA 3B78A 3IWNC 4NX9A 3L09A 3NKYA 4IOCQ 3N6LA 1BWEA 4DQIA 3QZ8A 4RW7A 4DUYJ 4NLWA 4PQUB 3LW5C 2G1DA 2EC0A 4ES2A 4RNMA 4QPTA 4EMDA 1YX2A 1REGX 2J7WA 1TQLA 2HSEB 2GJIA 4GVLA 1Y11A 4RNOA 2F4FA 2DCLA 1G1XA 1XR7A 1TK0A 4IFVA 2DK2A 1LW0B 1S6PB 2K1RB 3GILA 3N0VA 3IGVA 1YHQS 4LFBJ 1VIOA 1T3NA 4RW4B 2UXCF 3BEGB 3PJ9A 4MK9A 4M5JA 4JV2A 3VVTA 2W4CA 2WVDA 3M8SA 4G3IA 3HCXA 1JIHA 4AXIA 4CI0B 2H48B 1KFDA 5D77A 1R8HA 2DJWA 3NCRA 2DCUB 2AMCB 4A8MP 2UVVA 2ZVIA 4DPYA 4ZP6A 4ZIWA 2J0SD 3DLKB 4CYUA 1U1OA 2BJ7A 5T7LA 2W2NP 3CD7A 1Q1KA 3DI6A 1HWUA 1M5SA 4AYBD 2CXEA 2Z56B 3KJVA 2HYIB 3TZXA 3I0RB 5MLCV 3M1VA 1GMWD 2JZ5A 1YJNS 2WB1D 5DZ6A 3J7Z5 3LA0A 5KFFA 2KI2A 3PFOA 2NSCA 1RT7A 4MIWA 4JI2J 2DGUA 4BDPA 2Z2YB 3TOQA 4RX6A 5HMZA 2VQEJ 1WC1A 4IQMA 1CEZA 3JQMA 1XC9A 4RU2A 4TY9A 3Q2SC 2UUAJ 5IT4A 4FS1A 1NLKL 1K0VA 1KONA 1HQUA 5LMNF 3BR9A 2EG2A 3UW1A 4AFFA 2DGQA 3ITHA 5DS7A 4P73A 1FWKA 1HBMB 4JI1J 2DEIA 2ZH1A 2AZ1A 4F50A 4I2QB 4J9UE 4OI3A 3RGIA 4NI2B 4Z7CA 1FE0A 2D7SA 4CT8A 2HWIA 3M8QA 2XSJB 4C6AA 2QLFB 2J9CA 2W2OP 1KHWA 2XI2A 5A2QY 4C8YA 5E5NA 1S1VA 3QWUA 4IYQA 1TVRB 2RUSA 4XDCA 2R2RA 3MOZA 3JAMY 4TU7A 4Y2CA 3TARA 3P45B 3N5BA 4DV6J 2QYGA 3QT8A 4K8RA 4KKOB 3Q8PB 5IV3A 2VQFF 1TL5A 2VBXA 1V9OA 3JYTB 5H9EJ 1FKOA 3D6FB 2BM1A 2BXJA 3HZGA 4KV8A 4C9DA 2XYGB 3HM9A 4DV7J 1X60A 4EU0A 2RKIA 4FVMA 2Y9HA 2JEJA 4TYBA 2UUTA 5KFPA 4MTPA 4QPXA 1JXVA 4DZ6A 1N48A 4KC5A 2XCPA 4R25A 1N5QA 2Y8WA 4WCEQ 1H2TZ 3AB2B 1RUSA 1XNRJ 1PYOB 1B3TA 5BXIA 1MLAA 4J7CA 3D9BA 3G96A 2ZC4A 4X65F 3UCUP 1Q86T 3Q86A 3T6JA 2VFSA 3QMQA 1RBAA 2RT3A 3ENVA 5KG5A 4ZP8A 1XJWB 2KXHA 2JLGA 3PYGA 3L9ZA 1HQEA 1WKKA 1BQNB 2MGZA 2JNJA 5IZHA 2DITA 4QR0A 4J90A 1ZM2A 4ID5B 3A3PB 1T9WA 3SIPB 2LA6A 4HEA9 5KFNA 1LOUA 3I9ZA 4DV3J 3CJKB 2ADCA 4LR8A 5DDPC 4NYZA 2R8HA 1WF0A 2GA7A 1X31C 1S9EB 1NK4A 1TKXB 3I0SA 1FDAA 1ICEB 5HSPA 1V3SA 1RISA 1RCXB 2F63A 4WZQA 4EEYA 4K4XA 2V4RA 4Y2MA 1Y5LB 2LECA 4WWSA 4GKJJ 3Q8SB 1JLEB 1Y4ZB 3E3XA 4RW6B 1C1BA 3G2XA 4TU9A 2ZZNA 3M30B 2J6UA 5JVHQ 2ZNYA 1PYSB 3MFIA 3MF5A 2JHEA 3HFZB 3CDAA 5IOLA 2P5VA 2IYIA 1VRUA 1ZPWX 3M7VA 2B7CB 2OTJS 1YDLA 1Q53A 4WF9Q 4JI0F 2Y8YA 3SDEA 4JYAJ 2GMLA 2HAIA 3SCIE 2N4CA 5E41A 2B56A 2BR0A 3DMJA 3JTNA 4GMKA 3ENWA 4WK1A 1MU2B 3GV8B 1SKUB 4OL8A 1RT1A 2D9PA 1SUQA 2KB2A 3JSRA 2R7RA 3MECA 5KT5A 3EE3A 3U02A 4FPRA 4USTA 2DGOA 3QIDA 3BGOP 3GCWP 2V8PA 3OR2B 1VQPS 2E66A 2PC6A 3FSIA 3AOAA 4OYWA 3QYYA 4NLSA 5DGBA 3PYEA 1SQGA 2V8DA 3IM8A 5D8HB 3TEHB 2B9XA 3CJ3A 2EI5A 2NXNA 3UNYA 4N5SA 2CQDA 2HNYA 1U6BA 3ADAC 3PACA 2UXDJ 5KT2A 1ROFA 2VODA 2E29A 2OGUA 2BQ3A 1VBXA 1V3ZA 1XIQA 4AL5A 3E51A 2VG7A 3RAQA 4BCAA 4DUZJ 4FS2A 3HHLB 3N5FA 1AW0A 3GMGA 2BOPA 4CH1A 3AXMA 5B0BA 5IS2A 4P10A 3DGPA 1B7FA 1WD6A 5ADZA 3SSRA 3QGHA 1W7WA 1KEKA 4JV5F 4BS2A 1PGZA 1RHMB 1TMJA 2AP6A 1J5EF 3PYDA 2VBZA 3BBFA 5KT7A 4U67Q 1LNQA 4WKRA 2QA2A 4YDDB 2OHDA 2WTFA 1NPKA 1U2FA 1UPPA 1XK8A 2N82B 3KJFB 1RWUA 1LWEA 2CJXB 3LGNA 1F9HA 1PJ6A 3CJQA 4G1PA 1T94A 1VK3A 1EETA 4QIWD 5KFKA 3POTA 1U1RA 4K4VA 4DG1A 1YZ6A 3HULA 5AXMA 4B9MA 4WK3A 1XWLA 3VQTA 2OD4A 1XNQF 1OO0B 2CJAA 4F4XA 4F3MA 2LFVA 1Y7PA 2UU9F 3R5AA 3ONQA 2ZH9A 1NPPA 1RU2A 1A6LA 2W9AA 1YJWS 2KYZA 1IXKA 1QE1A 3N79A 1SBRA 3M8PA 2VG6A 4Q2LA 2WK4A 3D6MB 2I8EA 2E5IA 2WW8A 1HYSA 4Q7AA 2YQ0A 5D15A 9RUBA 2BANB 3HVAA 4UQGA 1N54B 3EYZA 1FHTA 1FFSB 2VHGA 4AQYF 2WCXA 4LIWA 4V1Ak 1C0TB 1I94J 2BE2B 3AT1B 4OZJA 2DRAA 2FLOA 2XQCA 3HVTB 4DL4A 4Z7YA 4F4YA 1HD1A 3M6UA 2JWNA 1Z2LA 2IAJB 2CQ3A 2NZ4A 1HNVB 5FLXU 1FDDA 3R7NB 1EKRA 1TFWA 5HBMA 2E1RA 3A8IA 4HT5A 1OQ3A 1WG5A 1CC7A 3X3UA 2HEKA 4WIIA 1FRMA 1Q0NA 2B0GA 4BWMA 2W25A 1Q7YT 2YNGA 3BQ1A 3R97A 4TU8A 2YKMA 1MSWD 1SI9A 4TQSA 3BS9A 3MMJA 4DL6A 4ZPAA 3OVAA 1VCTA 3NBPB 1VI7A 5DZ7A 2CWXA 3UVJB 3FVYA 2PGCA 2APOA 5I3UB 1D9FA 2RDJA 1BGXT 2GX8A 1IKVA 3L3CA 2AW0A 3MMBB 2WOMB 4DV0J 1YLXA 3LP1B 1RT3B 1SH3A 4F04B 5KFMA 5CH7B 4DPWA 4YMEA 3DYAB 1UVKA 3ENAA 2HWHA 3FJ2A 2D41A 1WWHA 3CDEA 1NMEB 4X4UA 4LF9F 1LK7A 2FB0A 1IR2A 1IKXB 2JEGA 2FJXA 4C3MA 4DR6J 4L75A 2J5AA 1A7GE 1HI0P 1RGVA 5KFQA 1H7WA 1K9MT 4L76A 1WKJA 3M6XA 3QATA 3G6YA 1TL3A 5CD4H 1VRQC 3MOJB 1FFGB 2KVIA 3QT6A 3K5MA 3IRWP 4Q0BB 1FDNA 3VTIA 4O4GA 1UFKA 4N41A 3BO3A 2BVZA 2LQ9A 1KQGB 1R7IA 3H98A 2VOPA 1NH8A 3RBDA 2PSZA 2FJDB 3CD6S 1WNEA 1E6YA 4AD6A 1FD8A 3EGWB 3IAS9 4HLBA 2R42A 2XMAA 1UVMA 4O23A 4USHA 1LFWA 4QWEA 3I32A 1DZ5A 5HK4A 1TL4A 3DXBA 4P2SA 3HD2A 5B0AA 4RU9A 4JV1A 3DRPB 3RUBL 1GNKA 3QRRA 4WFNQ 3RB6A 1EP4A 2W9BB 3MEGB 4KGKA 2LU2A 4NOHA 4IRCA 4LRCA 3NGDA 1C0UA 3T6BA 2EFVA 1CJKA 4NLDA 3R7SB 1IKWB 2BQRA 2VU5A 4IQXA 1R6VA 5HJXA 3BYPA 1IR0A 1GMWA 1T7PA 4IH5A 1QUPA 2VG5B 3I96A 3IFEA 4B17A 3W9JA 1V6HA 3CO9A 3PHEA 2AWZA 3MCOA 3D54A 5J2NA 1WOSA 1DTQB 2GGPA 4I64A 4K59A 5KFEA 5ETQA 1JKHB 1XBWA 4KPYA 4WFYA 2FQQB 4B3SJ 3KUGA 4WP8A 2L41A 1FKPB 4C0OC 2BOAA 3FRZA 4LFAF 1ZM3A 5F8MA 2ZC3A 2WAQD 2QLXA 3M6VA 2MKHA 2O5DA 2YNIA 1Q8IA 3MCNA 1ULRA 1U02A 5HVHA 5AE1A 3GYXB 4KJIA 4DR5J 2ZHAA 4ZVTB 4DHVA 4WFZA 1SL0A 4X2BA 2W2MP 1EARA 3IWXA 4DV4J 4X64F 4TKTA 1T05A 2KFZA 3RTVA 3IN5A 2K06A 3LWMA 4NE9C 1YK9A 4GO7X 2XZDB 1TK5A 4FKXA 3SMZA 3M9OB 2XNQA 3DOLB 3MHYA 1M1GA 3UO0A 1UJ4A 4FVCA 2VD3A 4TXSA 2UVWA 2KT5A 1YBAA 4YY3F 4QQBA 4K0KJ 3WBZA 2E5LJ 1XERA 1EIYB 4IFYA 3R1HA 2DNKA 2MPUA 3OLBA 2G1HA 1AYEA 2HHSA 5KFWA 3NWRA 2C3MA 5D4NA 5IWAF 3R5CA 2V50A 4NZ6A 1S6QA 1VGYA 4ZLNA 3AOCA 3MM8B 3IC1A 4IG0A 2E7WA 1RWOB 5F3ZA 1QAIA 4LF7F 2YNFB 3CCVS 2GJFA 2P9EA 4CQ1A 1WEXA 3M2VB 4NRUA 1P1LA 4ZS6A 3MM6B 2KRRA 3HI9A 1VQYA 1AZSA 4A8QA 3NS7B 2IJFA 3M2RB 3UR0A 3QPIA 3W2VB 1W2BR 3ISND 2I9SA 3KK1A 1L3TA 3KLHB 3M4XA 4EGLA 9ATCB 2OPPA 2XSFA 1CJTB 4DQQA 2C3UA 1U1NA 2XMWA 2ZH3A 1FNXH 4ED5A 5A2QU 2V2ZA 2DH8A 3R1LA 5K8PA 1X4BA 4NLGA 3JAMU 3NGTA 1HWJA 4NLXA 2XGPA 2XC9A 1JLFA 1XR6A 1RAJA 2DXDA 4A8XA 1CS4A 1HI8A 4K7QA 1HBUB 3CIZA 3MD1A 3CDBA 5D78A 3FCWA 1MMLA 2ZDOA 1OIAA 1NM2A 2ATCB 2R7SA 3HHKA 5KFGA 4CLPA 4X62J 4LSLA 3FZ2A 3EZ5A 2RUGA 3OXGA 3L7OA 4FBTA 3M6WA 1S7HA 4EWTA 4G1QB 1KVKA 2JVRA 5C24B 4YR2A 1F9FA 2DNYA 3EVOA 2ZHOA 4I4BA 5J2PB 1IBLF 4N8OA 2XYHB 2HHHF 2EKNA 2Z4PA 1CJVB 1TUWA 1WACA 5HQMA 2DNPA 1FF2A 1H7XA 3D4JA 1HWLA 4U8VA 1KLNA 2CA9A 3K8WA 3PW4A 2B4VA 2BJ9A 3IRXA 4ITSA 5JXSA 4ZHRA 4A8FA 1WC5A 4ZVUB 3BKFA 3A8KA 4USVA 3OXFA 1S1XA 3DC2A 3ILOA 3KK2A 2J0XA 4ZJOA 4JI8J 1APSA 4U7CA 1RTIB 4IOBA 1FKAF 5A6WA 1S1UB 2HBYB 4EZ9A 2Q43A 4YUDA 3R8YA 2C2MB 3RRGA 3NOGA 3I55S 4RLEA 1FRKA 4R0JA 4LF4J 2A0FB 3NCPA 3H8YA 1UMJA 1Q5YA 4UQTA 1UEVA 4R5PA 1TTHB 4LBPA 1JJ4A 3KNAA 1SQFA 1S97A 3ILJA 3HT0A 2F1FA 2KM8B 2QL9B 4RR5A 2NXUA 1TU0B 3AJ2A 4B3OA 1GQEA 3BO4A 4AE5A 3G6VA 4LBHA 4M5LA 4V19J 4OYAA 2MQ8A 2H5JB 4R8UB 2C2KB 4DS5A 3BQ0A 1C4CA 2IRUA 5CCMA 2POKA 4LF8F 4UTGA 4HACB 4FYYB 2OPRA 2DHAA 4C11A 1WDDA 4F2SA 5HROA 1R8BA 1KQSR 5GADI 1U25A 4K4TA 4QOTA 2CQBA 4QIGA 2XLIA 2YH0A 5C2GA 4CM2A 4DLGA 2JVOA 3I5BA 4DFPA 2MLXA 5ETVA 4CLWA 1R8CA 3RBXA 5LOQA 1RBOB 2ZWOA 4ZCLA 3O44A 1MWQA 3G8SA 2IM1A 1FE4A 3MUVP 4C8OA 2XMVA 3IBFB 3JSMA 3G82B 1RTZA 2CNKB 2G0JA 5HO4A 2OAUA 1GXTA 2GIFA 4ZVHA 2QLBB 1SVDA 1B0TA 4DN0A 4YR0A 1NJIT 1HR0F 3K57A 3MAAA 5A8RA 4RW7B 3IP0A 4DV2F 1TMMA 4Q5VA 4YB6A 5H9FK 4Q45A 2IM3A 3B4MA 2V9KA 4GKKJ 4OJ1A 