4ER8A

Structure of the rep associates tyrosine transposase bound to a rep hairpin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
165
structure length
165
Chain Sequence
MSEYRRYYIKGGTWFFTVNLRNRRSQLLTTQYQMLRHAIIKVKRDRPFEINAWVVLPEHMHCIWTLPEGDDDFSSRWREIKKQFTHACGLKNIWQPRFWEHAIRNTKDYRHHVDYIYINPVKHGWVKQVSDWPFSTFHRDVARGLYPIDWAGDVTDFSAGERIIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TnpArep for protein
publication title The processing of repetitive extragenic palindromes: the structure of a repetitive extragenic palindrome bound to its associated nuclease.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein/dna
total genus 51
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2012-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 4er8A00
2XM3A 2VJVA 4ER8A 2XMAA 2EC2A 2VHGA 2F4FA 2VICA 2XO6A 2VIHA 2A6OA 2A6MA 2F5GA 2VJUA 2XQCA 2FYXA
chains in the Genus database with same CATH superfamily
2BQ3A 3GR0A 2F9JA 1VC0A 4YDDB 1BQMA 1N88A 5L46A 3OPKA 1Q95G 4KH0B 4X62J 1P9QC 4J5OA 1SH2A 2A2DA 2VC1A 2ZH3A 3GP9A 1N4LA 2OPSA 3CT9A 4I7FA 3TYTA 4PXDA 2CQGA 4CLFA 3BQ0A 3QRPA 2VG6A 3ILOA 3AAWB 3SV4A 2CPFA 2YNGB 4DSIA 2UV8A 4O3NA 4ZJLA 2ZVIA 4F0HA 3KOAA 1N0UA 4Y65A 1M1HA 4WYLA 1PJ7A 2FVPA 2DPIA 5T7LA 3PG9A 2MKKA 2G0CA 3OHAA 3DRXA 4L76A 1RP5A 2X3GA 1NUEA 2V9KA 2FIUA 2QA1A 5KFRA 5F9NA 5ETOA 1JLBA 5K8MA 1WHXA 5J2QB 5KT2A 4WXOA 2LEBA 2FLOA 4OZLA 2B3TB 4F2RA 4F26A 2XMMA 5FD1A 4AXJA 2XO6A 3DCAA 2H4WB 4CTAB 3HPOA 3HULA 3QMQA 8ATCB 1SH3A 3BBFA 3UO0A 4FXVA 4LREA 2I6WA 1UCNA 2V2KA 1K0TA 3NWRA 4J9LA 2F9DA 4PPZA 4GVLA 4ANEA 1R8HA 1V3ZA 3QSIA 3IXQA 4HHHA 4DXLA 2XS2A 1UPMB 1IBKJ 1Q0NA 1U6BA 2JEIA 4G1PA 4KKOB 2NR0A 5JJBA 4D3HA 2CPIA 3NP5A 4RZRA 4P75A 3SV3A 1JQGA 3MZIA 1NEEA 1TL3B 1VIOA 1QUVA 1LWCB 1KQFB 5EWEA 5KFXA 4KFBB 2NXCA 4R5PB 3ADAC 2BZ2A 3DHXA 1I94F 3PEHA 4K4SA 1GT8A 3DGPB 2M2BA 1S1XA 2ZUGA 4F02A 3MEDB 1YDLA 1D3WA 1UJ4A 1HNWF 1QSSA 1IKYB 5BR8F 1LW2B 3RB3A 3GIJA 3ZC4A 1IQZA 1WWHA 2VQEJ 1JJ2R 3C3LA 3AT1B 1RAJA 4NA3A 1PJ5A 2DVIA 2AJ4A 1JK9B 1UA1A 3UE2A 2CAJA 1GNKA 2YBVA 1HMVB 2HHWA 2FTRA 2B6AA 2E9TA 3A8EA 4ANCA 4DV4J 1PJ6A 1QVFR 1KVJA 1TL4A 3OL8A 1HW8A 2B43A 3IR6B 2RD5C 4F25A 2YKOA 2VONA 4JI3J 2F8HA 2XMAA 3OLBA 2Y1IA 1W26A 2XLJA 3MFHA 2PEBA 1NSQA 1BWVA 4QQBA 1IBLF 2XS7A 4ANDA 2V4JA 1QSYA 3GSDA 5B7WA 1R0CB 1F3VA 1FO1A 2DNGA 3BN7A 2G13A 3SDEB 2CQ0A 2YKPA 2FYXA 3UR3C 1JKHA 4ATNA 3NCPA 5CD4A 2QO3A 2DCLA 3CUNA 1HQUA 4JI4J 4DL5A 3MWBA 1ZM2A 3VZHA 3ONQA 2RU9A 3I31A 5GADI 1MWZA 1U49A 2MKSA 3W65A 4P9SA 3J80Y 2M0GB 4BWMA 5ADZA 1B0VA 2EI5A 2RMLA 1I5OB 2KM8B 2RQMA 3HT3A 1LKZA 5HATA 4F0MA 1Y00A 4ZCLA 1TL5A 4C8YA 3DOLA 2RDDA 4Z2XA 1FFWB 2VHGA 4WFYA 2DNMA 2MZRA 2FPHX 1UEKA 2Q43A 2DY1A 2VD3A 3FBFA 1RAEB 4DR5F 4BLGA 2Z2MA 1FHTA 2KH9A 3Q8VA 1DQ8A 4DFKA 1RE1B 2FLLA 4X4SA 5D4NA 2F63A 1FCAA 3M2UA 1YVFA 4P72A 4NLVA 1R6VA 1ZBTA 2ZZTA 4BDPA 1NPKA 2HHHF 1L3TA 1VQMS 3OFHA 4LF8J 3A8KA 2E7XA 2VA2A 4KH1B 2ZE2A 4NCGB 3F0NA 4FF3A 4XO0A 1SC1B 3RAQA 4DX7A 4CO3A 4M63A 2PFDA 3WZ0A 4GVBB 4FDFA 3CCES 4HR2A 4I1TA 2VBXA 3CJTA 3K5OA 3I4PA 4DZ6A 1R6YA 4NEZA 1WELA 2GX8A 1L3UA 3DKDA 3PZPA 2JL9A 5D4LA 1SV5A 1U24A 2E66A 1R3NA 2GA7A 3T1YJ 4RUBA 2LYVA 2VKZG 2ZWOA 4JI7F 4KE5A 2GO9A 4DR3F 4YN3B 4CZCA 2XNRA 4QIEA 4JV0A 2XWYA 1OS5A 3Q0AA 1HQ2A 3D9BA 1VQKS 2NQPA 2C3UA 2DITA 5KFKA 5E7OB 4EI2A 4OI1A 4ICLB 4DN0A 4JP8A 4IUFA 1ACMB 3ENVA 1D09B 3I6PA 1Y3JA 4Y28C 5J1EB 2YXLA 1FK9A 1RT2A 6FD1A 1F9EB 4U7UK 3LP1A 3UCGA 1P1TA 1X60A 5D3GA 3SMZA 1TL7B 1X4EA 1WF2A 