3EGVA 2E1AA 3ZZ0A 4LRFA 3IGNA 3ET6A 1CG2A 2DO4A 4JI4J 5F9NA 1HNXF 4ZCIA 2XI3A 1QDUB 4IFVB 1RQ0A 1KQFB 2FYXA 2WVBA 5C5JA 1S79A 4EYIB 3KHRA 4JI5J 2A3JA 2VUGA 1DRZA 4CO5A 5GADU 2ASJA 1UVNA 4P71A 2HBQB 5C42A 2Y1JA 2XY7A 1O0PA 2VC1A 4ECWA 4NA2A 5HAOA 4JOUA 3J7AN 2RRNA 3CCZA 1VQ9S 2YBVA 3TQ1A 4F4ZA 5CAAA 2CJBA 4FBUA 4Y2AA 1XQIA 1IBMF 1QAJA 1OSCA 1SC1B 1VQMS 4ICLA 3H25A 4ZVRB 2DBBA 3MURP 3AD9C 1X4AA 3D1HA 3EPIA 2RH3A 2YKNA 3R6GB 3DCAA 1AB8A 1KNZA 2VONA 3W9HA 3HF5A 4CYUB 3GE9A 5AXLA 2F7VA 5T7LB 5LXRA 1LQ9A 3DI6B 4ZMMA 3NAIA 5B0EA 1R3NA 3KJVB 1XR5A 3M1VB 4CH7A 3C14A 4ETZA 5KOXA 4CLYA 4E8UA 2J9DA 3DDNA 3CULA 2H5EA 2V69A 4JI3J 1GMVA 4B3MF 1RT7B 4C8NA 1N0VC 1J27A 3ISNC 2AYEA 1D09B 2J8AA 2W01A 4E0DA 3ZZRA 4U8YA 4DUYF 1JWWA 3KLIA 3EWGA 4RWXA 3TX0A 3KLGA 3P96A 1UWAA 1GX6A 1QAYA 2IVMA 2HNDA 1JJ2R 1HQUB 4U95A 5L1LA 3IA0A 3F73A 4OHVA 4EK2A 2HQFA 1IQTA 4CO1A 3ITHB 1OY6A 2F65A 1S0OA 2QFIA 4C98A 1RDRA 2H54B 2VA2A 2V2QA 1B99A 1KDNA 4LFBF 1NKBA 5CABA 1T9YA 2WBMA 1U49A 3M8QB 1KTQA 4RZRA 4I68A 1N5SA 2HVEA 1OS5A 3L7PA 1HHSA 2JFDA 3NGUA 1UFLA 1FCAA 2VFTA 3Q89A 1GT8A 2ZDPA 3W5YA 4UOCA 1S1VB 3Q83A 4QW8A 1SL1A 3HJFA 1OMSA 1YJRA 2C1EB 2ZH6A 5B08A 2VJVA 1S72S 3L4BC 2Q79A 3TANA 5HL7Q 2XS5A 3MTJA 3D0IE 1FKOB 5DQIA 2FJVA 3KFWX 4KV8B 1VQOS 1PILA 1N0UA 4OHZA 2CYYA 4CLLA 2QL7B 1DAXA 2RKIB 4PQAA 4FPIA 3BZQA 3R6LB 1F2GA 3VZIA 1V3RA 4YHHJ 2QO3A 2CAJA 5LL6d 1E6VA 2V8HA 5AXNA 2H3EB 4ZPVR 2YQ3A 5KOWA 4URSA 2EPIA 4L72B 3PZPA 3BV8A 4IUFA 3LWLA 2VQEF 3GV5B 3CDUA 2NR0A 1OQ6A 4QYZK 4NRTA 3E8OA 3TZYA 5L46A 2UUAF 3F56A 3CE8A 4FF1A 4CWBA 5KFIA 3F41A 4TVAB 4KGVB 2KHDA 4ZPWR 4ZPBA 5ETOA 2AKWB 4NEYA 2PI4A 3MDFA 4JI1F 4ELTA 3G87A 7FDRA 2MGZB 1QJHA 1FK9A 2FJAB 1KN6A 4M1KA 5EDWA 3IWLA 1RB0A 2E9ZA 1F5CA 3I4HX 5BYSA 3HT3A 2CQIA 3KMQA 4KO0A 2XY5A 1FJ7A 1ZAXA 3RZAA 1X0FA 2DEJA 3MPDA 2V68A 3VGVA 2PO4A 1GMUA 1F5BA 3CCUS 2ZBRA 2DHHA 3I0SB 1HQ2A 4JI7J 4YP3A 3TVYA 3NY0A 5HQLA 4TLRA 5KTQA 2KT3A 4CH0S 1RWXB 2NYHA 2CQGA 1O51A 2ZKTA 4DV6F 2KG0A 1FJCA 2BX6A 2KO1A 3ZZZA 3H20A 1JQGA 1Q5VA 3M9NB 2H4WB 2MKSA 3H7HB 2LU1A 4Y0FA 2RQ4A 1WTBA 2ILZA 2EBGA 4URQU 1NDKA 2J6TA 3J7ZT 2EFGA 1JLAA 2GVDA 4DV7F 1VRUB 1HBOA 4PPDA 3AJDA 2HPUA 3EGNA 3P4UB 1YKWA 4DQRA 3HHEA 5DJBA 2J7KA 1S0NA 1RT6A 1JB0C 4YB7A 3SDEB 2LKZA 2MZTA 1A9NB 2XLJA 4DEZA 3ZFVA 2R8JA 1OPIA 1IM4A 3PKYA 2FHOB 3HKWA 2DXFA 3DMJB 5D0RA 1FWPA 3GTYX 8ATCB 5EX3A 2HKEA 3UD5A 1SJFA 1RT4A 1RT1B 2XGQA 3VAJA 3MECB 4CT9A
chains in the Genus database with same CATH topology
2EC2A 2F4FA 2A6MA 4ER8A 2VJVA 2XQCA 2VJUA 2XO6A 2F5GA 2XMAA 2VHGA 2VIHA 2XM3A 2A6OA 2VICA 2FYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EC2 A;  2F4F A;  2A6M A;  4ER8 A;  2VJV A;  2XQC A;  2VJU A;  2XO6 A;  2F5G A;  2XMA A;  2VHG A;  2VIH A;  2XM3 A;  2A6O A;  2VIC A;  2FYX A; 
#chains in the Genus database with same CATH topology
 3NGR A;  5KFV A;  3LP2 A;  4OV1 A;  1R89 A;  4P72 A;  2AYB A;  4N76 A;  4ZVP B;  1SCJ B;  3THV A;  4IRD A;  3FSX A;  1AFI A;  3SQG A;  2N7Y A;  3IR6 B;  2ZEJ A;  4RO0 A;  4BWJ A;  4KIA A;  3DRX A;  4X84 A;  1BMQ B;  5J2M A;  1IQZ A;  5L9X A;  1SQE A;  2D3Z A;  3GON A;  2PN6 A;  4KHR A;  4ED2 A;  2HNY B;  1SKW A;  1V5I B;  3ZZT A;  3OVS A;  4DV3 F;  1GFW B;  4DSF A;  1TKT A;  2DHS A;  2CWK A;  2HZA A;  2MQL A;  4J9K A;  2RQK A;  2B4U A;  3NXZ A;  3OHA A;  2VG7 B;  3CCM S;  1U0S A;  4ZCM A;  4OHY A;  5LMU J;  4WIQ A;  4QIF A;  4CP5 A;  3DGP B;  3R2C J;  4GKJ F;  4PAB A;  3H5S A;  1RT5 A;  5D4L A;  2AX1 A;  2ABY A;  1A0O B;  3DOM A;  4F2R A;  2EFP A;  2LQJ A;  1M1K T;  2FVP A;  1NAQ A;  2I5J A;  3SSQ A;  4NCA A;  1FX4 A;  4NAS A;  2C2E A;  5IV4 A;  4WYW A;  3HLU A;  3RRH A;  1LWE B;  1S0V A;  6FDR A;  4EYH B;  4Y2K A;  4JYA F;  3ZTS A;  1EET B;  3POT B;  3LPY A;  4DG1 B;  1JJH A;  3V4I A;  4N56 A;  3IXQ A;  1Z4U A;  2AEM A;  4Z37 A;  1VR6 A;  3LAL A;  4WTO B;  1S48 A;  5EWF A;  2XO6 A;  2DY1 A;  5F0W A;  4TNO A;  1IKY A;  4XPE A;  3HKZ D;  2CQH A;  2JDJ A;  1HA1 A;  4CLF A;  3CF5 Q;  3NAH A;  1QE1 B;  3QNW B;  1CBK A;  3M8P B;  2VG6 B;  4ZDN A;  3TJA A;  2BJE A;  2BE7 D;  2I2Y A;  2FD2 A;  4F67 A;  2E5J A;  2QEX S;  2Z2Z A;  1HYS B;  3BRE A;  4I69 A;  1KR4 A;  2H9Z A;  4OYM A;  5ETT A;  2BJ8 A;  2UXD F;  5KFD A;  2HGM A;  2QFJ A;  4NLV A;  4F36 A;  5L8R C;  4DUZ F;  4GVB A;  3GJS B;  3OLA A;  2HQD A;  5E7O B;  5E3C A;  4O0N A;  4ES3 A;  2JFK A;  4ECU A;  2E9R X;  3A13 A;  2C2Z B;  2PMH A;  1RCO B;  4DL5 A;  4QCL A;  4WU3 A;  5A8K A;  1M0S A;  5HBM B;  5L38 A;  3P5T L;  3UCG A;  3HP6 A;  2CPJ A;  3KHH A;  1N5V A;  4KRW A;  4F0H A;  1JLQ A;  1QSY A;  2RVJ A;  2R3V A;  5A76 A;  1C1C A;  1HBN A;  2YH1 A;  1FNM A;  2OML A;  2YNG B;  1WC3 A;  1N5Y A;  1FI4 A;  5C25 A;  2YKM B;  3GYG A;  5EN1 A;  5HP1 B;  2G2O A;  2XWY A;  3KDN A;  4NA3 A;  2W4D A;  2DKO B;  1IKV B;  3W62 A;  1EQ0 A;  2R8G A;  2F8E X;  1KKH A;  3OFG A;  4UT4 A;  3BR8 A;  1SL2 A;  2F8M A;  3DFE A;  2DYA A;  2BKO A;  3A8E A;  3Q8R B;  3HJV A;  1WSR A;  2Z57 B;  2FZK B;  2IVF B;  2PMZ D;  2ROE A;  3TWZ A;  2AHO B;  1FES A;  2CQ2 A;  2VV5 A;  1QAX A;  4F7V A;  1D1U A;  4B9N A;  2YWG A;  1KFS A;  2FY1 A;  2M52 A;  4P6Q A;  4CO3 A;  5K8O A;  1S0M A;  2M8H A;  4E2F B;  3SXL A;  4MK8 A;  2Y1L B;  4CRJ A;  7AT1 B;  3LUY A;  1TAQ A;  4TN2 A;  3MCM A;  5EX0 A;  3R27 A;  3VQS A;  1AUD A;  3TVZ A;  5K8M A;  3GJQ B;  3EZO A;  2XTJ P;  3S8S A;  2OEK A;  3QO9 A;  4JBC A;  3AHP A;  4KHP F;  1UA0 A;  1TL3 B;  1WDT A;  2DIU A;  3PKM A;  4O4G B;  2EFO A;  2Q3P A;  2W8L A;  1SXL A;  2RML A;  5IC4 B;  1O5J A;  4B9T A;  2BW7 A;  3PV8 A;  2X51 A;  2CPI A;  1FTC A;  1RAA B;  4WU2 A;  4IH6 A;  1ARO P;  3MI7 X;  4PEO A;  5KFC A;  4Y2I A;  1E6Y B;  1FEH A;  4UOG A;  3BBB A;  4UZC A;  4USI A;  1SJQ A;  5J1N A;  2H5I B;  4DSE A;  1NSK L;  1RYS A;  2W7P A;  1UET A;  2GCF A;  2QE5 A;  3TUZ C;  4J9M A;  3GCX P;  4YFU A;  5B0F A;  2XCA A;  2G4B A;  3D0G E;  1X5S A;  1EP4 B;  1O8B A;  2BE9 B;  1BWV A;  4S0M A;  1C0U B;  3P5B P;  3MTK A;  1NK0 A;  1QUV A;  1CJK B;  2NRE A;  1T9X A;  2I1R A;  4CNZ A;  1XN9 A;  3KG4 A;  3JTO A;  2GC8 A;  3TJ9 A;  4K2J A;  4DV0 F;  1OYD A;  3GFH A;  3DRY A;  4WP9 A;  3M8W A;  1RHJ B;  2VKZ G;  3AJ1 A;  2MB0 B;  3PDN A;  3EDR B;  4AL6 A;  4PQU A;  5J2N B;  1ACM B;  3TO8 A;  3HK2 A;  1N36 J;  2CPY A;  1CQM A;  2DGX A;  2GGP B;  4RUC A;  4FF3 A;  2GAH C;  3W5X A;  4DR6 F;  4DR1 J;  4OI2 A;  2M7S A;  4DMZ A;  3J81 Y;  2KXN B;  1KOO A;  1NSQ A;  2NPF A;  3Q24 A;  2MKC A;  3O6Q A;  3BKU A;  3UI3 A;  2PT0 A;  2MDA A;  3T19 A;  2YNI B;  3LP0 A;  5HMY A;  4MKY A;  2VL1 A;  4M5K A;  2KHC A;  2V4J A;  2MZS A;  1HMV B;  4LSN A;  2ZH5 A;  1XMO J;  3RR7 A;  1VQ7 S;  3D67 A;  2M4M A;  2OD6 A;  2J0W A;  3CGI A;  1T05 B;  1QLN A;  1M5H A;  1NEE A;  4M5I A;  3HSD A;  1X7V A;  1CVJ A;  5E0O A;  2CRL A;  4MT1 A;  3SV3 A;  4ZPT R;  4YEA A;  1ZAV A;  1N52 B;  2B9W A;  4PG6 A;  3OBI A;  3CCJ S;  4BLG A;  5FDL A;  2QZ8 A;  5B7W A;  1REV A;  1HAR A;  3HX9 A;  2WON A;  4IFY B;  5HI7 A;  2ZJP Q;  4RW8 A;  3QRQ A;  4LIR A;  4B3T J;  2OSR A;  1RE1 B;  2RSQ A;  1GEH A;  2EG1 A;  3T1A A;  4KY3 A;  1DQ9 A;  3I0R A;  1S6Q B;  4HHU A;  2GHV C;  4KFB A;  1YRT A;  1VDH A;  4IG0 B;  3FEY B;  2UXB J;  3EXY A;  1Y3K A;  2HLU A;  5E2Q A;  4Y3C A;  2DNR A;  4CZC A;  2DR6 A;  5JJB A;  4ZA1 A;  1U0H A;  3B82 A;  2R2U A;  5KFT A;  3ZNJ 1;  2OFH X;  4LVO P;  2BRL A;  1AZS B;  3HFK A;  1CPZ A;  4RUB A;  4ER8 A;  3FFI A;  1SH0 A;  3GII A;  4JI6 J;  4B3S F;  2AEJ A;  4NL5 A;  2X7I A;  3KK1 B;  2O01 C;  2R7V A;  1ZZF A;  1HWK A;  2QGF B;  3M9M B;  2DR8 A;  1AUS L;  3BN4 A;  3PW0 A;  4RNH A;  2GO9 A;  2OPP B;  2VFV A;  4QJV A;  3PX0 A;  1IWA A;  4OYZ A;  2V63 A;  1X5T A;  1SC3 B;  1R0B G;  4O3S A;  3CTR A;  3CCS S;  1LKZ A;  2GMJ A;  1S49 A;  4DR5 F;  1JLF B;  3BM7 A;  4ZP7 A;  2CIM A;  5D3G A;  4ED3 A;  5U47 A;  4DV4 F;  1WJ9 A;  4DU7 A;  1H72 C;  1CS4 B;  1FRX A;  1Q16 B;  2YY3 A;  2HGN A;  1TL1 A;  3GIJ A;  1H74 A;  3I4P A;  3NP5 A;  2CZ9 A;  2LDI A;  1BQM A;  2W2P P;  1QSS A;  2GQQ A;  4DV5 J;  2ZIT A;  3CCL S;  2IVY A;  2VPZ B;  1RWN B;  2E5L F;  4LSL B;  2D9O A;  5ETS A;  4F02 A;  4CO2 A;  1TKZ A;  2CPZ A;  3MEE A;  4ALZ A;  2PE8 A;  2MLZ A;  5LXY A;  3ILI A;  1S59 A;  3NS6 A;  3BH6 B;  3V6K A;  3ZTO A;  4YB5 A;  3CIM A;  4ECZ A;  4C0H A;  2XG8 A;  3S7R A;  3MFH A;  1LK5 A;  1DHM A;  3ZZY A;  2RIJ A;  3OTO J;  4MMO A;  1WHX A;  3L95 X;  1U6F A;  1RZM A;  1WKL A;  1P8G A;  2IFX A;  3C8Y A;  2N3L A;  1T0T V;  3IRX B;  3OSP A;  1TEL A;  4ZHR B;  1QTM A;  2J7U A;  1T9V A;  1K44 A;  1S1X B;  4PAA A;  2QA1 A;  3DLG A;  5KT3 A;  2AIR B;  5K8N A;  3KK2 B;  1M5O C;  4N77 A;  2DPJ A;  2AEF A;  5J1E A;  4NCG A;  4WBF A;  4G6V B;  2ASY A;  2OPQ A;  1JLG A;  4LF2 A;  1YTY A;  3P8B B;  3H59 A;  4ZPC A;  2FC8 A;  2GAG C;  2ZM6 J;  2HK2 A;  4R5P B;  2R8I A;  4TY8 A;  5G0R A;  3R5J B;  2YX7 A;  2GHP A;  2WSC C;  2L9W A;  3EIC A;  2H65 B;  4HT7 A;  3TEG A;  4B3O B;  4IOA Q;  2CPX A;  4DQS A;  1UL3 A;  2QV6 A;  2MY7 A;  1NJW A;  3GFX A;  4NPO A;  4CCH A;  4JV5 J;  1X0P A;  1FD2 A;  1UVI A;  3M30 A;  3T5H A;  3LH2 S;  4DL0 C;  4C11 B;  1KP6 A;  3FDS A;  4L3N A;  2VH7 A;  1ZTT A;  5KG3 A;  5HRO B;  1H0H B;  1NB7 A;  2B51 A;  1QTN B;  2V67 A;  3CCT A;  3HXM A;  4IG3 A;  5D4O A;  3D3B J;  2MJU A;  2W24 A;  5M2P A;  1GTH A;  4MKA A;  2MXY A;  3FZB A;  4QWD A;  2HW3 A;  1KHV A;  1MWY A;  1X9W A;  3KG0 A;  3S1T A;  1VQS A;  4LR9 A;  3T41 A;  6AT1 B;  2VOO A;  1PYT A;  4FXD A;  4K5S A;  2EKY A;  3EVM A;  3V81 B;  2G2Z A;  3JSM B;  3GG1 A;  3LF0 A;  1H2V Z;  5AJ3 J;  4D3H A;  2IMW P;  4DSI A;  2DNH A;  1UVJ A;  1VYA A;  2X1B A;  3CJ8 A;  3MAA B;  5A8R B;  2IBO A;  4JI8 F;  1CQN A;  1G7C B;  4ID8 A;  1UEK A;  3CME S;  3CD5 A;  3PXG a;  4FYV B;  1HNZ F;  3I9V 9;  3D28 A;  4HDG A;  3NNC A;  3ET6 B;  5H1S V;  3MR2 A;  4OYO A;  2EC2 A;  3GZ7 A;  4LF4 F;  2DIS A;  1X5O A;  3M32 A;  2P9C A;  5CYJ A;  1B70 B;  4Q44 A;  2ASD A;  3MR7 A;  2CAD A;  3BSC A;  1NHK L;  4B02 A;  3PY8 A;  4I2P A;  4R0E A;  3SCK E;  2BDP A;  2HFV A;  3HSG A;  3R7B B;  4ZKA A;  1VJW A;  1X5P A;  5C42 B;  3A8J A;  3CC7 S;  4DR4 J;  3TI0 A;  2O1P A;  4X4O A;  1Q82 T;  1WC4 A;  3FBF A;  1RP5 A;  4C7Q A;  3UNG C;  2Z8Q A;  3HSZ A;  1LXJ A;  2W1B A;  4K4Y A;  2D3O 1;  1TV6 A;  3O1L A;  5L9N A;  4OYB A;  3K5N A;  5CYM A;  1RAB B;  2HMI A;  3NOC A;  4ICL B;  2C3P A;  2K7K A;  2YNH A;  2HZC A;  1UWB A;  2YKN B;  2B9E A;  2J9D E;  2I6W A;  1JLB A;  5I42 B;  4CLS A;  4ECQ A;  4URG A;  5K20 B;  2W9C A;  1I6J A;  1HLW A;  3C14 B;  3DDK A;  3KJQ B;  4J5O A;  1L5U A;  4DPU A;  2IA0 A;  2GZO A;  5KG0 A;  1NXI A;  1VQK S;  1BXN A;  1CJU A;  5LM7 E;  3H5Y A;  1N34 J;  1MN7 A;  1RAE B;  1WOR A;  4DPO A;  4O3R A;  2L3M A;  1X4E A;  2WZ1 A;  3UN5 A;  3KLI B;  4WTY A;  3KLG B;  3QGG A;  2NSB A;  4GKK F;  2RRA A;  2HQI A;  2ADB A;  1G2E A;  1UAW A;  2HND B;  3BPD A;  1BE4 A;  1U1Q A;  5HQ8 A;  3E01 A;  4JI4 F;  3I6P A;  2DB1 A;  4I0W A;  1VQ6 S;  2Q6C A;  1IN0 A;  2RU9 A;  2IYG A;  1FXD A;  4W90 B;  4JI5 F;  4IRK A;  1R8A A;  1I5O B;  2FJE B;  1LWF A;  4ZVG A;  4BC7 A;  2Z2M A;  4ILL A;  4QR1 A;  3G4S S;  4OI0 A;  2EFQ A;  5M2R A;  2VAS A;  4DR3 J;  3NS5 A;  1D8Y A;  3I31 A;  2CPH A;  3OJS A;  2E1C A;  2HS0 A;  3KG1 A;  1S5Z A;  3X1L B;  3EX7 B;  4M5N A;  5KFJ A;  1SC4 B;  3OVB A;  4NZ0 A;  2LQ8 A;  3PX6 A;  4LF6 J;  1JLC A;  3TAM A;  4ZLP A;  1PBA A;  1Q7L B;  3OD2 A;  3V4M A;  4DZD A;  5A0Y A;  5I3U A;  3M05 A;  4PWW A;  4HI1 A;  3ZTQ A;  2X1A A;  2K3I A;  2NZC A;  2IM0 A;  3VAK A;  1K8A T;  1E6V B;  1RHK B;  4JI3 F;  4ANC A;  1RT3 A;  3MM7 A;  4LQ9 A;  3FQL A;  1WOP A;  5I3P A;  5D0G A;  4O3O A;  1SV5 A;  3PJW A;  2CNN B;  2BAC A;  1YBT A;  4EBE A;  1YBU A;  1RTJ A;  1YJT A;  2W7A A;  3OL6 A;  2FLN A;  3AFG A;  1PJ5 A;  3PW2 A;  1S57 A;  3CJR A;  1GXU A;  2DGT A;  1NK9 A;  4K2X A;  4DLE A;  2MQM A;  1MW7 A;  2G13 A;  1ZTW A;  2XNR A;  4H4O A;  3VAI A;  5DET A;  2FZG B;  1DLO A;  1FK9 B;  2JX2 A;  4Q8F A;  1N32 J;  2JJ4 D;  2QMW A;  2F4V J;  3T1Y J;  4KO0 B;  4X64 J;  3P6Y C;  1CLF A;  5IM0 A;  3DKD A;  4TQR A;  1S77 D;  4A8W A;  2OTL S;  3NCQ A;  3MR5 A;  3N6M A;  4DI6 A;  2OEM A;  4DFM A;  2R4F A;  4FXW A;  1B4S A;  2G0C A;  3Q23 A;  3P49 B;  4B3R J;  3AOD A;  4YY3 J;  2AGQ A;  5HAN A;  3MMC A;  2ASL A;  2EK1 A;  3MMA A;  4MIA A;  4YOE A;  4DJB A;  4CO4 A;  4B9V A;  3EPG A;  5ITH A;  1JLA B;  4PWD A;  4M8L A;  3B6B A;  3DNC A;  4RL1 A;  1HW9 A;  1HBO B;  2K7J A;  3P3D A;  2IMO A;  1AA1 B;  3KOA A;  4OMF G;  4YHH F;  1RT6 B;  1NK8 A;  3J81 U;  1PAU B;  1VOM A;  2R7Q A;  4HL9 A;  2RDD A;  4JV0 A;  2W4P A;  4D3G A;  2XM3 A;  4GC7 A;  2L9D A;  1RT4 B;  4LRB A;  2KH9 A;  2FLL A;  3UD4 P;  4CLT A;  3R5D A;  4PCQ A;  4C8M A;  1YVF A;  3LP2 B;  4EFA C;  1DJ0 A;  1HPZ B;  5ETM A;  3K5O A;  3JQK A;  4UUW A;  3SQG B;  4P7T A;  1FO1 A;  2PI5 A;  2MLY A;  2K3K A;  3Q8V A;  4DDF A;  5EUH A;  2ROG A;  2HHU A;  3BB5 A;  3UD3 P;  1XTZ A;  5B0D A;  3WQP A;  3B54 A;  2CZV C;  4USW A;  1X9M A;  3D3C J;  3HVR A;  2YPY A;  4PRF A;  1TKT B;  2HWT A;  2MHN A;  3GV7 B;  4ED1 A;  1CC8 A;  2UVR A;  1RAD B;  1HNI A;  1Q8B A;  4JI7 F;  1TUV A;  1WG1 A;  3OT9 A;  1RWM B;  4P2M A;  1RWW B;  3ETM A;  2HVI A;  1RT5 B;  2GS8 A;  3KLE A;  1AXQ A;  3KHG A;  2XZW A;  3DOM B;  3UDE A;  4JUZ A;  2ZZM A;  2I5J B;  2P9G A;  3MCS A;  1F2H A;  3PHT A;  2C3Y A;  3HVW A;  1UPM B;  4X4Q A;  1QY7 A;  3PO4 A;  4DS4 A;  7FD1 A;  2B6A A;  3AA8 A;  2VFR A;  1S1T A;  1PBU A;  2HVZ A;  1KSP A;  1VQN S;  4XIU A;  4J9O A;  3J81 j;  2ZH7 A;  2QMU B;  5KT6 A;  1RTD A;  2UUW A;  1RWP B;  3GR1 A;  3DU5 A;  4QU6 A;  3RAM A;  2BJ3 A;  3V4I B;  3C2P A;  1EQM A;  4OHX A;  3UQS A;  2HAF A;  4ZLJ A;  3OSN A;  5E3A A;  3KLV A;  3CD0 A;  1WHY A;  1V5V A;  2Z0G A;  1IKY B;  5IQ6 A;  2COL A;  3PW5 A;  4EO8 A;  2NCK L;  3ICL A;  3UCZ P;  4ZJL A;  1RXO B;  1FXR A;  5IT9 Y;  1ITP A;  4X4R A;  4X4V A;  2DR5 A;  3DRR A;  2AGO A;  4DU8 A;  4RW9 A;  2QLW A;  5F8L A;  3T1H J;  3GIR A;  2R7U A;  1VQ4 S;  2JC0 A;  5FII A;  3E2E A;  4U7U K;  1W2I A;  2GMH A;  2PII A;  2X3G A;  4HHH A;  1PKU A;  