3PYGA 3NAIA 4P52A 2IRYA 2DGUA 3VAGA 2ZH1A 2DNRA 3I55S 2LP4A 5F3TA 4DWIA 2B4UA 1UAWA 4DX5A 2K7JA 2E9RX 3HFVA 1Y5NB 4OYOA 4Q8FA 2QLBB 4ZJOA 4FP9A 1MU2A 5D15A 4CLYA 2ZM6J 1NDLA 1YTYA 2G1HA 4QPTA 3NGRA 4R0EA 1YJWS 4U67Q 4KPCA 2HQDA 1MROB 1XERA 4U9RA 1WJ9A 5CZVA 4DL7A 3WBZA 2ZEJA 3UW1A 4F04B 2OPRB 4NXMF 4IH6A 1K9MT 2ILYA 2YKAA 4J91A 2IM3A 3DRRA 1F3FA 1Q5VA 5A2QU 4OHYA 3TW0A 1M0SA 2HFUA 2BANB 3DDKA 1HBNB 1XR5A 3HHNB 3OL7A 3I32A 1EAYC 4ZVHA 4P74A 4NMXA 4WTOB 2ZDOA 3CD6S 4IDKA 3PJXA 3MR2A 4C4WA 2BBEA 3ISND 1XTZA 3JTOA 1NNDA 3HVTB 3PR4A 3D6FB 3W60A 4O23A 3LPEA 2F8MA 4W92B 2VPXB 5J1PA 5KG5A 5SZTA 2WZ1A 4F3MA 3SXLA 2XGPA 5ETMA 3C15B 3LTOA 2V9WA 2B4PA 4TU7A 3K5LA 3M8PB 3T1HF 1HYSA 5HJYA 4B9LA 3EYZA 4YMEA 3JSYA 1DQAA 2I0XA 3H5XA 2DK2A 2WHOA 1PBAA 1DFDA 5ETPA 4NYZA 2KJWA 4DUYJ 4EYIB 1E6VA 1WC3A 4A8SA 1UTAA 1IBMF 1PYSB 3LA0A 1PKUA 3TARA 3EICA 3PO5A 2MKIA 4O0IA 2N4CA 2R7QA 2A2CA 5G0RB 5L39A 2QMUB 3TVKA 1IKWB 4CM0A 1WI6A 4ECVA 1FFGB 3D67A 4UQGA 2HS0A 4MKYA 1UETA 4Y6IA 2B9EA 3BGOP 3E01B 4QYRA 3HSJA 2NPIA 4F4KA 4ID5B 1WKLA 3V6KA 3N0VA 1U09A 5DQGA 2UXBJ 5KFGA 3M9NB 3CJ4A 2B4OA 4IH5A 3NGUA 4YUDA 1O8BA 2HNYB 1NB7A 3V6HA 4ZVRB 2UXCJ 3PX0A 2FJAB 3SCLE 4UF4A 3UWTA 4J9UE 3BB5A 1H2TZ 4FN5A 4IG3B 2C2NA 3Q2SC 4LF4J 5IWAJ 3IBWA 1HI1A 1DTTA 2AJ2A 4QWCA 4ECZA 5C24A 3J7YU 3QO9B 3CD0A 2BJ7A 2ZVSA 3P4UB 2G2ZA 2C28A 4FBTA 2DBBA 4QBUA 2QMXA 2E5IA 2GGPB 4M5DA 1AXQA 4DF8A 3DU6A 3CF5Q 3R7BB 3TNVA 5KT7A 1NK6A 1V5VA 2DYAA 2NCKL 3M8SA 2DIVA 3W3SA 4GC7A 2VBWA 1S5ZA 4R8UA 4YB6A 1L5UA 2XB2D 1UZDA 1RB0A 4CT9A 1N32J 4NL5A 1VQNS 3HXMA 4TY8B 1F2GA 1LEOA 4LVOP 4OZ2A 3MM5A 3P5TL 2AEMA 4ZVPB 1J2VA 1CS4B 2AHOB 1UW9A 4KJIA 4YDXA 3PHEA 3V81A 2E5LJ 1SKWA 2KZZA 1SUQA 3R5DA 1RCOB 3TVZA 3QWPA 4RNHA 3OXGA 3LGHA 3JTNA 5KG6A 1REVA 3CCUS 4YB7A 4K4WA 2QL5B 3FJ2A 4UQTA 1N5SA 1ZZFA 2MJUA 4EMDA 2BUNA 5DDPC 2CQPA 1S48A 1HBOB 1EQ0A 4NXNJ 4DJBA 2SXLA 4QW8A 3OTBA 1GK8A 3MECB 2WK4A 5B0GA 2FVCA 2MKCA 2K7KA 5DZ7A 4MJKA 3HX9A 3ENAA 1S9EA 2R9LA 2EKYA 3CGIA 1S1VB 3DM2B 2MQOA 2ALYB 4X65F 1C0TB 3VCDA 3KNAA 3BO3A 1JLFA 4Q2MA 5I3PA 4AQYF 3PJ9A 4FKYA 3Q8RB 2W9CB 1VI7A 3VAHA 4YY3J 4WZQA 4L75A 2MLZA 1B70B 4Q43A 1R0BG 4I0WA 2W9BA 1UJ6A 5I42B 1FRIA 1GXLA 2GIRA 1MLAA 3BV8A 2E1CA 3LO3A 2U2FA 4GKJF 3KTQA 2HK3A 2FVQA 4AE5A 5ETRA 2J76E 3ZFVA 2GQCA 1HA1A 2W24A 1M1GA 4DV7J 1IKVA 3VF0B 1R89A 1BHNA 4ZHRA 3Q23A 1VJWA 3PW7A 3FZ2A 2FY1A 5KFFA 3HM9A 5F8JA 1TELA 2ZJQQ 2LQ8A 2ZH7A 5KFEA 4WFBQ 3MFIA 1FESA 3PRVA 2AGPA 3CJKB 3KLGA 1L3VA 1CULB 3Q8YA 5BJRA 1RI7A 5LXYA 1M5HA 3JS9A 1FKOB 1RHKB 2XGQA 1U2RA 3DFEA 3QRRA 2Z0GA 1VRUB 1JLCB 3CCVS 4AL5A 3EGNA 3P6YC 4IFYA 2IVMA 2CWKA 3D0HE 1X4CA 5K8NA 2EXUA 3BYPA 4USUA 2XM3A 4UY85 5LT5A 4DV2J 1WC4A 2R7UA 2V8HA 1S72S 1H98A 1KNZA 4RW6A 4B08A 4C11A 1WOPA 3M30A 2E29A 2X1FA 1V6HA 4K5SA 3I0RB 5FLXY 4JI0F 1GX6A 2ZITA 2F3JA 2GVDA 2P6SA 3KUHA 1ZA1B 2OP5A 4M5LA 2VPWB 3G86A 4RW8B 1U1QA 4DV1F 1IBCB 4QIGA 3WHIA 3G8QA 4I2QB 1VJQA 4N56A 4QR0A 2X3DA 3KMSA 2PI4A 3VR1A 1XNQJ 3R27A 3SBMA 1Q8LA 4IOBA 2OLWA 3BH6B 4DV6J 1RT7B 4B3RJ 2HNDA 4G1IA 3VQSA 1TMMA 1RWUA 4J7CA 1X4AA 1HBUA 5GADU 5C42A 4NLTA 3MCOA 1KVIA 1BY9A 2CPZA 5KAKA 3TX8A 4HHUA 1C0UA 3OD2A 2K2PA 4J9MA 5H1SV 3EZOA 3VGTA 1C2PA 2VG5B 3C6TA 3UCUP 2IDEA 4C8LA 4KHPJ 1J5EJ 3FMWA 1RISA 3DLGA 4P2XA 2A10A 1NKBA 3SZ2A 1TZ0A 5B0EA 4GKKF 2LCWA 4DR6J 1ZOTA 4K4ZA 4ID8A 3R5BA 3E2EA 2A6OA 2JH3A 2KN4A 1U25A 2J7WA 4C3KA 2CQ3A 3DYAA 5LMNF 2HZVA 3N9UC 4P2SA 4MMOA 2ZH8A 3HHLC 2H3EB 1KLNA 2CA9A 3BSCA 2A3JA 1NK5A 5E33A 4USHA 3TAMA 5HVFA 2YPZA 3OLAA 2M52A 2QA4G 3RB6A 2Z2ZA 2GVZA 1YRUA 2F1FA 5A0YA 3M2RB 3CJ8A 4QU6A 2L08A 1FERA 2CYYA 2V0NA 4JI6F 3M8RA 3CCWA 2O1PA 5J1NA 2HFOA 4RW4B 4A48A 2BV3A 2FGCA 1T05B 4NLRA 1HBMB 4KO0B 4J9OA 3MM9A 1Z2LA 3PYFA 2XO7A 1RT4B 4QZVB 3K2YA 2G2YA 2HVIA 5J2MB 3JSRA 3ITHB 2B51A 3NEKA 5DO2A 5LL6d 4JI8J 2OH2A 2R8IA 4B3SF 2X1AA 3IC1A 3OVSA 3IM8A 4LSNB 4AT1B 4F4AA 3NAHA 4IO1A 4I6WA 2UUAF 2EBEA 1B0PA 1KBRA 5E3PA 2AT1B 1JLAA 2PSZA 3J7AN 1QD1A 1LWEB 1RYRA 4DSEA 4DCOB 2VQFF 2IJFA 4DN9A 1RT6A 2XLIA 5EHHA 5GVQA 3R6GB 3GMGA 3G8TA 5HVGA 1SBRA 2LXFA 2GAGC 5K8PA 3OBIA 2XLKA 1WACA 5CCMA 4CNYA 3Q2TC 2FQQB 3QIPB 1VK3A 4PPDA 1FDDA 2GMJA 1U0HB 3R97A 4PXCA 2CADA 3LP2B 4LJMA 1U1NA 3IP0A 1KOHA 1NMEB 2ZZNA 1Q8KA 2CG4A 1SH0A 4ZCMA 2AKWB 2V2VA 3LAMA 3TWZA 3H5YA 4XIUA 3AQPA 5F3ZA 3G9CA 3MCNA 3R1HA 1HHTP 1Q1KA 4BC7A 4ERDA 2W8LA 2OPPB 4L3KA 3M32B 3KLFA 1FRHA 3MM8A 4RL1A 3KG1A 3UVJB 1I94J 1RYSA 4CLKA 1YBUA 5L1KA 7FD1A 4DPTA 2AQ4A 4KTQA 2JEFA 3T3FA 1EHWA 4F3QA 1JLQA 2B5JB 2MQMA 1HNWJ 4D3GA 3QBCA 4IR9A 4X66F 1QE1B 5BR8J 1SKUB 4EZ9A 4LBPA 2CJKA 4OX8A 2W2QP 3KKFA 4PWDB 1B7FA 4C0OC 2Y0BB 3L09A 4LRDA 2ZNZA 2HBYB 3I5BA 4YB5A 5F8HA 3K0JA 3LANA 2ZH9A 2AGOA 1TAQA 2J9DE 2C2KB 2C2MB 3BQ2A 5DQHA 2C22A 5D0HA 3QT5A 2BA9A 3DXSX 2BKNA 5JXSA 4LSZB 2R42A 4X4TA 1YJ7A 3GONA 4ES3A 2WB4A 4MK7A 5LJ3Y 5H9EJ 2HFSA 2UP1A 3F41A 2YNHB 2D69A 1NK0A 3X3UA 4M5KA 4OHWA 5KFMA 3GPAA 4X4NA 4PUOB 2KG1A 4WF9Q 1IJFB 2BKPA 4K2XA 3MR5A 4WFXA 2YNGA 1IBLJ 4PG8A 5DLGA 4KY3A 2ZOGA 2NSBA 6AT1B 2ASYA 4PG4A 1WC1A 5AXKA 3BGRB 4NX9A 2MLYA 2ZBPA 2J9DA 3HO1A 1BGXT 3M8ZA 2KL8A 4R0JA 2VPYB 3KK2B 4QWAA 4KC5A 2G0IA 1QUPA 1KLMA 2QGFB 3DOKB 1AFJA 3FEZA 4ZS6A 3R2CJ 5J2QA 5CAAA 3HHKA 3CCQS 1GMUA 2V4QA 4HACB 4CO2A 1FRLA 1WSVA 3UDLA 3CJQA 1VQ5S 1HQEB 3GZ7A 4RNOA 1RBAA 2RS2A 3WIUA 4M94A 2J9EA 4OZ5A 3KK1B 3GJQB 4I67A 1MN7A 3M6UA 1WKJA 4K0KF 2HURA 4ECWA 1VQ8S 2ZUAA 2OELA 3HFKA 5C2GA 2LECA 4DR5J 1WKKA 4KRWA 4LFAF 1R27B 4ELTA 4KKOA 3N6MA 3CVKA 2P9CA 4XPCA 2WW4A 2QE5A 2ZBIA 3D66A 1TL3A 3MAHA 1LWCA 2HIQA 4KFBA 1YIJS 5EUHA 4R5PA 4WFNQ 2HHHJ 4YQWA 2ADBA 2D9OA 4IRCA 3QAUA 1M90T 4LUBA 4RPFA 3K7RA 3MEDA 1S0MA 2HVZA 1IKYA 1LW2A 2WW8A 2AYBA 2ADCA 2BX6A 1DJ0A 1FWPA 3GE9A 5IM0B 3EZ5A 1GTEA 2WVBA 1RT3B 2P8IA 3V6DB 4MKAA 4WE1B 3TX0A 1YJVA 4RUCA 1HWKA 3BO2A 3BSNA 1HMVA 1JMTA 2I9SA 3JTPA 1T02A 4ECYA 4Y34A 1VLOA 4JI7J 1U2FA 4DR3J 2K3IA 3G6VA 2X7IA 1RT1B 1MSWD 2UVRA 1UEVA 2RQKA 3DRSB 2YWGA 1NSKL 5U47A 3TR5A 2P2CB 1N5TA 4ZP6A 3FGVA 2A1BA 2L48A 4ETXA 2JVOA 1H0HB 2CJYB 4OL8A 1T94A 3HKWA 4LT6A 2YVSA 3PFEA 4WKYA 4H4OB 2EFNA 3SDEA 1X5TA 1G1XA 4ZCIA 5EX3A 1ZM4A 2KJVA 3N6LA 2D1CA 1WOSA 2OAUA 4TNOA 2Z57B 3HLUA 1WG1A 4PXBA 3ZZZA 2IBOA 2CDQA 2VFVA 5LM7E 4J9KA 4DL2A 4OX9F 2AJFE 3MR6A 2Z2LA 2PFFB 2FDNA 2B7BB 1D0EA 2M70A 4NLSA 2P9GA 1HWIA 2MTLA 2DGOA 4USKA 1FD2A 3W64A 3FCWA 2DEIA 4LRFA 1CJKB 2VFTA 1BQNB 2FZGB 2LVWA 3OVBA 4NXMJ 1RSCA 1J5OB 1WF1A 3CCMS 2VODA 3P8BB 4RBVA 3GIIA 2OUGA 2R7RA 4TLQA 4RUHA 4FYDA 1S4EA 2KHCA 1S76D 1H74A 3DI6B 5IZHA 4W90B 3PJWA 1VBYA 3R7SB 4LQ3A 4Q2LA 2FGOA 3D6HB 4X64F 2R2SA 2YWKA 4DSFA 4NA2A 3AODA 3GV5B 4DV5F 3OR1B 4WBFA 1S4FA 1CJTA 3B54A 2WONB 1N36J 3SFUA 4NCGA 3MCMA 1YJRA 3T1HJ 1T03B 2ZFHA 2OTLS 1UWBB 1KRPA 1NSPA 1WEXA 2MQQA 3ENWA 1IBMJ 5EWFA 2DRAA 2VF3A 5GAHI 1EETB 2I5JB 1F6TA 2YKNB 3J7ZT 3MPYA 2V8DA 1Z4UA 5CZXA 4KGXB 4H54A 2DNQA 4LIRA 4LIWA 2UVVA 1APSA 3CJ3A 4DFPA 2XYGB 1S97A 3WQPA 5SUHA 1AROP 4KSEB 3BZQA 3IRXB 3WDOA 5CYJA 3MUMP 3JAMY 4ICLA 2KB2A 2HSEB 2FHJA 3POTB 1FEEA 1NK8A 4DEZA 2ZH2A 2UUCF 