1RI7 A;  3GJT B;  4GVB B;  3D1O A;  1RAG B;  3QSI A;  5LMU F;  1N5T A;  3D5M A;  3J7Y I;  2B7B B;  1U6Z A;  4LF8 J;  4C8Z A;  1I1G A;  3V6H A;  4OX9 J;  3NMA A;  2BV3 A;  3MR3 A;  3TAQ A;  1UCN A;  5A8K B;  3SCJ E;  5DG9 A;  2JEI A;  2MKY A;  3AB4 B;  4UY8 5;  2AU0 A;  4QWA A;  4UZB A;  5IQQ A;  1JNZ B;  4LBI A;  3QGP A;  4J9P A;  3BN7 A;  3SI8 A;  3DRS A;  3DU6 A;  2V8V A;  2FGC A;  2CUY A;  2M0G B;  3W8G A;  2VPW B;  1NUE A;  1C1C B;  2HHT A;  4I1T A;  1HBN B;  4H54 A;  3PTW A;  1N5Y B;  2LMI A;  5C25 B;  3DLL Q;  3PCO B;  5T14 A;  2HFZ A;  4DCJ B;  5ETP A;  2IHR 1;  3D6T B;  2EFN A;  4L73 A;  4LRA A;  2YWW A;  2E1P A;  2YWE A;  4UW2 A;  1Q95 G;  2FVR A;  4OHW A;  3TQE A;  3H0P A;  3T5K A;  2ILY A;  3GR0 A;  5SZT A;  1X4F A;  2U2F A;  1HD0 A;  3AQO A;  1S10 A;  2ROP A;  4IR9 A;  2ZNZ A;  2CG4 A;  3PFE A;  1D0E A;  2VIH A;  4B9L A;  2CJY B;  4QYZ J;  1VBZ A;  4HDH A;  4NLT A;  3H2L A;  2AQ4 A;  3RAX A;  1S7I A;  4Q8E A;  4ZOS A;  1B0P A;  2AYG A;  2QTW A;  1LWC A;  2E44 A;  3MGJ A;  4HR2 A;  3J7Y U;  1XEZ A;  3RRK A;  4J9S A;  3RW7 A;  3QO9 B;  3OR1 A;  2BMB A;  5KFL A;  2MKI A;  5KFS A;  4Y28 C;  3T9N A;  2Z2L A;  4LF5 J;  3QJP A;  3VHQ A;  4K5R A;  1QM9 A;  1TL7 A;  5L1I A;  5F8N A;  3DOK A;  3MAQ A;  2RRB A;  5CHC B;  2M88 A;  4RKU C;  2DVI A;  1VHF A;  2HIY A;  3KLF A;  2QSW A;  3KHL A;  3GQC A;  1ZOT A;  1NSP A;  4Y34 A;  2ZVS A;  3NGS A;  2MZR A;  1UKU A;  2WBR A;  3O2I A;  4E98 A;  1WEY A;  1RWK B;  3BKT A;  4O3Q A;  3JB9 k;  5BJR A;  4K4S A;  4ECT A;  3C66 A;  2IM2 A;  3S01 A;  1LFP A;  3LTO A;  3AA9 A;  3K5P A;  4EBD A;  2G9O A;  1FRL A;  3ZO7 A;  1UZH A;  1FTR A;  3IBW A;  1YJ9 S;  2R2T A;  1HL6 A;  2OJ3 A;  2UUB J;  1Q4R A;  2OH2 A;  2ZBC A;  3RYL A;  3T3F A;  1LWX A;  2QSF A;  4TLQ A;  1WEL A;  1L3V A;  4OFZ A;  3OL7 A;  2ZJQ Q;  2EW9 A;  1RLD A;  3BF4 A;  2FJW A;  4OYP A;  6FD1 A;  1XMQ J;  5DM6 Q;  1KC8 T;  4A4J A;  3FK4 A;  2IPO B;  2E1M C;  1DTT A;  1MRO A;  3U1M A;  1FJG J;  1G6B A;  4A46 A;  4RUA A;  3I82 A;  4QU7 A;  3QLH A;  2M8D B;  2HRU A;  3U27 A;  5KG2 A;  4X4S A;  3THT A;  2I38 A;  2M70 A;  2GJ2 A;  4Z2X A;  4WYL A;  3LP0 B;  2DRB A;  4MAK A;  3CMQ A;  3H2U B;  1ELO A;  2V4J B;  4Q43 A;  1TUG B;  4LSN B;  1ZBT A;  5F8J A;  4DBQ A;  3K8V A;  3IR5 B;  4FZV A;  1SKR A;  4ELU A;  5IC6 B;  3ZXW A;  4NEZ A;  3BDP A;  3AXK A;  2V5H G;  1DQA A;  1WI8 A;  5KFU A;  1NZ8 A;  4W4M A;  3K89 A;  1NH7 A;  1FER A;  4UOH A;  4ES1 A;  1FRH A;  2ZFH A;  2AJF E;  1G3O A;  2NXC A;  5D4P A;  3ZTP A;  1RT2 A;  2YTC A;  2K2P A;  1BD6 A;  5FDL B;  2OI2 A;  1REV B;  3T5J A;  2QL5 B;  1WHV A;  3UE2 A;  2DGS A;  3UDV A;  2WON B;  1BUX A;  1CUL A;  1J2V A;  4RW8 B;  2HHW A;  4OZ2 A;  1S9G A;  3C6U A;  1NK6 A;  4DOZ A;  3EGZ A;  1TZ0 A;  5ETL A;  4NML A;  4KFB B;  3CJT A;  5AXK A;  2HVH A;  2KL8 A;  2HRY A;  2XZT B;  5M2U A;  3CDW A;  1P9Y A;  1U0H B;  2CVE A;  1JX4 A;  4KT0 C;  2RF2 A;  3NNA A;  3MPU B;  2DGW A;  1N36 F;  4CLZ A;  2MKJ A;  5D6G A;  3OJU A;  3B4D A;  3FFI B;  2X1F A;  4P7V A;  4PKD B;  2XS7 A;  2OO4 A;  2MZJ A;  3MUT P;  3EUN A;  4DR1 F;  4A8S A;  1VBK A;  1SIW B;  2CFX A;  4IH7 A;  1FXL A;  2FHM A;  2FUG 9;  4NLR A;  4Y00 A;  2YX4 A;  1YJU A;  4W92 B;  4KH1 B;  1U24 A;  4I7F A;  3MEK A;  1WUU A;  2HLT A;  1VBY A;  1XMO F;  5DLG A;  1H38 A;  5D3G B;  3SCL E;  1T9T A;  2VBY A;  2J6S A;  3VAG A;  4ILM A;  2MZ1 A;  1UTA A;  4KGM A;  3GFZ A;  4DV1 J;  1TL1 B;  3DDI A;  4XTT A;  2QC3 A;  2KFY A;  1BQM B;  2Y1I A;  1FVQ A;  1DY3 A;  1U48 A;  3V2U C;  3OTD A;  1TKZ B;  3RBE A;  3MEE B;  1FRI A;  2N3O A;  3M2U A;  2L9N A;  2CQP A;  4UOF A;  1KQK A;  2VIC A;  4ECR A;  3GB0 A;  1NDL A;  3U1L A;  1D9A A;  4UUX A;  1RA6 A;  4B3T F;  1HKA A;  2FLP A;  4IDK A;  2VB6 A;  4LRD A;  4GC6 A;  4YN3 B;  3V6D A;  2FHK A;  2JEF A;  4L6V 3;  3TZZ A;  2KXF A;  4FF4 A;  3QSY B;  2NQP A;  3H5X A;  2UXB F;  3HDS A;  3W61 A;  4KGX B;  4MKB A;  3TA1 A;  5KFH A;  3W60 A;  2YX1 A;  2BYC A;  1TK8 A;  1LV5 A;  2CQ4 A;  3CMA S;  3LGH A;  3MAH A;  4ZN1 A;  3GYN A;  1OY9 A;  1RHR B;  2IRY A;  3EMT A;  3KUE A;  2ZBI A;  3AQP A;  3O8W A;  1ZA1 B;  3LAK A;  4JI6 F;  1UA1 A;  1WC6 A;  2XLK A;  4PUO A;  3DLG B;  3ISZ A;  5FJ4 A;  2BA9 A;  4P2X A;  4M5G A;  3NGK A;  3W64 A;  2XMK A;  5J1E B;  4NCG B;  2A2C A;  2NXJ A;  3PG9 A;  1Q78 A;  4CTA A;  5F9L A;  1NO8 A;  4ZP9 A;  2OPQ B;  1JLG B;  2B5J A;  1U4B A;  2KZM A;  4ATN A;  1RJJ A;  3QGI A;  3IM9 A;  1M1H A;  4F3O A;  2CJ9 A;  4TY8 B;  5G0R B;  1F3F A;  2CNO B;  3K58 A;  3PX4 A;  1ZM4 A;  1U1P A;  2R2S A;  1R0C B;  5C7P A;  3THP A;  1BY9 A;  3Q8Q B;  3D7S B;  3FMB A;  5KG6 A;  4V19 X;  2KN4 A;  3CJS A;  3TA0 A;  4DV5 F;  1HNW J;  3DLB A;  2LQ5 A;  1U45 A;  2BAB A;  4OQJ A;  5JVG Q;  1S1W A;  4HH1 A;  4MYT A;  1TKD A;  1MMD A;  4FNI A;  2RS8 A;  2ACY A;  1P1T A;  2DR9 A;  4IG3 B;  5DQH A;  5DO2 A;  2BKN A;  4DR2 J;  1VFJ A;  2DNZ A;  1NBE B;  4ETX A;  3OFE A;  4EUV A;  1YZ7 A;  3OTO F;  3PEJ A;  5E3R A;  1YJV A;  4LJM A;  4ZVE A;  3ELH A;  4I6Y A;  4CLK A;  2Y0B B;  5IT0 A;  4WFA Q;  4LQ3 A;  1U7L A;  4P2F A;  1JXE A;  3TAP A;  2LLZ A;  4FKY A;  3TVK A;  1RAO A;  2ZOM A;  4OLP A;  4C3K A;  2A10 A;  3CCQ S;  3PNI A;  3MUM P;  1NJY A;  5HVF A;  4EZ6 A;  1YG0 A;  5DDR C;  4LUB A;  2B43 A;  5GVQ A;  1IBK J;  4C48 A;  2AJQ A;  4OYI A;  2GVZ A;  2DNN A;  2ZKU A;  3H42 A;  4ZJQ A;  3H4D A;  4RBT A;  1N33 J;  2CDR B;  4NYO A;  1NCL A;  5L1J A;  1M90 T;  3QT5 A;  3M32 B;  5JMN A;  1HHT P;  2ZM6 F;  4DL7 A;  1T02 A;  1M5V C;  1VRT A;  1M5P C;  3IAM 9;  2DNQ A;  4GRS A;  4RJV A;  5T41 A;  2XMT A;  2HFN A;  3NG8 A;  2FPH X;  4MH8 A;  4I2P B;  3I56 S;  3BBC A;  2BBE A;  4IO9 Q;  4FP9 A;  2O3D A;  2ZH4 A;  1GH8 A;  3VGS A;  4XDD A;  2ZH8 A;  3PIO Q;  2ZOG A;  3DXS X;  4LSZ B;  3CJ5 A;  3Q2T C;  1URR A;  5CA5 A;  2KG1 A;  1TV6 B;  3K0J A;  1SH2 A;  2DH7 A;  1F6T A;  2CNL B;  5CYM B;  3OTB A;  2AGP A;  2DNL A;  2H51 B;  4P75 A;  2VPX B;  2HMI B;  1EKS A;  3DHW C;  2YNH B;  2JOQ A;  3VAM A;  3ILL A;  2FY8 A;  3M8R A;  1UWB B;  3GIK A;  2XO7 A;  3O3L A;  3JSB A;  1PCA A;  4ANE A;  2ZE2 A;  2AD9 A;  1FJE B;  1JLB B;  3ENQ A;  2EBE A;  2MHE A;  2NUU G;  2W9C B;  4Y6I A;  1NSA A;  5CXT A;  5IT9 U;  2E5H A;  2EK6 A;  2ZHB A;  3C6T A;  4HVZ A;  3RU0 A;  5F3T A;  5AJ3 F;  2IC3 A;  2OPS A;  1MMN A;  1LEO A;  4KH0 B;  1CJU B;  3QIP A;  4ED0 A;  3QJJ A;  4M5D A;  1X4C A;  1KVI A;  1X8D A;  4W98 A;  4ZVQ B;  4JI2 F;  2C3O A;  1S99 A;  2QRR A;  2L08 A;  1Y10 A;  3EDQ B;  1K1S A;  2V4Q A;  3E01 B;  2QYC A;  3V5R A;  3G8T A;  3TZW A;  3MM9 A;  1YIT S;  2MEW A;  3BPS P;  4KHP J;  4PG5 A;  5HLF A;  2A6O A;  4GO5 X;  3KNG A;  2LA4 A;  3UDL A;  3WIU A;  2RIL A;  2V34 A;  1LWF B;  3D66 A;  2HBR B;  2DNG A;  3F44 A;  1HQE B;  5KFY A;  3Q22 A;  2Z30 B;  3KK3 A;  4OZN A;  2YVS A;  4DR4 F;  4MIB A;  3N28 A;  2GFF A;  4N8N A;  1SJ4 P;  3NMR A;  2IY5 B;  5BR8 J;  3AOB A;  4LF1 A;  3WX4 A;  5K14 A;  3OFH A;  1JNR B;  3IG1 A;  5KG1 A;  1R0A A;  2M9K A;  3RJM B;  2VF3 A;  3W2W A;  2XWX A;  2RQC A;  3CCR S;  4HTI A;  5HP1 A;  4X66 J;  1DUR A;  2CPE A;  1HHQ A;  3OTE A;  1R43 A;  1JLC B;  3TAM B;  3GIM A;  2EEY A;  1X9S A;  3CT9 A;  1PC4 A;  1W25 A;  2A18 A;  5A0Y B;  1C1B B;  4U9R A;  4DF8 A;  1UJ6 A;  2DXE A;  4O3N A;  3CW2 C;  4M63 A;  3UFC X;  2YPZ A;  2R7W A;  4G65 A;  5HMW A;  4F0M A;  2KT2 A;  1GX5 A;  5LSR A;  2KTQ A;  2QT7 A;  1VHI A;  3MM7 B;  2MST A;  2RDI A;  5CD4 A;  2LXI A;  2RAQ A;  3K7R A;  1N34 F;  3CSK A;  1DQ8 A;  1SV5 B;  4KYZ A;  2ATL A;  2YWF A;  1NDC A;  2AF6 A;  1VC5 A;  2Q66 A;  5EHH A;  2ZBP A;  4ERD A;  4ZK7 M;  2QG9 B;  3GJR B;  4A47 A;  1RTJ B;  1NJX A;  3TUI C;  2JSX A;  1XNR F;  5F8I A;  1IM6 A;  5I4M A;  2V9W A;  1B64 A;  2C42 A;  3JS9 A;  5B0C A;  2Q6B A;  2ZUA A;  3BYR A;  3D2W A;  3R2D J;  1SUQ B;  4H4O B;  1DLO B;  2KDO A;  2FTR A;  1U26 A;  4FYW B;  4KPC A;  4H4M A;  4WFX A;  1LW2 A;  4F3Q A;  4MJK A;  5J1P A;  1YSJ A;  3C3L A;  1EX8 A;  5G4D A;  1T3O A;  4MKV A;  5J2Q A;  2W7O A;  5IM0 B;  2UUC J;  2P2C B;  4OI1 A;  2HNZ A;  1VC0 A;  3FBE A;  3OUY A;  3SFG A;  3VCD A;  4DR3 F;  5HMX A;  2DR7 A;  2MKK A;  4LT6 A;  1IWG A;  1KLM A;  5IXU A;  3MM5 A;  3LAN A;  3UR3 C;  2WRM A;  2YWH A;  1Y0H A;  3UWT A;  2P8I A;  1GK8 A;  2F9J A;  1M5K C;  2GNK A;  1VJQ A;  3MMC B;  3UDC A;  3QJL A;  1UJ5 A;  3NNH A;  1F1B B;  3MMA B;  2Y0S D;  2QA4 G;  2OIH A;  2HK3 A;  3GG0 A;  4LF6 F;  2JLE A;  4BHQ A;  4NLY A;  3W65 A;  4DQP A;  2CDQ A;  4NXM J;  2AX0 A;  3TR5 A;  2CVI A;  3G8Q A;  2FVQ A;  2J76 E;  4J9L A;  4PWD B;  4ELV A;  3R5G A;  2GQC A;  1VLY A;  2ZBQ A;  1VIS A;  3RB4 A;  3OXL A;  1OJ4 A;  4OX6 A;  3Q0A A;  2F8H A;  4O44 A;  1O6X A;  2IDE A;  2NXE A;  2HS4 A;  3HSJ A;  5CYQ A;  1HWI A;  1S12 A;  5JUM A;  5KFR A;  2XB2 D;  1L3U A;  3DLJ A;  5CQG A;  3BJY A;  3MPY A;  5B09 A;  4RPF A;  1GAO A;  5GME A;  1Q8L A;  1JK9 B;  4MFB A;  1I51 B;  3T5L A;  2VDI A;  3H90 A;  2ZOF A;  3IS9 A;  2GHW A;  3KJN B;  1RA7 A;  3ZTR A;  4NXN J;  2VFU A;  1RAI B;  2XHC A;  5A8W A;  1N32 F;  3MXH P;  1HMV A;  3MPW A;  1NZA A;  1R8P A;  2F4V F;  3T1Y F;  4ED6 A;  5KFB A;  2DRD A;  1RTH A;  4AUK A;  2RU3 A;  4C8K A;  2G2Y A;  5K5M A;  3W7B A;  1VQ8 S;  2EWH A;  2YKP A;  3PVX A;  5HVG A;  2QMX A;  4ZIV A;  3VAF A;  3DN9 A;  2QIF A;  2VBW A;  3OFF A;  1HNI B;  4OZL A;  5DG8 A;  2RHQ B;  4B3R F;  1T9U A;  3HHL D;  3JXO A;  4CNY A;  1J5O A;  4ZIT A;  2FIU A;  3J80 Y;  4Y65 A;  1Z2Z A;  3HZE A;  4IR1 A;  2D1C A;  3QFW A;  3KLE B;  3AH6 A;  3DM2 A;  2PA3 A;  2I0X A;  4OZ1 A;  3RG6 A;  1ZAW A;  1F5A A;  2ZD1 A;  3FNN A;  1T03 A;  3KDO A;  1QVF R;  1G4C A;  2F5G A;  3TYT A;  4PZV A;  4NZ7 A;  1SJ1 A;  2B6A B;  3N01 A;  3CPW R;  5L1K A;  3OHB A;  4OI4 A;  1S1T B;  1RYR A;  1RLC L;  2HUR A;  5H9E K;  1RTD B;  4LFC J;  1K0T A;  1PIE A;  1YWX A;  5HN0 A;  2DGV A;  3H2V E;  3WC2 A;  2K8G A;  2KRB A;  3CVK A;  4DR7 J;  3JSY A;  3MED A;  4DCP B;  3GPA A;  1W26 A;  4AXJ A;  3N4W A;  4KR0 B;  2IIH A;  2LEA A;  1FFW B;  5KFO A;  2A6M A;  1N6Q A;  3G9C A;  5HAT A;  2DO0 A;  3C16 A;  2RE1 A;  2F3J A;  2J9E A;  2HFU A;  3DRR B;  2DT9 A;  4I6A A;  4RW9 B;  4WKY A;  4OLO A;  4HYK A;  1VQ5 S;  1IVZ A;  1RK8 A;  3V6J A;  1MG7 A;  3DLE A;  1NHU A;  2HVD A;  5DDQ C;  4OV6 A;  2XUL A;  2YWK A;  3O5T B;  2UZA A;  3C15 A;  4RNN A;  4RNF A;  4WE1 A;  2C2O B;  1B7Y B;  1I3O B;  3PRB A;  2L48 A;  3VF0 B;  1I94 F;  2X1G A;  2JL9 A;  4U7U D;  4DSK A;  2UP1 A;  2HBZ B;  3QAU A;  2UXC J;  2A2D A;  4J9N A;  1Y5N B;  3UN2 A;  4PXE A;  3FEZ A;  3LQV A;  3DRS B;  3IR7 B;  3PRD A;  1N4L A;  4B9S A;  2XMU A;  2BJ1 A;  1PO6 A;  4ENO A;  1H6K X;  5RUB A;  3Q8U A;  4NLQ A;  1B0V A;  1ZS6 A;  1VIX A;  2WVE A;  2PD1 A;  1RHU B;  3QBC A;  1OYE A;  3CNQ P;  4RWW A;  1T11 A;  2KU7 A;  1PAE X;  2B8P A;  1RSC A;  1HIY A;  3KXD A;  4A8Y A;  2IJN A;  4DWI A;  4OZ0 A;  4P9S A;  3PYF A;  2NYI A;  4DPX A;  2HHX A;  3IBC B;  4KE5 A;  2PEH A;  5AE2 A;  4DXL A;  3TRG A;  4KSE B;  2LEP A;  4DL3 A;  3LPE A;  4CM0 A;  5KG7 A;  2RQM A;  3EXC X;  3BGR A;  1OWX A;  2KZZ A;  1HNZ J;  3TX8 A;  3OL8 A;  2W8K A;  1LWC B;  2FVC A;  3BGL A;  3MR6 A;  4CDI A;  4F8R A;  4U96 A;  1VC6 A;  2HZV A;  1D9D A;  3OW2 R;  2O67 A;  3T1H F;  4KTQ A;  3W1Y C;  2WSE C;  4QWB A;  3OR1 B;  1YJ7 A;  5LMN J;  4EI2 A;  1WG4 A;  1TL7 B;  3DOK B;  2OEJ A;  2LP4 A;  3DGV A;  1LW0 A;  1S6P A;  4FDF A;  2K1R A;  2D3O R;  1SKS A;  3KLF B;  4OX9 F;  3FC9 A;  4J37 A;  4WP3 A;  3EVW A;  2HGL A;  2OUG A;  4OZ3 A;  2RB7 A;  2IDL A;  4RW4 A;  5CZV A;  1F60 B;  1D3W A;  3A1Y G;  1Q81 T;  4WFB Q;  5ETR A;  1S4E A;  1DFD A;  2YKO A;  2IA6 A;  2HIQ A;  4USJ C;  3WX8 A;  4X4N A;  2D69 A;  4HI2 A;  5F8H A;  3LO3 A;  3SFU A;  2B3T B;  3LOU A;  1DBD A;  1JJC B;  4PYA A;  2QJ3 A;  5KFZ A;  4BBY A;  3GSI A;  1KD1 T;  5KFX A;  3HHN B;  2VQF J;  3WZ0 A;  3V81 A;  4J91 A;  3CED A;  4N47 A;  3DLK A;  1FDB A;  1WEZ A;  3CXC R;  3RBZ A;  4B9U A;  2OSQ A;  2V2K A;  1WHW A;  4MYU A;  1RKJ A;  2WW4 A;  1SIZ A;  2HRT A;  2P6T A;  3GSD A;  2FVS A;  4KAI A;  3GWC A;  3QT7 A;  1X4D A;  1URN A;  2XBP A;  4DF4 A;  1NDP A;  3Q8Y A;  1Y3J A;  4DFJ A;  1UVL A;  1DTT B;  1MRO B;  2C2N A;  4F26 A;  1N8R T;  2XS2 A;  5BYQ A;  2MY8 A;  3QLH B;  4X65 J;  1X4H A;  1R27 B;  2LDY A;  2FHJ D;  4LF5 F;  3GP9 A;  1WOO A;  1U2C A;  2V8G A;  5GAG I;  1HBM A;  2MQO A;  4UF4 A;  4DX6 A;  3G6X A;  4UY8 T;  4K4Z A;  3HHL C;  3W63 A;  4I2Q A;  3VGU A;  2YXL A;  4NI2 A;  1NPR A;  4J9R A;  4PWU A;  1KWM A;  3AD8 C;  1FT8 A;  1ZA2 B;  4YS2 A;  2XSJ A;  4QBU A;  1MWZ A;  2WHO A;  1IBC B;  2XMJ A;  3NEK A;  1RT2 B;  1AFJ A;  1UW4 A;  1TVR A;  2CQC A;  3TP2 A;  2GV1 A;  3CJ0 A;  1KVJ A;  1CUL B;  4HKQ A;  3FRY A;  4ZCK A;  8AT1 B;  3R9L A;  1GXL A;  1S9G B;  4K0K F;  4DN9 A;  1NU4 A;  3C6U B;  3D6H B;  5I42 A;  1S6U A;  4KKO A;  4YQW A;  5HJY A;  2UUB F;  3LGM A;  2HG4 A;  2J0Q D;  3JYT A;  3VZH A;  3IMQ J;  1R6Y A;  4OJG A;  1RU1 A;  3ZZU A;  2BM0 A;  4WXW A;  1R31 A;  3F0N A;  4YDX A;  3ETO A;  2RF2 B;  1XMQ F;  4JI0 J;  4C4W A;  3CWJ A;  4EBC A;  2AJ4 A;  2B9Y A;  4NMX A;  2VDH A;  2OKQ A;  5GAG U;  3M8Y A;  1FJG F;  4TYA A;  2HFS A;  3B8H A;  1U1L A;  2HQG A;  3S6E A;  3CCE S;  1RWV B;  2B4P A;  5GAE I;  3RB3 A;  2HHV A;  3VAL A;  2ACM A;  4I7F B;  1YQH A;  4EO6 A;  3KTQ A;  4C8L A;  2G0I A;  3LAM A;  1YGY A;  1BQN A;  3W3S A;  1S6O A;  2FJB B;  4DCO B;  2WB4 A;  3BDE A;  4M5M A;  2LCW A;  4ID5 A;  3I5C A;  4B08 A;  4G1I A;  3T9Z A;  5GAH I;  4M95 A;  3CJK A;  2DPI A;  4XK8 C;  5MAO A;  4KB7 A;  4IO1 A;  1S9E A;  3TJ8 A;  5DLF A;  1TKX A;  3ZZO A;  1VS3 A;  3KKF A;  1P27 B;  2GIQ A;  3M2U B;  4DSL A;  4KBI A;  3AY0 A;  4QIE A;  2P6S A;  3J7A 1;  3BGF A;  2PEB A;  2RNE A;  1JLE A;  4C97 A;  4RW6 A;  4X62 F;  2E7V A;  2OPR B;  4IDK B;  1IJF B;  3FQK A;  2HQC A;  3V6D B;  4QR2 A;  5E3Q A;  1EHW A;  2JRS A;  2JLF A;  1J5E J;  1HI1 A;  2OP5 A;  4PG7 A;  1FNO A;  1VMB A;  1PG5 B;  3W8P A;  1SJR A;  1S4F A;  1KRP A;  2MTL A;  5GAE U;  1RAF B;  2O66 A;  1WTF A;  3BGU A;  1H73 A;  2KKH A;  2ZJR