3HD2A 2JC1A 5J1EA 3R1LA 5CHCB 1SC4B 1RBOB 3I5AA 1TL7A 2J7UA 5E3AA 4ZN3A 3K57A 2Q79A 4CLUA 2UV8G 1RAOA 4WK1A 3BSAA 1NM2A 1VCTA 2WRMA 1TUVA 2QLFB 3BM7A 3S8SA 1VHFA 4EO6A 1AZSA 3DLEB 1Q16B 4B9NA 2H5IB 2MYFA 5BYRA 1WNEA 3D5MA 4NLYA 3OQ2A 1S59A 2QC3A 3VQTA 3OVAA 1XMBA 4DR1F 2E44A 2CPHA 4OHXA 3K59A 3DDNA 1MROA 5A8RB 1GH8A 2CQ2A 4O44B 4HL9A 2OPRA 3DU5A 4ZPDA 3KFWX 5DGAA 2ZH6A 4CDIA 4A8YA 5K14B 3EGWB 2Y8YA 2BANA 5H9EK 1HBNA 3H8YA 2QFJA 3I56S 2F7VA 2EVZA 1HNIB 4Y0FA 4KR0B 3TJ9A 2DRBA 2IRXA 2X1GA 4P2FA 4PYAA 4R25A 3HVAA 2ZKUA 3HVTA 4LF5J 2QX0A 2ROPA 4A8XA 1LV5A 3MMAB 5K9FA 2CQ4A 3C15A 5A6WA 4UZCA 3AOCA 3M8PA 1T9TA 2WOMA 4CLZA 2R7WA 2K3KA 1I1GA 2IRUA 5D6GA 5HP1B 2J6UA 2W4CA 2NZ4A 1P8GA 1GEHA 4O4RA 3H2VE 3BBBA 2M7SA 3A3OB 1S57A 1Q7LB 2WSEC 1PYOB 3GFHA 3KHHA 3V2UC 4UY8T 2RAQA 3L7UA 5G0RA 5E2QA 2DR7A 1X5PA 1FRKA 4NMLA 3OTEA 3U1LA 4DPUA 5M2RA 1KS2A 4AFFA 2VIHA 2YX1A 1LWFB 1VDHA 4X65J 2HIYA 2WVFA 3E01A 4EGLA 4LSLB 4AQYJ 4ID5A 1T9XA 2WVDA 1X9WA 2C2RA 3TAPA 4J90A 4RUAA 1U7LA 1U8SA 1BC6A 4ZDNA 2F65A 4ZPBA 3PW0A 4OJ3A 1PC4A 2CXEA 3GV7B 1KFDA 5KFNA 1H38A 2GIFA 2XZDB 2KYXA 2E1PA 4UW2A 3K17A 3N4WA 1SL2A 4GKJJ 4Q0BB 1KSPA 2MDAA 2BMBA 2GMHA 1EP4A 4NLQA 3KDOA 4NLWA 3UN3A 3KK3B 1RCXB 3SSSA 1D9FA 3TOQA 1Y3KA 4K5RA 4ECSA 4IG3A 3NWGA 3EGVA 4KHRA 1IWAA 4FF2A 3W2VA 5DDQC 2RNEA 2OMLA 3RYLA 2CJQA 3BR8A 1VQ7S 1CG2A 2XMTA 2BXJA 4DCPB 4CI0B 2K06A 2GGPA 2J5AA 2F4VF 1ZH5A 3QYYA 2U1AA 3ZZRA 4O4GB 4Z7CA 1EARA 4HT5A 2O66A 1Q7YT 2DHAA 4MYUA 3G82B 1F1BB 2PA8D 1CJUB 2EFGA 1N8RT 1UZHA 2CQHA 2HHXA 3W2WB 3CJ5A 3OV7A 5G4DA 3T9ZA 4TY8A 1HLWA 1U1MA 3BGUA 3CJRA 2HRTA 2CRLA 4RNFA 4IOAQ 3CCLS 2JEJA 3PCOB 2GAHC 4FBUA 3RW6A 4F7VA 1CS4A 9ATCB 2AP6A 3CDWA 4JI0J 3ISNC 2DNHA 4QIVA 5JVGQ 5HI7A 1YK9A 2CVEA 4DV1J 1XR6A 3NRBA 2WSFC 1S77D 3HK2A 3AD8C 4URGA 1HL6A 2N82B 4J9SA 1UVNA 1HBOA 4HTJA 3H90A 5AE2A 3UR0A 1AA1B 1KQSR 3MEEB 4YR0A 5KOWA 2Z56B 3WX8A 3MECA 4KGKA 2FVRA 1C1BB 4IQMA 3DLHA 3RU0A 3SCIE 1XK8A 5F9LA 2B4VA 2BE7D 2NREA 1CQMA 4DU7A 5IT9Y 2UXDF 4LF1A 1ZS6A 3QGGA 4KGMA 4OYAA 1S1VA 3DM2A 2RIJA 3GYNA 3NS7B 5J2PB 1SJ4P 4F36A 1VRQC 2ALZA 1R8BA 4ZLLA 1C0TA 2W2OP 2YH1A 2RH3A 4JB8B 3D4JA 3G71S 2NXJA 3GIMA 2W9CA 3HKZD 1C4CA 1RHUB 1KTVA 3IO1A 1QTNB 1R31A 2AYEA 5AT1B 4I6YA 4CCHA 5I42A 2VU5A 1NSAA 3D0GE 4KT0C 5DDRC 4DV3F 1ZZNA 2V34A 4A47A 3GYGA 2ASLA 3GJTB 1PCAA 4GKKJ 2ZBCA 5AXLA 3I9ZA 2H51B 3EWGA 3MOJB 1Y10A 1VQ6S 2F5GA 2DNZA 1VBXA 2NZCA 4WP8A 3PVXA 3HCXA 3KLEB 5LMNJ 2OKQA 2LQ5A 2OIHA 3N5FA 3D0IE 3BF4A 1OY6A 2FJVA 4E2FB 3BQ1A 2CNLB 2FB0A 5E5NA 4URQU 5DJBA 5GMEA 1T3OA 3CJKA 3VV2B 1VGYA 4HVZA 2EG1A 3D6TB 1NJYA 5IV4A 1BUXA 2PO4A 1CULA 1GAOA 4JI6J 1FKOA 3AA8A 1TKXB 3HFZB 2VA3A 2XG8A 2A6MA 2XSFA 2I38A 1FFSB 4PABA 4F50A 3A1YG 2BKOA 1VRUA 2HLUA 3A4TA 1XR7A 2DHXA 3AJ1A 3P5BP 4ZPAA 4ZPTR 3MEGB 5HBMB 4TY9A 1OSDA 5DG9A 5KFTA 2PEHA 2VDHA 5DDOC 4DPXA 2D7SA 2V2QA 3T6BA 1RKJA 3JSMB 3OT9A 3I0RA 3GIRA 2DGTA 3ZTQA 1AUDA 1RHJB 1K44A 1IKXB 4B3SJ 4RW8A 4ED7A 1FT8A 4PKDB 3L7OA 4I2QA 3FRZA 3PR5B 1F5AA 4MFBB 1LW0B 2DGSA 4DV6F 1F9HA 4QWDA 3F44A 1DLOB 1ZYQA 3MM7B 2HWIA 4OQJA 2O67A 1VBKA 4J37A 2JVRA 2VQFJ 1RT7A 3AA9A 4JI2F 2BJ1A 3GJSB 3K58A 2BVZA 2OFGX 5IQQA 1XQIA 4Z37A 5CYMB 4NWBA 4LR9A 2R3VA 2FHOB 4WWSA 4G1QB 2XNQA 2ZJPQ 3E51A 3M8QB 4S0MA 3ZTSA 2AIRB 4DQSA 2WBMA 1HHSA 4U7CA 3QLHB 4OYZA 3KLVA 1JB0C 4TVAB 2VG5A 3TUJC 4A8QA 2GO8A 3L9ZA 1Y9OA 4AYBD 1HNXF 2YNFB 3C6UB 3GB0A 1KTQA 2D3O1 2DR9A 2EWHA 3GV8B 2Y9HA 2BW2A 5HLFB 2IHR1 3EMTA 5KT6A 2RF2B 5E3QA 2G0JA 4LF7F 2HFZA 2QRRA 4EO8A 4CNZA 