Q;  2GQ2 A;  3FBC A;  2C22 A;  2AT1 B;  5AE3 A;  1FVS A;  4JP8 A;  2R7X A;  5C2C A;  1VQL S;  4QWC A;  4PUO B;  1FA0 A;  2XEX A;  1MU2 A;  3RB0 A;  4FN5 A;  1XNQ J;  4IKA A;  1EJ7 L;  2UU9 J;  4CTA B;  3ZNU A;  2B4O A;  4WJB A;  4OYX A;  5GAH U;  3HMJ G;  3OR2 A;  1U2R A;  2B5J B;  1UP1 A;  2BJD A;  5LSL A;  2ALZ A;  1NB2 A;  2DH9 A;  2KJW A;  4L74 A;  4ED4 A;  4RBU A;  3OQ2 A;  2W2Q P;  4XAK A;  1QSL A;  3MWB A;  4NLO A;  4K50 A;  5EWE A;  3CO0 P;  3D0H E;  4NLU A;  4DV1 F;  4DPT A;  3CB4 A;  2RD5 C;  3JQJ A;  4AQY J;  3WIV A;  4USU A;  2CJK A;  2MQQ A;  1PSD A;  3HHL A;  3H40 A;  3HFV A;  3NL0 A;  2LXF A;  3PJX A;  3VR1 A;  4OIX A;  1U1M A;  1TAU A;  1U09 A;  1BLU A;  1S1W B;  5LSO A;  2BW2 A;  3HO1 A;  2KYX A;  3FMW A;  3UN3 A;  1P9Q C;  3SV4 A;  4DX7 A;  4RUH A;  3HD1 A;  1X4G A;  4PPZ A;  1ZH5 A;  3NWG A;  3CC4 S;  1XMB A;  3SEO A;  1IR1 A;  1Y5I B;  3PW7 A;  4L3K A;  2GIR A;  2DNO A;  1KTV A;  4J9Q A;  1UEU A;  5L39 A;  2B8Q A;  3CCW A;  3EZU A;  3A4T A;  2YKQ A;  2UVU A;  4LMZ A;  2NPI A;  1WI6 A;  3EJM A;  2AYM A;  3G86 A;  3H5U A;  4FYD A;  4NA1 A;  3OTC A;  3SBM A;  2OEL A;  2QN6 B;  1NKE A;  1HPZ A;  1N56 A;  2HHP A;  4I56 A;  1JMT A;  3CJ2 A;  1FEE A;  4C2M A;  2VZ9 A;  2CG8 A;  2A1B A;  2GVZ B;  1LXN A;  2M3D A;  2MMY A;  3SZ2 A;  3ZC4 A;  1OSD A;  2OMO A;  4LF9 J;  1IJE B;  2QLJ B;  1BC6 A;  2PFF B;  4KGZ B;  3J80 U;  2F40 A;  1VRT B;  4ZN3 A;  1C4A A;  2DTJ A;  2HHQ A;  2BAN A;  1K73 T;  2CZ4 A;  2PFD A;  1TR0 A;  4I67 A;  4PR6 A;  2R7T A;  3TUP A;  1PJ7 A;  5F8G A;  1C0T A;  1HNW F;  2BE2 A;  1KBR A;  4H4K C;  3PEH A;  4M5H A;  2ZUG A;  4WPA A;  3HVT A;  2LQB A;  4OJ3 A;  2R8K A;  1KS2 A;  2V2V A;  2IAJ A;  1SC6 A;  1S9F A;  1AT1 B;  3TW0 A;  5DGA A;  1HNV A;  5CCL A;  3SYZ A;  4CLU A;  2BEF A;  4DR2 F;  2OLW A;  4LR7 A;  4AT1 B;  1GTE A;  1YRU A;  5K9F A;  4RBV A;  4DX8 H;  2ZE2 B;  2X3D A;  1UZD A;  4QYR A;  2VC0 A;  3NBP A;  2AZ3 A;  1K47 A;  1FRJ A;  3UVJ A;  3C6T B;  5ETN A;  2IC3 B;  2OPS B;  3PR5 B;  3QQC D;  3TA2 A;  4Q2M A;  4C0B A;  3QIP B;  4ZLL A;  2BZ2 A;  2CQ0 A;  2FC9 A;  4M5D B;  3MMB A;  4PXB A;  2WOM A;  5DDO C;  4PXC A;  3LP1 A;  4I6W A;  1WC0 A;  1IBK F;  2JC1 A;  4QIV A;  4ECV A;  3DYA A;  2XHW A;  2MSS A;  2F9D A;  2WVC A;  5THW A;  1N33 F;  4A48 A;  4P52 A;  5KFA A;  4CO0 A;  3MM9 B;  1ZET A;  2EVZ A;  5HLF B;  1IKX A;  3MZI A;  4KQZ A;  3FBB A;  5DM7 Q;  4OX7 A;  1RAC B;  2V6A A;  3QWP A;  1MN9 A;  3BSA A;  3K59 A;  4LFA J;  4FYX B;  1RHQ B;  3RW6 A;  4JB8 B;  4HTJ A;  2WVF A;  4Q0B A;  3KK3 B;  2IRX A;  1HW8 A;  2NS1 B;  3A12 A;  2M5Y A;  4YB1 P;  1TFY A;  4F4A A;  4YR3 A;  2Q1L A;  1UW9 A;  1NJZ A;  5LJ5 Y;  2QX0 A;  4WXO A;  1BHN A;  1NK5 A;  1Y00 A;  5K14 B;  8RUC A;  1RAH B;  2VA3 A;  3IG1 B;  1R0A B;  2DNM A;  3FEX B;  2AJ1 A;  3W2W B;  3WHI A;  2XY6 A;  3BQ2 A;  2ZZT A;  3NLC A;  3GLJ A;  3K17 A;  5ETK A;  1NRK A;  2RHS B;  2DHG A;  2ERR A;  1NHV A;  4DL2 A;  1F3V A;  3UPF A;  3A3N B;  3DRP A;  2OFG X;  3PO5 A;  5DQG A;  5KAK A;  2KFN A;  4USK A;  2W9B A;  3MEG A;  2DHX A;  4LRE A;  2IJR A;  4XO0 A;  5IWA J;  2GVD B;  4N7T A;  1IKW A;  3W66 A;  3FCV A;  3BSO A;  2N7C A;  4ED8 A;  2DY9 A;  3D68 A;  1UFW A;  2NLW A;  1BQX A;  2C2D A;  5BYR A;  1HFE L;  4BC9 A;  4LF7 J;  4ECX A;  2VG5 A;  4O0I A;  4PXD A;  4NCB A;  3OL9 A;  3K5L A;  2DIV A;  5LJ3 Y;  4NLP A;  3VV2 B;  3EM1 A;  1D8Z A;  3PR4 A;  1DTQ A;  3NRB A;  1SPB P;  1JKH A;  1Q79 A;  5H9F J;  3DLH A;  2PA8 D;  3R3T A;  4H4M B;  2FHJ A;  2V94 A;  1FKP A;  1LW2 B;  2NUH A;  3OV7 A;  3ZZP A;  1JXL A;  2V0N A;  3QRP A;  1H3D A;  2KM8 C;  4DFK A;  1ZM9 A;  3TUJ C;  5J2Q B;  1FWL A;  2FGO A;  1MNE A;  1OY8 A;  2HNZ B;  3OUY B;  1L3K A;  2LVW A;  5J2M B;  2AJ2 A;  4F4K A;  4DSJ A;  2LEB A;  2Y3Y A;  3OPK A;  5DRK A;  1KLM B;  4FF2 A;  3MM5 B;  4ZPD A;  5BR8 F;  5B0G A;  2JH3 A;  3WC0 A;  4H4K A;  4HH0 A;  3DOL A;  2E7X A;  2VPY B;  3VGT A;  3CUN A;  1PC5 A;  1YI2 S;  4X66 F;  1F0X A;  2FDN A;  1WF1 A;  2CJQ A;  2J8S A;  1C2P A;  4QZV B;  2XMM A;  3FUY A;  4AL7 A;  5LT5 A;  3ULH A;  3MPV A;  5GMD A;  2MQP A;  4F4W A;  2WSF C;  2KVQ E;  4ZVO B;  3KYL A;  2M2B A;  4ECY A;  3HHD A;  1SJ3 P;  4HHJ A;  4OI6 A;  3PM9 A;  3VVU A;  4U6P A;  1IBL J;  3MM8 A;  4O44 B;  2N4D A;  4X4T A;  5CYQ B;  2HHH J;  3G6E S;  5SUH A;  5F41 A;  2YNF A;  1VK8 A;  1WF2 A;  3AAW B;  2ALY B;  1U8W A;  4F25 A;  3M2V A;  2Z58 B;  3PIP Q;  4MFB B;  1RKI A;  4O3P A;  3MM6 A;  2C28 A;  1IUJ A;  2PMW A;  2PDA A;  3M2R A;  5I3Q A;  5F0U A;  2MZQ A;  4WZM A;  3IS9 B;  1T95 A;  4MK7 A;  3GU0 A;  3QAE A;  2IBK A;  3BH7 B;  3W2V A;  2H1Y A;  2RS2 A;  1U47 A;  2D74 B;  5A8W B;  3KLH A;  1CJT A;  3W5Z A;  3A3O B;  2CPD A;  1RTH B;  3N9U C;  2BKP A;  4ED7 A;  5DG7 A;  2UUC F;  3H4B A;  3FSY A;  1S76 D;  2XYP B;  4M94 A;  2CPF A;  5E33 A;  4J9V A;  3VWS A;  1CSJ A;  3CJ4 A;  1HBU A;  2R7O A;  3KUH A;  1J5O B;  4A8O A;  4P74 A;  3TNV A;  1QVG R;  1U8S A;  1Z1Z A;  3MD3 A;  3DM2 B;  3DHX A;  3VAH A;  4X4P A;  1QD1 A;  2AV5 A;  4FXV A;  5A6P A;  2ZD1 B;  1H98 A;  4NXM F;  1T03 B;  4DUT A;  2SXL A;  1FX2 A;  2ZWP A;  3FKB A;  1SB6 A;  3GFY A;  1VLO A;  2H4Y B;  2BUN A;  1EZZ B;  4G1Q A;  5C24 A;  4QW9 A;  2EXU A;  1JLQ B;  4OX8 A;  3IO1 A;  5D0H A;  2AJ0 A;  1YRX A;  5J2P A;  2YQ1 A;  5FLX Y;  4XPC A;  2ZH2 A;  4C3L A;  5GMK a;  1CJV A;  3K2Y A;  1EAY C;  5KT4 A;  4ZVS B;  4ILR A;  5CZX A;  4O4R A;  4A8K A;  2HQ3 A;  3MED B;  4OZ5 A;  3W9I A;  3US5 A;  2LYV A;  2Y1R I;  1WSV A;  1N6Q B;  1L3S A;  4ECS A;  3C16 B;  1ZPV A;  2UV8 G;  4NXN F;  4NWB A;  3JTP A;  5AT1 B;  3U7J A;  4AND A;  1HR0 J;  2LXU A;  2YKA A;  2FZC B;  4OJH A;  1RTI A;  4DV2 J;  2VJU A;  1S1U A;  4LVN P;  1NND A;  3AD7 C;  3QZ7 A;  3FGV A;  3M8Z A;  2CQ1 A;  3DLE B;  4USM A;  4DX5 A;  4PG4 A;  1ZYQ A;  1P6T A;  1H2U X;  4F0K A;  4K4W A;  4PYD A;  2U1A A;  3L7U A;  3C46 A;  2E9T A;  3PRV A;  1HNX J;  2MQN A;  3C15 B;  3QFH A;  3SQO P;  3FCH A;  3I87 A;  4WE1 B;  2MJN A;  2VKR A;  1F9E B;  2BQU A;  1EB0 A;  2BRK A;  2GW8 A;  5D0E A;  4FNH A;  4R8U A;  3G71 S;  4K4U A;  4KHM A;  4PG8 A;  2CKW A;  3RR8 A;  3SSS A;  5EGY A;  1NKC A;  1T8E A;  2C2R A;  3KMS A;  4HAC A;  5FD1 A;  3R5B A;  1KOH A;  2MYF A;  1DAR A;  1U1K A;  1RBL A;  3CC2 S;  3U1N A;  2HFO A;  2HS3 A;  2RJZ A;  5EWG A;  3HPO A;  2R9L A;  4ZVF A;  1IBM J;  5E3P A;  1K1Q A;  2D3U A;  1TP7 A;  4LFC F;  3BSN A;  3I5A A;  1NK7 A;  5KG4 A;  4CIO A;  3WDO A;  1ZZN A;  3C19 A;  4DR7 F;  3BO2 A;  2QA4 S;  2DD8 S;  1YIJ S;  1OPZ A;  3N6N A;  3KWM A;  4NYP A;  2E5G A;  3G82 A;  2GO8 A;  5IFM A;  1N88 A;  3D1Q A;  2UV8 A;  4B3M J;  1Q8K A;  3BGR B;  2KJV A;  1Y9O A;  3B78 A;  3IWN C;  4NX9 A;  3L09 A;  3NKY A;  4IOC Q;  3N6L A;  1BWE A;  4DQI A;  3QZ8 A;  4RW7 A;  4DUY J;  4NLW A;  4PQU B;  3LW5 C;  2G1D A;  2EC0 A;  4ES2 A;  4RNM A;  4QPT A;  4EMD A;  1YX2 A;  1REG X;  2J7W A;  1TQL A;  2HSE B;  2GJI A;  4GVL A;  1Y11 A;  4RNO A;  2F4F A;  2DCL A;  1G1X A;  1XR7 A;  1TK0 A;  4IFV A;  2DK2 A;  1LW0 B;  