2V63A 2RKIB 3VTIA 5A8KB 5L1IA 3IBCB 3H5UA 4FYXB 1HHQA 3DOMB 2QL9B 3M2UB 4CH7A 3KMQA 5I3UB 3M2RA 2L9DA 3GR1A 2HS3A 5L9XA 4X66J 4C3LA 5EN1A 4BCAA 2ZE2B 4FYVB 1YBTA 4RW4A 5GAHU 3KHRA 1T05A 2LU1A 2FY8A 3S6EA 3NG8A 4WFZA 2L41A 4K4XA 2OPQB 1HBMA 4KO0A 1NCLA 2DGWA 4DZDA 3CCRS 4IOCQ 5BYSA 1X4HA 5CH7B 1JXEA 2XY6A 2HNZB 1RT4A 1OWXA 1M5KC 4ZPWR 2ERRA 4FF4A 1JXLA 4ZP9A 1G4CA 4OI0A 4JI8F 1NKEA 1B0TA 5M2PA 5J2MA 3PW4A 5ETLA 3RBXA 3T41A 4PRFA 3NCRA 4PG5A 4I56A 3LGMA 1X4GA 1IUJA 4ZLJA 4LRCA 1FJEB 3CW2C 2BOAA 1EZZB 4LSNA 1WD6A 5HMXA 5EX0A 2E1RA 3KLIB 2HQCA 1KC8T 1KONA 3G6ES 3FK4A 1KVKA 3A8JA 1JNZB 3GG1A 3J7A1 2GHPA 1ZM9A 2M4MA 1X0PA 2Y3YA 3VAJA 2B56A 3IAS9 2RQCA 5C5JA 4IKAA 4K4UA 3QIPA 2J9CA 4ZVGA 4PAAA 1YG0A 1U0HA 4NPOA 4C6AA 4HTIA 4ES2A 1RUSA 2MSSA 3LP2A 3F56A 1TUWA 4DV0F 3UI3A 2MJNA 2YQ3A 5MLCV 4DPOA 3VWSA 4FYYB 2Y1RI 2BJ8A 2ZHAA 3ILIA 4JI1F 4K0KJ 3QFWA 1SC6A 1NZAA 3MR3A 4LFAJ 1P6TA 2MZTA 2KI2A 2ZH5A 2ABYA 2FD2A 4W98A 1F9FA 3DN9A 3SSQA 1DARA 5HROA 5F8MA 1FXLA 1IXKA 2ACYA 1LK5A 1ZTTA 4XPEA 4ED4A 2OPPA 3M32A 1MMDA 2IJRA 3DRPB 3SIPB 4IDKB 1VFJA 3UVJA 4DR2F 3PX4A 2QSWA 4AL6A 2GFFA 1OSCA 4RR5A 2B5JA 1KOOA 3BKFA 1QE1A 4FF1A 2W2MP 2CPEA 2P9EA 4PWDA 3MUVP 3IWLA 1FDNA 1LNQA 2EEYA 3NL0A 3N79A 3QIDA 1P9YA 2BJDA 2CPDA 3RW7A 3LPYA 2DB1A 2Y1LB 5KFIA 2NUUG 2BE9B 1C1CA 5HSPA 4CLTA 4CLSA 3ZZUA 2FJDB 2BR0A 1KKHA 1K0VA 2PIIA 2BACA 1Q82T 3U02A 3KUEA 1RKIA 3VGUA 2YNHA 4G3IA 4C8ZA 1F2HA 1T9VA 4U8VA 4PUOA 1R7IA 2FJBB 5I3QA 1P27B 3HSGA 3I0SB 3D1OA 1IWGA 1WUUA 1U1RA 2CWXA 1REGX 2CNOB 1NPRA 2IAJA 1LXJA 3R7NB 3DLLQ 3D68A 4JV5F 4DUZF 3MXHP 3LP0A 1WEYA 1G3OA 3EJMA 2NPFA 1B3TA 3OHBA 3D2WA 1XC9A 3BGRA 1YRXA 3TQEA 3CIMA 1BXNA 2QSFA 1FD8A 3KK2A 4USIA 3DLKB 2W8KA 3RZAA 2IVFB 1KQGB 3DOKA 2Z2YB 4LFCF 1S9FA 4DL4A 1OY9A 2VFRA 5MAOA 4HACA 5HMWA 1JXVA 1TU0B 2IC3B 4OX9J 3H40A 3HI9A 4PR6A 3TEGA 4DX8H 4X4QA 5HQLA 4OYWA 3J81j 3THVA 4G6VB 1HQEA 5FJ4A 2MGZB 4DBQA 2MLXA 4ZPVR 3KK1A 1KDNA 4A8OA 3M6XA 1UFKA 4FPIA 4HH0A 4WJBA 4GO7X 4ECRA 4OMFG 1TV6B 3QJPA 3SYZA 3IM9A 2R8GA 1N56A 2RT3A 4H4MB 1WHVA 1RZMA 4B9MA 3KLHB 3SCJE 4X64J 4R8UB 4JUZA 2VG7B 4NLOA 4OX6A 2JRSA 1VS3A 1X9SA 4EK2A 4DV5J 3UD5A 2HZCA 2IDLA 3IWNC 1MW7A 3MPVA 3C19A 3KJNB 3TP2A 4U96A 3OTOF 4KV8B 3CPWR 1Q4RA 3SCKE 1SVDA 3J81Y 3V81B 1Q8BA 2V4RA 1RTDB 3HZEA 5IC4B 3OXLA 1RT3A 2CFXA 3J81U 3V6DA 3UDCA 2B9WA 1WC6A 4WE1A 2JLGA 2JLEA 2QYCA 4N76A 2EBGA 3NXZA 3US5A 4A8WA 2LEAA 1N34F 2V68A 1TMJA 2YH0A 2LU2A 3LWLA 3SQGB 4IRKA 1WC5A 1KQKA 4KAIA 4OZ0A 2J0WA 3UFCX 2LDYA 2ZDPA 2HYIB 3MM6A 4NLUA 3DRSA 4F4ZA 3CTRA 4K2JA 5CCLA 2BE2B 2G9OA 3EE3A 2JNJA 1BWEA 4X84A 4K4TA 2UUCJ 4PQUB 2V8VA 2HWTA 2V67A 4DQPA 3W9JA 5DZ6A 2H5JB 1BE4A 2OD4A 1YJTA 4H4OA 2XCPA 3RAXA 4GC6A 2VB6A 3TQ1A 3KYLA 3CCZA 3H4DA 1KFSA 3HP6A 3IR5B 4B9VA 3M9OB 2HZAA 3CNQP 4LF2A 1RU1A 1BLUA 4TYAA 4EWTA 5KG2A 1ZPWX 4OZ1A 2JC0A 1RAAB 3OUYB 5A2QY 3QT8A 1HPZB 1TFYA 4DR1J 4KPYA 1URRA 5B09A 3CD5A 2IVYA 3ZNJ1 2NXUA 4MH8A 1YQHA 1CJKA 1BQNA 5L38A 3QSYB 3RJMB 2VFSA 1J5OA 5KFYA 1SJQA 3BYRA 4ECXA 1HWUA 2HHPA 4FZVA 4ZVEA 2OD6A 1RACB 3DI6A 5HK4A 3LF0A 3DLJA 7FDRA 2IYGA 2R2RA 1GMWD 4WFAQ 4WTYA 2HQIA 1FTRA 2Y8WA 3IA0A 4KHMA 2JZ5A 5KOXA 2HQFA 4BWJA 1N36F 3FFIB 3MTKA 3OR1A 4ALZA 2WONA 1VQPS 1SIZA 2HKEA 5L1JA 2MKJA 3UD4P 3MF5A 1WTFA 2F40A 4WPAA 2GVDB 3DNCA 2DTJA 1WDDA 4ZCKA 2HHVA 1HIYA 1TP7A 3BH7B 1EETA 2I5JA 5EGYA 2VJVA 2EW9A 3MPUB 4DLGA 3IRWP 4PQAA 1RAIB 2L3MA 1VQSA 4ZLNA 4LRBA 5F0WA 4CYUA 2XCAA 3TJ8A 2QLWA 4DQIA 4HH1A 1G2EA 4NYOA 1NAQA 4YEAA 3RR8A 2HNDB 3Q8SB 