1S6P B;  2K1R B;  3GIL A;  3N0V A;  3IGV A;  1YHQ S;  4LFB J;  1VIO A;  1T3N A;  4RW4 B;  2UXC F;  3BEG B;  3PJ9 A;  4MK9 A;  4M5J A;  4JV2 A;  3VVT A;  2W4C A;  2WVD A;  3M8S A;  4G3I A;  3HCX A;  1JIH A;  4AXI A;  4CI0 B;  2H48 B;  1KFD A;  5D77 A;  1R8H A;  2DJW A;  3NCR A;  2DCU B;  2AMC B;  4A8M P;  2UVV A;  2ZVI A;  4DPY A;  4ZP6 A;  4ZIW A;  2J0S D;  3DLK B;  4CYU A;  1U1O A;  2BJ7 A;  5T7L A;  2W2N P;  3CD7 A;  1Q1K A;  3DI6 A;  1HWU A;  1M5S A;  4AYB D;  2CXE A;  2Z56 B;  3KJV A;  2HYI B;  3TZX A;  3I0R B;  5MLC V;  3M1V A;  1GMW D;  2JZ5 A;  1YJN S;  2WB1 D;  5DZ6 A;  3J7Z 5;  3LA0 A;  5KFF A;  2KI2 A;  3PFO A;  2NSC A;  1RT7 A;  4MIW A;  4JI2 J;  2DGU A;  4BDP A;  2Z2Y B;  3TOQ A;  4RX6 A;  5HMZ A;  2VQE J;  1WC1 A;  4IQM A;  1CEZ A;  3JQM A;  1XC9 A;  4RU2 A;  4TY9 A;  3Q2S C;  2UUA J;  5IT4 A;  4FS1 A;  1NLK L;  1K0V A;  1KON A;  1HQU A;  5LMN F;  3BR9 A;  2EG2 A;  3UW1 A;  4AFF A;  2DGQ A;  3ITH A;  5DS7 A;  4P73 A;  1FWK A;  1HBM B;  4JI1 J;  2DEI A;  2ZH1 A;  2AZ1 A;  4F50 A;  4I2Q B;  4J9U E;  4OI3 A;  3RGI A;  4NI2 B;  4Z7C A;  1FE0 A;  2D7S A;  4CT8 A;  2HWI A;  3M8Q A;  2XSJ B;  4C6A A;  2QLF B;  2J9C A;  2W2O P;  1KHW A;  2XI2 A;  5A2Q Y;  4C8Y A;  5E5N A;  1S1V A;  3QWU A;  4IYQ A;  1TVR B;  2RUS A;  4XDC A;  2R2R A;  3MOZ A;  3JAM Y;  4TU7 A;  4Y2C A;  3TAR A;  3P45 B;  3N5B A;  4DV6 J;  2QYG A;  3QT8 A;  4K8R A;  4KKO B;  3Q8P B;  5IV3 A;  2VQF F;  1TL5 A;  2VBX A;  1V9O A;  3JYT B;  5H9E J;  1FKO A;  3D6F B;  2BM1 A;  2BXJ A;  3HZG A;  4KV8 A;  4C9D A;  2XYG B;  3HM9 A;  4DV7 J;  1X60 A;  4EU0 A;  2RKI A;  4FVM A;  2Y9H A;  2JEJ A;  4TYB A;  2UUT A;  5KFP A;  4MTP A;  4QPX A;  1JXV A;  4DZ6 A;  1N48 A;  4KC5 A;  2XCP A;  4R25 A;  1N5Q A;  2Y8W A;  4WCE Q;  1H2T Z;  3AB2 B;  1RUS A;  1XNR J;  1PYO B;  1B3T A;  5BXI A;  1MLA A;  4J7C A;  3D9B A;  3G96 A;  2ZC4 A;  4X65 F;  3UCU P;  1Q86 T;  3Q86 A;  3T6J A;  2VFS A;  3QMQ A;  1RBA A;  2RT3 A;  3ENV A;  5KG5 A;  4ZP8 A;  1XJW B;  2KXH A;  2JLG A;  3PYG A;  3L9Z A;  1HQE A;  1WKK A;  1BQN B;  2MGZ A;  2JNJ A;  5IZH A;  2DIT A;  4QR0 A;  4J90 A;  1ZM2 A;  4ID5 B;  3A3P B;  1T9W A;  3SIP B;  2LA6 A;  4HEA 9;  5KFN A;  1LOU A;  3I9Z A;  4DV3 J;  3CJK B;  2ADC A;  4LR8 A;  5DDP C;  4NYZ A;  2R8H A;  1WF0 A;  2GA7 A;  1X31 C;  1S9E B;  1NK4 A;  1TKX B;  3I0S A;  1FDA A;  1ICE B;  5HSP A;  1V3S A;  1RIS A;  1RCX B;  2F63 A;  4WZQ A;  4EEY A;  4K4X A;  2V4R A;  4Y2M A;  1Y5L B;  2LEC A;  4WWS A;  4GKJ J;  3Q8S B;  1JLE B;  1Y4Z B;  3E3X A;  4RW6 B;  1C1B A;  3G2X A;  4TU9 A;  2ZZN A;  3M30 B;  2J6U A;  5JVH Q;  2ZNY A;  1PYS B;  3MFI A;  3MF5 A;  2JHE A;  3HFZ B;  3CDA A;  5IOL A;  2P5V A;  2IYI A;  1VRU A;  1ZPW X;  3M7V A;  2B7C B;  2OTJ S;  1YDL A;  1Q53 A;  4WF9 Q;  4JI0 F;  2Y8Y A;  3SDE A;  4JYA J;  2GML A;  2HAI A;  3SCI E;  2N4C A;  5E41 A;  2B56 A;  2BR0 A;  3DMJ A;  3JTN A;  4GMK A;  3ENW A;  4WK1 A;  1MU2 B;  3GV8 B;  1SKU B;  4OL8 A;  1RT1 A;  2D9P A;  1SUQ A;  2KB2 A;  3JSR A;  2R7R A;  3MEC A;  5KT5 A;  3EE3 A;  3U02 A;  4FPR A;  4UST A;  2DGO A;  3QID A;  3BGO P;  3GCW P;  2V8P A;  3OR2 B;  1VQP S;  2E66 A;  2PC6 A;  3FSI A;  3AOA A;  4OYW A;  3QYY A;  4NLS A;  5DGB A;  3PYE A;  1SQG A;  2V8D A;  3IM8 A;  5D8H B;  3TEH B;  2B9X A;  3CJ3 A;  2EI5 A;  2NXN A;  3UNY A;  4N5S A;  2CQD A;  2HNY A;  1U6B A;  3ADA C;  3PAC A;  2UXD J;  5KT2 A;  1ROF A;  2VOD A;  2E29 A;  2OGU A;  2BQ3 A;  1VBX A;  1V3Z A;  1XIQ A;  4AL5 A;  3E51 A;  2VG7 A;  3RAQ A;  4BCA A;  4DUZ J;  4FS2 A;  3HHL B;  3N5F A;  1AW0 A;  3GMG A;  2BOP A;  4CH1 A;  3AXM A;  5B0B A;  5IS2 A;  4P10 A;  3DGP A;  1B7F A;  1WD6 A;  5ADZ A;  3SSR A;  3QGH A;  1W7W A;  1KEK A;  4JV5 F;  4BS2 A;  1PGZ A;  1RHM B;  1TMJ A;  2AP6 A;  1J5E F;  3PYD A;  2VBZ A;  3BBF A;  5KT7 A;  4U67 Q;  1LNQ A;  4WKR A;  2QA2 A;  4YDD B;  2OHD A;  2WTF A;  1NPK A;  1U2F A;  1UPP A;  1XK8 A;  2N82 B;  3KJF B;  1RWU A;  1LWE A;  2CJX B;  3LGN A;  1F9H A;  1PJ6 A;  3CJQ A;  4G1P A;  1T94 A;  1VK3 A;  1EET A;  4QIW D;  5KFK A;  3POT A;  1U1R A;  4K4V A;  4DG1 A;  1YZ6 A;  3HUL A;  5AXM A;  4B9M A;  4WK3 A;  1XWL A;  3VQT A;  2OD4 A;  1XNQ F;  1OO0 B;  2CJA A;  4F4X A;  4F3M A;  2LFV A;  1Y7P A;  2UU9 F;  3R5A A;  3ONQ A;  2ZH9 A;  1NPP A;  1RU2 A;  1A6L A;  2W9A A;  1YJW S;  2KYZ A;  1IXK A;  1QE1 A;  3N79 A;  1SBR A;  3M8P A;  2VG6 A;  4Q2L A;  2WK4 A;  3D6M B;  2I8E A;  2E5I A;  2WW8 A;  1HYS A;  4Q7A A;  2YQ0 A;  5D15 A;  9RUB A;  2BAN B;  3HVA A;  4UQG A;  1N54 B;  3EYZ A;  1FHT A;  1FFS B;  2VHG A;  4AQY F;  2WCX A;  4LIW A;  4V1A k;  1C0T B;  1I94 J;  2BE2 B;  3AT1 B;  4OZJ A;  2DRA A;  2FLO A;  2XQC A;  3HVT B;  4DL4 A;  4Z7Y A;  4F4Y A;  1HD1 A;  3M6U A;  2JWN A;  1Z2L A;  2IAJ B;  2CQ3 A;  2NZ4 A;  1HNV B;  5FLX U;  1FDD A;  3R7N B;  1EKR A;  1TFW A;  5HBM A;  2E1R A;  3A8I A;  4HT5 A;  1OQ3 A;  1WG5 A;  1CC7 A;  3X3U A;  2HEK A;  4WII A;  1FRM A;  1Q0N A;  2B0G A;  4BWM A;  2W25 A;  1Q7Y T;  2YNG A;  3BQ1 A;  3R97 A;  4TU8 A;  2YKM A;  1MSW D;  1SI9 A;  4TQS A;  3BS9 A;  3MMJ A;  4DL6 A;  4ZPA A;  3OVA A;  1VCT A;  3NBP B;  1VI7 A;  5DZ7 A;  2CWX A;  3UVJ B;  3FVY A;  2PGC A;  2APO A;  5I3U B;  1D9F A;  2RDJ A;  1BGX T;  2GX8 A;  1IKV A;  3L3C A;  2AW0 A;  3MMB B;  2WOM B;  4DV0 J;  1YLX A;  3LP1 B;  1RT3 B;  1SH3 A;  4F04 B;  5KFM A;  5CH7 B;  4DPW A;  4YME A;  3DYA B;  1UVK A;  3ENA A;  2HWH A;  3FJ2 A;  2D41 A;  1WWH A;  3CDE A;  1NME B;  4X4U A;  4LF9 F;  1LK7 A;  2FB0 A;  1IR2 A;  1IKX B;  2JEG A;  2FJX A;  4C3M A;  4DR6 J;  4L75 A;  2J5A A;  1A7G E;  1HI0 P;  1RGV A;  5KFQ A;  1H7W A;  1K9M T;  4L76 A;  1WKJ A;  3M6X A;  3QAT A;  3G6Y A;  1TL3 A;  5CD4 H;  1VRQ C;  3MOJ B;  1FFG B;  2KVI A;  3QT6 A;  3K5M A;  3IRW P;  4Q0B B;  1FDN A;  3VTI A;  4O4G A;  1UFK A;  4N41 A;  3BO3 A;  2BVZ A;  2LQ9 A;  1KQG B;  1R7I A;  3H98 A;  2VOP A;  1NH8 A;  3RBD A;  2PSZ A;  2FJD B;  3CD6 S;  1WNE A;  1E6Y A;  4AD6 A;  1FD8 A;  3EGW B;  3IAS 9;  4HLB A;  2R42 A;  2XMA A;  1UVM A;  4O23 A;  4USH A;  1LFW A;  4QWE A;  3I32 A;  1DZ5 A;  5HK4 A;  1TL4 A;  3DXB A;  4P2S A;  3HD2 A;  5B0A A;  4RU9 A;  4JV1 A;  3DRP B;  3RUB L;  1GNK A;  3QRR A;  4WFN Q;  3RB6 A;  1EP4 A;  2W9B B;  3MEG B;  4KGK A;  2LU2 A;  4NOH A;  4IRC A;  4LRC A;  3NGD A;  1C0U A;  3T6B A;  2EFV A;  1CJK A;  4NLD A;  3R7S B;  1IKW B;  2BQR A;  2VU5 A;  4IQX A;  1R6V A;  5HJX A;  3BYP A;  1IR0 A;  1GMW A;  1T7P A;  4IH5 A;  1QUP A;  2VG5 B;  3I96 A;  3IFE A;  4B17 A;  3W9J A;  1V6H A;  3CO9 A;  3PHE A;  2AWZ A;  3MCO A;  3D54 A;  5J2N A;  1WOS A;  1DTQ B;  2GGP A;  4I64 A;  4K59 A;  5KFE A;  5ETQ A;  1JKH B;  1XBW A;  4KPY A;  4WFY A;  2FQQ B;  4B3S J;  3KUG A;  4WP8 A;  2L41 A;  1FKP B;  4C0O C;  2BOA A;  3FRZ A;  4LFA F;  1ZM3 A;  5F8M A;  2ZC3 A;  2WAQ D;  2QLX A;  3M6V A;  2MKH A;  2O5D A;  2YNI A;  1Q8I A;  3MCN A;  1ULR A;  1U02 A;  5HVH A;  5AE1 A;  3GYX B;  4KJI A;  4DR5 J;  2ZHA A;  4ZVT B;  4DHV A;  4WFZ A;  1SL0 A;  4X2B A;  2W2M P;  1EAR A;  3IWX A;  4DV4 J;  4X64 F;  4TKT A;  1T05 A;  2KFZ A;  3RTV A;  3IN5 A;  2K06 A;  3LWM A;  4NE9 C;  1YK9 A;  4GO7 X;  2XZD B;  1TK5 A;  4FKX A;  3SMZ A;  3M9O B;  2XNQ A;  3DOL B;  3MHY A;  1M1G A;  3UO0 A;  1UJ4 A;  4FVC A;  2VD3 A;  4TXS A;  2UVW A;  2KT5 A;  1YBA A;  4YY3 F;  4QQB A;  4K0K J;  3WBZ A;  2E5L J;  1XER A;  1EIY B;  4IFY A;  3R1H A;  2DNK A;  2MPU A;  3OLB A;  2G1H A;  1AYE A;  2HHS A;  5KFW A;  3NWR A;  2C3M A;  5D4N A;  5IWA F;  3R5C A;  2V50 A;  4NZ6 A;  1S6Q A;  1VGY A;  4ZLN A;  3AOC A;  3MM8 B;  3IC1 A;  4IG0 A;  2E7W A;  1RWO B;  5F3Z A;  1QAI A;  4LF7 F;  2YNF B;  3CCV S;  2GJF A;  2P9E A;  4CQ1 A;  1WEX A;  3M2V B;  4NRU A;  1P1L A;  4ZS6 A;  3MM6 B;  2KRR A;  3HI9 A;  1VQY A;  1AZS A;  4A8Q A;  3NS7 B;  2IJF A;  3M2R B;  3UR0 A;  3QPI A;  3W2V B;  1W2B R;  3ISN D;  2I9S A;  3KK1 A;  1L3T A;  3KLH B;  3M4X A;  4EGL A;  9ATC B;  2OPP A;  2XSF A;  1CJT B;  4DQQ A;  2C3U A;  1U1N A;  2XMW A;  2ZH3 A;  1FNX H;  4ED5 A;  5A2Q U;  2V2Z A;  2DH8 A;  3R1L A;  5K8P A;  1X4B A;  4NLG A;  3JAM U;  3NGT A;  1HWJ A;  4NLX A;  2XGP A;  2XC9 A;  1JLF A;  1XR6 A;  1RAJ A;  2DXD A;  4A8X A;  1CS4 A;  1HI8 A;  4K7Q A;  1HBU B;  3CIZ A;  3MD1 A;  3CDB A;  5D78 A;  3FCW A;  1MML A;  2ZDO A;  1OIA A;  1NM2 A;  2ATC B;  2R7S A;  3HHK A;  5KFG A;  4CLP A;  4X62 J;  4LSL A;  3FZ2 A;  3EZ5 A;  2RUG A;  3OXG A;  3L7O A;  4FBT A;  3M6W A;  1S7H A;  4EWT A;  4G1Q B;  1KVK A;  2JVR A;  5C24 B;  4YR2 A;  1F9F A;  2DNY A;  3EVO A;  2ZHO A;  4I4B A;  5J2P B;  1IBL F;  4N8O A;  2XYH B;  2HHH F;  2EKN A;  2Z4P A;  1CJV B;  1TUW A;  1WAC A;  5HQM A;  2DNP A;  1FF2 A;  1H7X A;  3D4J A;  1HWL A;  4U8V A;  1KLN A;  2CA9 A;  3K8W A;  3PW4 A;  2B4V A;  2BJ9 A;  3IRX A;  4ITS A;  5JXS A;  4ZHR A;  4A8F A;  1WC5 A;  4ZVU B;  3BKF A;  3A8K A;  4USV A;  3OXF A;  1S1X A;  3DC2 A;  3ILO A;  3KK2 A;  2J0X A;  4ZJO A;  4JI8 J;  1APS A;  4U7C A;  1RTI B;  4IOB A;  1FKA F;  5A6W A;  1S1U B;  2HBY B;  4EZ9 A;  2Q43 A;  4YUD A;  3R8Y A;  2C2M B;  3RRG A;  3NOG A;  3I55 S;  4RLE A;  1FRK A;  4R0J A;  4LF4 J;  2A0F B;  3NCP A;  3H8Y A;  1UMJ A;  1Q5Y A;  4UQT A;  1UEV A;  4R5P A;  1TTH B;  4LBP A;  1JJ4 A;  3KNA A;  1SQF A;  1S97 A;  3ILJ A;  3HT0 A;  2F1F A;  2KM8 B;  2QL9 B;  4RR5 A;  2NXU A;  1TU0 B;  3AJ2 A;  4B3O A;  1GQE A;  3BO4 A;  4AE5 A;  3G6V A;  4LBH A;  4M5L A;  4V19 J;  4OYA A;  2MQ8 A;  2H5J B;  4R8U B;  2C2K B;  4DS5 A;  3BQ0 A;  1C4C A;  2IRU A;  5CCM A;  2POK A;  4LF8 F;  4UTG A;  4HAC B;  4FYY B;  2OPR A;  2DHA A;  4C11 A;  1WDD A;  4F2S A;  5HRO A;  1R8B A;  1KQS R;  5GAD I;  1U25 A;  4K4T A;  4QOT A;  2CQB A;  4QIG A;  2XLI A;  2YH0 A;  5C2G A;  4CM2 A;  4DLG A;  2JVO A;  3I5B A;  4DFP A;  2MLX A;  5ETV A;  4CLW A;  1R8C A;  3RBX A;  5LOQ A;  1RBO B;  2ZWO A;  4ZCL A;  3O44 A;  1MWQ A;  3G8S A;  2IM1 A;  1FE4 A;  3MUV P;  4C8O A;  2XMV A;  3IBF B;  3JSM A;  3G82 B;  1RTZ A;  2CNK B;  2G0J A;  5HO4 A;  2OAU A;  1GXT A;  2GIF A;  4ZVH A;  2QLB B;  1SVD A;  1B0T A;  4DN0 A;  4YR0 A;  1NJI T;  1HR0 F;  3K57 A;  3MAA A;  5A8R A;  4RW7 B;  3IP0 A;  4DV2 F;  1TMM A;  4Q5V A;  4YB6 A;  5H9F K;  4Q45 A;  2IM3 A;  3B4M A;  2V9K A;  4GKK J;  4OJ1 A;  3EGV A;  2E1A A;  3ZZ0 A;  4LRF A;  3IGN A;  3ET6 A;  1CG2 A;  2DO4 A;  4JI4 J;  5F9N A;  1HNX F;  4ZCI A;  2XI3 A;  1QDU B;  4IFV B;  1RQ0 A;  1KQF B;  2FYX A;  2WVB A;  5C5J A;  1S79 A;  4EYI B;  3KHR A;  4JI5 J;  2A3J A;  2VUG A;  1DRZ A;  4CO5 A;  5GAD U;  2ASJ A;  1UVN A;  4P71 A;  2HBQ B;  5C42 A;  2Y1J A;  2XY7 A;  1O0P A;  2VC1 A;  4ECW A;  4NA2 A;  5HAO A;  4JOU A;  3J7A N;  2RRN A;  3CCZ A;  1VQ9 S;  2YBV A;  3TQ1 A;  4F4Z A;  5CAA A;  2CJB A;  4FBU A;  4Y2A A;  1XQI A;  1IBM F;  1QAJ A;  1OSC A;  1SC1 B;  1VQM S;  4ICL A;  3H25 A;  4ZVR B;  2DBB A;  3MUR P;  3AD9 C;  1X4A A;  3D1H A;  3EPI A;  2RH3 A;  2YKN A;  3R6G B;  3DCA A;  1AB8 A;  1KNZ A;  2VON A;  3W9H A;  3HF5 A;  4CYU B;  3GE9 A;  5AXL A;  2F7V A;  5T7L B;  5LXR A;  1LQ9 A;  3DI6 B;  4ZMM A;  3NAI A;  5B0E A;  1R3N A;  3KJV B;  1XR5 A;  3M1V B;  4CH7 A;  3C14 A;  4ETZ A;  5KOX A;  4CLY A;  4E8U A;  2J9D A;  3DDN A;  3CUL A;  2H5E A;  2V69 A;  4JI3 J;  1GMV A;  4B3M F;  1RT7 B;  4C8N A;  1N0V C;  1J27 A;  3ISN C;  2AYE A;  1D09 B;  2J8A A;  2W01 A;  4E0D A;  3ZZR A;  4U8Y A;  4DUY F;  1JWW A;  3KLI A;  3EWG A;  4RWX A;  3TX0 A;  3KLG A;  3P96 A;  1UWA A;  1GX6 A;  1QAY A;  2IVM A;  2HND A;  1JJ2 R;  1HQU B;  4U95 A;  5L1L A;  3IA0 A;  3F73 A;  4OHV A;  4EK2 A;  2HQF A;  1IQT A;  4CO1 A;  3ITH B;  1OY6 A;  2F65 A;  1S0O A;  2QFI A;  4C98 A;  1RDR A;  2H54 B;  2VA2 A;  2V2Q A;  1B99 A;  1KDN A;  4LFB F;  1NKB A;  5CAB A;  1T9Y A;  2WBM A;  1U49 A;  3M8Q B;  1KTQ A;  4RZR A;  4I68 A;  1N5S A;  2HVE A;  1OS5 A;  3L7P A;  1HHS A;  2JFD A;  3NGU A;  1UFL A;  1FCA A;  2VFT A;  3Q89 A;  1GT8 A;  2ZDP A;  3W5Y A;  4UOC A;  1S1V B;  3Q83 A;  4QW8 A;  1SL1 A;  3HJF A;  1OMS A;  1YJR A;  2C1E B;  2ZH6 A;  5B08 A;  2VJV A;  1S72 S;  3L4B C;  2Q79 A;  3TAN A;  5HL7 Q;  2XS5 A;  3MTJ A;  3D0I E;  1FKO B;  5DQI A;  2FJV A;  3KFW X;  4KV8 B;  1VQO S;  1PIL A;  1N0U A;  4OHZ A;  2CYY A;  4CLL A;  2QL7 B;  1DAX A;  2RKI B;  4PQA A;  4FPI A;  3BZQ A;  3R6L B;  1F2G A;  3VZI A;  1V3R A;  4YHH J;  2QO3 A;  2CAJ A;  5LL6 d;  1E6V A;  2V8H A;  5AXN A;  2H3E B;  4ZPV R;  2YQ3 A;  5KOW A;  4URS A;  2EPI A;  4L72 B;  3PZP A;  3BV8 A;  4IUF A;  3LWL A;  2VQE F;  3GV5 B;  3CDU A;  2NR0 A;  1OQ6 A;  4QYZ K;  4NRT A;  3E8O A;  3TZY A;  5L46 A;  2UUA F;  3F56 A;  3CE8 A;  4FF1 A;  4CWB A;  5KFI A;  3F41 A;  4TVA B;  4KGV B;  2KHD A;  4ZPW R;  4ZPB A;  5ETO A;  2AKW B;  4NEY A;  2PI4 A;  3MDF A;  4JI1 F;  4ELT A;  3G87 A;  7FDR A;  2MGZ B;  1QJH A;  1FK9 A;  2FJA B;  1KN6 A;  4M1K A;  5EDW A;  3IWL A;  1RB0 A;  2E9Z A;  1F5C A;  3I4H X;  5BYS A;  3HT3 A;  2CQI A;  3KMQ A;  4KO0 A;  2XY5 A;  1FJ7 A;  1ZAX A;  3RZA A;  1X0F A;  2DEJ A;  3MPD A;  2V68 A;  3VGV A;  2PO4 A;  1GMU A;  1F5B A;  3CCU S;  2ZBR A;  2DHH A;  3I0S B;  1HQ2 A;  4JI7 J;  4YP3 A;  3TVY A;  3NY0 A;  5HQL A;  4TLR A;  5KTQ A;  2KT3 A;  4CH0 S;  1RWX B;  2NYH A;  2CQG A;  1O51 A;  2ZKT A;  4DV6 F;  2KG0 A;  1FJC A;  2BX6 A;  2KO1 A;  3ZZZ A;  3H20 A;  1JQG A;  1Q5V A;  3M9N B;  2H4W B;  2MKS A;  3H7H B;  2LU1 A;  4Y0F A;  2RQ4 A;  1WTB A;  2ILZ A;  2EBG A;  4URQ U;  1NDK A;  2J6T A;  3J7Z T;  2EFG A;  1JLA A;  2GVD A;  4DV7 F;  1VRU B;  1HBO A;  4PPD A;  3AJD A;  2HPU A;  3EGN A;  3P4U B;  1YKW A;  4DQR A;  3HHE A;  5DJB A;  2J7K A;  1S0N A;  1RT6 A;  1JB0 C;  4YB7 A;  3SDE B;  2LKZ A;  2MZT A;  1A9N B;  2XLJ A;  4DEZ A;  3ZFV A;  2R8J A;  1OPI A;  1IM4 A;  3PKY A;  2FHO B;  3HKW A;  2DXF A;  3DMJ B;  5D0R A;  1FWP A;  3GTY X;  8ATC B;  5EX3 A;  2HKE A;  3UD5 A;  1SJF A;  1RT4 A;  1RT1 B;  2XGQ A;  3VAJ A;  3MEC B;  4CT9 A; 
#chains in the Genus database with same CATH homology
 2EC2 A;  2F4F A;  2A6M A;  4ER8 A;  2VJV A;  2XQC A;  2VJU A;  2XO6 A;  2F5G A;  2XMA A;  2VHG A;  2VIH A;  2XM3 A;  2A6O A;  2VIC A;  2FYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...