1C4AA 3OR2B 2YQ0A 2R2UA 3MDFA 3IRXA 1RHQB 1FA0A 3Q24A 3IGVA 1S7IA 2D74B 3SEOA 4GRSA 1QSLA 5BYQA 3O6QA 1NU4A 1W7WA 4USTA 4KIAA 3BBCA 5D0RA 2A18A 3C6TB 2MQ8A 5B0DA 1OPZA 1TTHB 4LR8A 4NLDA 4L72B 4KGVB 2BYCA 3VVTA 6FDRA 3NBPB 2C42A 3ILJA 4ED3A 3TZZA 3DLGB 4U95A 2E5GA 5AE1A 2VFUA 2APOA 2GHVC 2D9PA 4BC9A 5KTQA 1U1KA 3DLEA 3AH6A 2AWZA 5LOQA 4WP9A 4HYKA 5KG4A 4OZ3A 3H4BA 3UDEA 4QU7A 2C1EB 2WVEA 2EK6A 3MAQA 4MIBA 4OI2A 3T5KA 3OFFA 1I3OB 5A8RA 2YX4A 2XY5A 5KFBA 4O44A 3QQCD 1DQ9A 2M8HA 2DR8A 2F4VJ 2KXNB 2AJQA 3EVWA 1GFWB 1MMLA 5K14A 1HR0F 2OSQA 3J7Z5 2XYPB 1SJ3P 4LF5F 1NLKL 3EVMA 3JB9k 1HNIA 3U1NA 2MY8A 1N6QB 5AXMA 2GMLA 2D41A 1RAFB 5KFUA 2DR6A 3TA0A 4DSLA 1NDKA 2H54B 3W9IA 1KEKA 3MMAA 2R7TA 3OTDA 3MM9B 3LGNA 1WG5A 5KFHA 3PY8A 2W2NP 4C0BA 4V1Ak 4HEA9 2NYIA 4MAKA 3WC0A 1H3DA 1RTJB 4XTTA 3B8HA 5IC6B 2XI3A 2ZOMA 2CUYA 1TUGB 3OFGA 4ZP8A 5HP1A 1J27A 3B4MA 4FYWB 5LSRA 3I82A 3IG1B 3HF5A 5C25B 3HJVA 2XMKA 2DHSA 2LLZA 1OQ3A 4P73A 3OW2R 3CDAA 2WCXA 3UNYA 5RUBA 4DS4A 2B9XA 4MYTA 4IR1A 2UXDJ 3ET6A 4ZITA 3F73A 1PILA 2N7CA 1LWFA 2MKYA 4NCBA 4CO1A 2HBQB 3UQSA 2HFVA 3M8YA 1RTZA 1R43A 4LSLA 3JYTB 3N01A 1VMBA 5AE3A 2Z8QA 3DDIA 2DNYA 1D8ZA 3PV8A 3A3NB 1NH7A 1TL1A 3GFXA 4DV3J 3QFHA 4FXWA 2FJEB 2CQIA 4Q0BA 3PKYA 2EK1A 2RJZA 4AL7A 1N33F 2IYIA 2HVEA 4NI2B 3UPFA 3KUGA 3N28A 1M5OC 4EFAC 1L3KA 2I8EA 5B0AA 5CABA 4B3TF 1ULRA 3ZTOA 4Q5VA 2YKMB 4K50A 1HNVB 3CDEA 2J7KA 5F41A 2MZ1A 5LMUF 2DGXA 3H42A 3ZO7A 3X1LB 1SCJB 1WG4A 1X8DA 1HI0P 2PA3A 3AD7C 4IO9Q 1RADB 4CRJA 2KDOA 4OZNA 1RWWB 4EZ6A 5BXIA 2HRUA 3MM8B 5HMZA 1RWVB 3U7JA 4CM2A 2E5JA 1RTIB 4O4GA 1NK7A 3K5NA 3R6LB 4IG0B 5ETVA 5D4OA 1ITPA 3EM1A 3ZTRA 3EPGA 5D0EA 3HMJG 5THWA 3G82A 3FEXB 1VRTA 1CJUA 1YITS 3T1AA 1HNZF 3W2WA 3ZTPA 2J6TA 1TAUA 1LXNA 1VLYA 3C2PA 3ZXWA 2BM0A 4ZOSA 4MKBA 2DJWA 3VZIA 8RUCA 2XI2A 2UZAA 2PMWA 3DMJB 1JNRB 1VIXA 5KFLA 4UUWA 1YLXA 2OI2A 4O3RA 3PW5A 1RK8A 2HFNA 2WB1D 2G1DA 2BW7A 3IBFB 1GTHA 1RQ0A 4DF4A 1EQMA 3ETMA 1X5OA 1JJHA 4PWWA 2AJ1A 3ENQA 2Q6CA 3AQOA 3MEEA 2E7WA 2CZVC 1T3NA 1C1BA 3IMQJ 4JI2J 3V4IB 1F0XA 4Y3CA 1DURA 2VC0A 4USJC 1YZ6A 2XMUA 2UVUA 2GCFA 1IR1A 1EB0A 2QN6B 5J2PA 5DGBA 2EFQA 1KLMB 1JLGA 2HVHA 4C8NA 1XN9A 1HKAA 1MNEA 3MTJA 3OJSA 1HNXJ 1Y5IB 1XMQF 3JQMA 4X4VA 5AJ3F 4UZBA 1U8WA 4NLPA 3G8SA 1FRMA 3LWMA 4H4KA 1RTHA 3TUZC 1YX2A 5E41A 1WOOA 3QRQA 2CVIA 2HMIB 1U48A 4NEYA 1H2UX 5IOLA 3NGSA 1U02A 5F8LA 2J6SA 1W2IA 3RBZA 4LF7J 1TVRB 1H6KX 3KLEA 4ZMMA 4WKRA 1LFPA 4B9SA 1AFIA 2KHDA 5HO4A 1RA7A 2JX2A 4ZN1A 2AW0A 1T8EA 2UUBF 1B64A 3H59A 2KZMA 2PT0A 1SPBP 2R2TA 1VQ9S 3VAMA 3HT0A 5IT0A 3DGVA 4YFUA 4DFJA 2OMOA 1GXTA 3P49B 4YP3A 3GLJA 2ATCB 2N3OA 3H5SA 4A4JA 2XBPA 1TKXA 4N8NA 1N5VA 2PC6A 4DCJB 1FXDA 2XMVA 2K1RB 1IVZA 3PFOA 3S01A 1Q79A 1YJUA 1YRTA 2PD1A 1TK8A 3CULA 3MEGA 4HDGA 5HBMA 5F8IA 1SJRA 1QVGR 3RTVA 2N4DA 3FUYA 3TZWA 2KM8C 4PXEA 4WP3A 1O0PA 3B82A 4XDDA 3Q8PB 5L1LA 4TN2A 1YZ7A 2FZCB 3EDQB 1RXOB 3JSMA 2RRAA 4KB7A 2KRRA 1UFLA 2HHSA 3HHLB 4WIQA 5DLFA 1IKXA 1RGVA 3PX6A 3LAKA 4I4BA 1VISA 4N5SA 3JQKA 4MFBA 1LW0A 1R8AA 2CNKB 1B7YB 1DLOA 3FQKA 4P10A 2DISA 3MM7A 2V50A 3O2IA 3I4HX 5L8RC 1DRZA 3P96A 1ZAVA 3C16B 2UUTA 3MAAA 4X4OA 3G6YA 4NCAA 4C2MA 3NKYA 5CYMA 2C2DA 2KKHA 4G1QA 3TZXA 3PM9A 4Y2IA 1S6PB 3M8QA 2ZHOA 1PC5A 1U1LA 3QLHA 3HHDA 1SKRA 2V94A 3KHLA 3OL9A 2CPJA 3Q8UA 3MPWA 4G65A 2IJNA 2FLPA 3M4XA 3CJ2A 1IN0A 4F8RA 3QWUA 1FVSA 4DV0J 2YNFA 3C6UA 3J80U 1RBLA 2W4PA 1U26A 4OJGA 4RW9B 4JI1J 3AJ2A 4IYQA 1XNRF 1RWKB 4MT1A 2Y0SD 2AU0A 5HLFA 1M1KT 3D1HA 1VHIA 2VICA 2RF2A 5HQMA 3OSPA 1NJIT 5H9FJ 2RKIA 5DM7Q 1S9GA 5A8KA 2NXEA 3ISZA 2NLWA 4BBYA 4JBCA 3M6WA 2R8JA 3MMBB 4Y00A 2JSXA 4DQRA 4F4YA 4U6PA 2JFKA 4DR2J 2R7SA 1JJ4A 3DOMA 1QTMA 2IM1A 3CJSA 5I3UA 4JYAF 1CC7A 1Y5LB 5KG1A 3MOZA 1E6YB 1N5YA 4DPYA 1NK4A 3EUNA 1CJTB 2VZ9A 2Y1JA 1DTQB 3RG6A 2RQ4A 4UOFA 2BOPA 2NXNA 2VBYA 5LSLA 4JV1A 2VPZB 5HAOA 1NZ8A 4YHHF 4DL0C 1SL0A 5CYQB 2OPQA 5KG3A 1Q8IA 2H48B 3BKUA 1URNA 2HNZA 1XIQA 2BRLA 2JEGA 1R0AB 1S1WB 1RLCL 4PEOA 4B9UA 3NMRA 1B4SA 1EKSA 1FDBA 4ETZA 2EFPA 4DR4F 2LQ9A 4TU9A 3N5BA 4TLRA 1ELOA 3FSIA 3UCZP 4JV5J 4DUZJ 3HZGA 1A0OB 4ES1A 3T19A 1PO6A 3IWXA 3KLIA 4FPRA 3KG4A 3THTA 2GW8A 4C0HA 1RABB 4O0NA 3CCJS 2DPJA 3D3BJ 1X9MA 1QLNA 1R8CA 1PSDA 4UOCA 2BQRA 4ED1A 1AB8A 1VQ4S 4HLBA 3CDUA 4LFCJ 1TFWA 1S99A 3RBEA 4ZVUB 2MMYA 3BKTA 1M5SA 4CTAA 3MURP 1SJ1A 3KXDA 1HWLA 5ETTA 1VC6A 1GMVA 1UVJA 4IFVB 2BDPA 2V8GA 3IN5A 1AZSB 4JOUA 2CDRB 2QEXS 5EDWA 3T5HA 3KG0A 1G6BA 4ER8A 2ZJRQ 1NHVA 4ZKAA 3RRKA 4LRAA 1KN6A 3CO0P 3B4DA 2W2PP 4LQ9A 4C48A 2VL1A 3OTCA 3R5GA 2FC8A 3QT6A 4NRTA 3W5ZA 3OFEA 1M5VC 2UU9F 2OHDA 2GC8A 5IQ6A 4B17A 2B8QA 5B08A 1K47A 3DGPA 2QA4S 1EX8A 3I9V9 3DRPA 3LUYA 1S0VA 4Q7AA 4LFBF 3M6VA 4DPWA 3OTOJ 4C97A 3QGHA 3MPDA 4UUXA 3UN2A 4OI4A 4ED2A 2J0QD 3M2VB 3ZZPA 1YJNS 3B78A 5T41A 1KD1T 1YKWA 3QJJA 2C3PA 1OIAA 2ZC3A 1ZTWA 2WOMB 4QJVA 1IJEB 4RWWA 3EZUA 4IRDA 4O3OA 1FNXH 1RHRB 5IT4A 2PE8A 2DXFA 4I6AA 4ZVOB 1F5BA 2ROEA 2HHTA 1GQEA 1N34J 1VC5A 2NSCA 1CJVB 4NZ7A 1V9OA 5KFDA 1PG5B 3OXFA 3I0SA 1NB2A 2E5HA 2M9KA 1NXIA 2LQJA 3NOCA 2VOOA 4DX6A 4X4PA 5KFCA 1NJZA 3HVRA 1Q86T 2RHSB 2VV5A 2ZC4A 3BJYA 4NYPA 4RU2A 1NKCA 1IQTA 5HJXA 2ZD1B 4YOEA 2H5EA 3C14B 4J9NA 3NY0A 1SI9A 3DLKA 2LKZA 2EFOA 1LQ9A 1YHQS 2VDIA 2ACMA 4NZ6A 1X4FA 4J9VA 2HLTA 3A3PB 4EBCA 1V3RA 2ZBQA 3AY0A 1EP4B 4OYMA 2XHWA 2IC3A 3G6XA 3MI7X 1QAIA 2L9NA 1YI2S 4F2SA 3Q89A 1XBWA 1FI4A 1QDUB 1RAGB 3W2VB 2MGZA 2Z58B 3W9HA 1Q81T 2X51A 4DU8A 1QY7A 2JHEA 2DT9A 3TA1A 3TAQA 1TV6A 4FS1A 2DIUA 4QYZJ 2JFDA 2M88A 4CP5A 3THPA 5IXUA 4A46A 3IS9B 4L74A 1RT5B 4PZVA 4H4MA 1NHUA 1D8YA 3NLCA 5J2NB 3KLHA 1S1TB 1H73A 2CJ9A 2IMWP 2VG7A 4ECTA 3OJUA 1T9WA 3BS9A 2CQDA 2D3ZA 1SQGA 4GVBA 4KV8A 2B9YA 4QWBA 3W5YA 4A8MP 3D6MB 4LMZA 3D1QA 1SXLA 2D3UA 1RTDA 1F5CA 1RWOB 1T0TV 4A8FA 2DY9A 1VQOS 3BR9A 4NRUA 2HEKA 2XSJB 2YWWA 4XK8C 2W9AA 2XEXA 2MQPA 4LBHA 2ATLA 4MK8A 3VALA 4N41A 2ROGA 1KP6A 2P5VA 1Z2ZA 2DR5A 1S1UB 1EJ7L 2ZH4A 3SQGA 1GX5A 1Q78A 5HQ8A 1X4DA 3AFGA 1SIWB 2HAFA 1Z1ZA 2LFVA 1I6JA 3NNCA 5CA5A 1TKTB 3M7VA 5FIIA 4M95A 1QAXA 3KJQB 1FX4A 1UEUA 3QGPA 4DG1B 2BE2A 4HI1A 1LFWA 4YS2A 2ZNYA 1S0NA 3U27A 2A0FB 4PQUA 1VYAA 3K8VA 3WC2A 5H9FK 3H98A 2E7VA 3RBDA 4QPXA 5KT4A 2CPYA 1S10A 4LF9F 3GU0A 2BQUA 4U7UD 1TKZB 1H7WA 2FJXA 1FVQA 4OJHA 2DCUB 2XMJA 1XMOF 2AJ0A 3PKMA 2YPYA 1CQNA 3TEHB 2AZ3A 5KFOA 4B02A 4OLPA 3OUYA 3UDVA 1HPZA 3CC7S 2Q66A 5CQGA 2WTFA 4B3MF 1FKPB 3TJAA 1NJWA 1JLEB 3IR7B 3BDEA 2FUG9 1VBZA 3CXCR 4YR2A 2OEKA 1WDTA 1YWXA 1PYTA 4JI5J 1Y4ZB 1HR0J 4B3OB 4ZVQB 3MR7A 2NYHA 3RGIA 2RUGA 2R8HA 1SQFA 4HI2A 2XHCA 3M1VB 1D1UA 1RAHB 4FS2A 4WK3A 1YSJA 1S49A 4RNMA 1QAYA 2MY7A 5DETA 5KT3A 3FFIA 4IQXA 1RWNB 4FNIA 3KJVB 3DC2A 4QIWD 3PW2A 2Q6BA 4USWA 4O3SA 3MMCB 2M5YA 4OV1A 4C8MA 3BSOA 3A13A 3C66A 4Y2AA 3FC9A 4ECUA 2G2OA 3A12A 3AJDA 4QWEA 2QMWA 4OI3A 1W25A 3R5AA 3W61A 2C3OA 1BQXA 2YNIB 2IPOB 2QFIA 2KTQA 5FLXU 3FBCA 5IV3A 1IKWA 4ZIWA 3TRGA 1UP1A 1IR0A 3NCQA 5FDLB 4WIIA 5KFJA 3RRHA 4M5HA 4ZJQA 1CVJA 1WHWA 4XDCA 3L4BC 5DS7A 4DMZA 3OR2A 2KT2A 2HVDA 1S6UA 3T6JA 4OX7A 2BJEA 3SI8A 2OGUA 3QNWB 5JVHQ 4DL3A 3DHWC 2HNYA 3TUIC 3HJFA 5E0OA 4Y2MA 2RILA 4Y2CA 1U2CA 1X7VA 1A9NB 3NOGA 4I2PB 1F60B 4L6V3 3KNGA 2W4DA 3BREA 4P2MA 4O3PA 3R3TA 5HMYA 4WZMA 2PN6A 2CKWA 2KT3A 3NBPA 3GCXP 3PIOQ 1N33J 3RUBL 3W63A 3HSZA 4K4VA 3NNAA 2MSTA 3QZ7A 4CT8A 3L95X 1O51A 1TR0A 5B0FA 3KHGA 3RRGA 2DXEA 3G96A 3QO9A 4B3TJ 1U6ZA 3GTYX 4AXIA 4Z7YA 5LMUJ 1T9UA 4JV2A 4RW7B 3TVYA 2FC9A 5GAEI 1FJCA 2QG9B 4OIXA 2YKQA 3W5XA 3A8IA 3CCTA 3H25A 5DG7A 4MIWA 1S0OA 2OEJA 5B0CA 3K5MA 5A8WB 2UVWA 1KR4A 2YWEA 2EFVA 3CMAS 1AYEA 3H2LA 2EPIA 3TA2A 1S6QB 1YJ9S 2J8AA 1BD6A 4DR7F 1AW0A 1T11A 1ZA2B 1Q5YA 2OO4A 2PDAA 3EX7B 2B0GA 3GILA 1HNZJ 3H0PA 3C8YA 2AZ1A 1N6QA 1VQYA 2DH9A 1BQMB 4RO0A 5DRKA 3GQCA 3VGVA 2P6TA 4OI6A 4Q44A 5KFVA 1SC3B 4ZK7M 3K8WA 2OPSB 2J0SD 4I7FB 1NDCA 1PBUA 2VG6B 4ZVTB 2CJBA 2KG0A 1O6XA 3D54A 3S1TA 1RTJA 2YQ1A 3FSXA 3IG1A 2ASJA 4L3NA 1A6LA 1D9AA 5EWGA 5C25A 3BEGB 2MHEA 5T7LB 4U8YA 2ZHBA 4EBDA 4PYDA 4UOHA 4KBIA 3GCWP 1K1QA 2C2ZB 4QCLA 1LWXA 1JLBB 4HT7A 4LBIA 2IA6A 3E8OA 3JQJA 5ETQA 2JDJA 4PG6A 3S7RA 3LOUA 4KYZA 3T5LA 2RDIA 3JYTA 4QYZK 4DLEA 4FNHA 3MMJA 2CJXB 1U1OA 2FLNA 2RS8A 1XMQJ 5AJ3J 5DM6Q 3PRDA 3I96A 5C2CA 2YY3A 4I68A 2HBZB 1HD1A 2IA0A 2QIFA 4QIFA 5KFWA 5GAGI 2EC2A 3O8WA 4QW9A 2HAIA 4WXWA 2IMOA 4NI2A 4GO5X 4CO5A 3PNIA 1FJGF 4XAKA 2OTJS 1OYDA 4HKQA 1PAUB 4CWBA 2YKMA 1NPPA 1HNVA 2MQNA 5LJ5Y 2UUBJ 3DLBA 2FVSA 4ZLPA 3FSYA 5HROB 2XMWA 1GXUA 4B9TA 1FNOA 4X4UA 5AXNA 3ZZOA 1S1XB 1UL3A 1PGZA 3V5RA 1U47A 2QLJB 2HPUA 3D3CJ 2LXUA 2KFYA 1RTIA 3QJLA 1X0FA 1JLCA 4ITSA 4NLGA 4IG0A 3AB2B 4LF6F 3KJFB 4RWXA 3CD7A 2O3DA 2Q1LA 1SKSA 4F4XA 2AF6A 1T95A 4M5NA 1OJ4A 4OYXA 1CC8A 2AX1A 5M2UA 3BDPA 2B6AB 4X62F 1CBKA 3RB4A 2IIHA 1HARA 3JXOA 2HK2A 1RWXB 1C1CB 1JWWA 2DD8S 1FXRA 2QA2A 3DMJA 1T7PA 4RJVA 4AUKA 4WU2A 4OLOA 3CSKA 1NDPA 3IGNA 1PIEA 2X1BA 3W66A 2QYGA 2KU7A 3VAIA 5HL7Q 3I87A 2V5HG 5D8HB 1TK0A 3CCSS 4KGZB 1RWPB 2QL7B 5K20B 2V4JB 3FCHA 3GWCA 2IAJB 3UNGC 1S12A 3CJ0A 2ILZA 1WI8A 4RX6A 3TI0A 1CEZA 3LP0B 2I2YA 1A7GE 2R7VA 4QR2A 3V4IA 3BGFA 1IM6A 1JKHB 3B6BA 1TQLA 3QT7A 2KFNA 3R5CA 1UVLA 4ENOA 2ASDA 1HQUB 5D4PA 4ILMA 3DXBA 5A76A 3VGSA 3WIVA 2DH7A 2WBRA 2DNLA 2KVIA 3GG0A 3O44A 2ZWPA 3W8GA 5F8NA 2GQQA 4LR7A 1LK7A 1FWLA 5A6PA 3EGZA 2RSQA 4DL6A 2HWHA 3CB4A 4DS5A 4NZ0A 2FHMA 3DOLB 4N47A 2IBKA 2E1MC 3CMES 3DRYA 1NK9A 1XNRJ 4BHQA 3L3CA 3PDNA 4X4RA 2FJWA 4ZP7A 4W4MA 3LH2S 3Q86A 2HS4A 2GS8A 1WORA 2HMIA 1IBKF 4F67A 4YR3A 2W25A 2O5DA 1TVRA 1UKUA 1FE0A 3SSRA 2BJ9A 3ICLA 5E3CA 4E8UA 5HN0A 3CE8A 2WVCA 4CIOA 4OV6A 5KG7A 4PWUA 5T14A 3M9MB 2AV5A 3UN5A 2HHUA 4JYAJ 2I1RA 2N7YA 3LQVA 3QPIA 2LEPA 5KG0A 4Q45A 1YBAA 2VQEF 3P45B 1DY3A 1JX4A 2K1RA 3R2DJ 1MG7A 4J9QA 4YHHJ 4M5JA 1CSJA 2DNNA 2F8EX 1SV5B 2RRBA 1K1SA 2CNNB 1XEZA 3FBBA 3LALA 2R7OA 3ZZYA 1N54B 3ITHA 4DV4F 4Y2KA 2LQBA 2XY7A 4ZA1A 2AMCB 4JI3F 2AEFA 3FDSA 2HHQA 2KYZA 4N8OA 4DR4J 3HHLA 2HGMA 4HHJA 3V6JA 5LSOA 1EKRA 3GSIA 3MM6B 2CIMA 1LWEA 2KT5A 1M5PC 1XWLA 2XTJP 3PYDA 1G7CB 1FK9B 1RT2B 1NHKL 2QTWA 1ZPVA 2VKRA 3LP1B 5D3GB 3C16A 3EXCX 3H20A 1SL1A 1UFWA 1U6FA 1WHYA 3MGJA 5HVHA 1Y0HA 2UUWA 4JI4F 3VVUA 3MD1A 2IY5B 3CDBA 3MHYA 1WEZA 3FRYA 2DGVA 2KFZA 1HWJA 1S6PA 5KFZA 3FQLA 5KFAA 4K8RA 3HDSA 1MU2B 2DNKA 1OMSA 1CPZA 1GMWA 2H1YA 2PI5A 4M5MA 1V5IB 1OO0B 3EVOA 4X2BA 3G2XA 4RW9A 3DRRB 2XWXA 2LMIA 1UW4A 2AYMA 2MQLA 7AT1B 4RKUC 2HRYA 2YWFA 4PG7A 2CQ1A 2R4FA 5GMDA 2UU9J 3MCSA 2GIQA 5DG8A 1BMQB 2JJ4D 2J0XA 1WC0A 3FZBA 1HFEL 3PO4A 4EEYA 3C46A 3D28A 1FEHA 2E9ZA 2O01C 4ILRA 1MMNA 3HHEA 2DHHA 3MMBA 4OHZA 2DO4A 4LFBJ 4V19X 1HD0A 4ED0A 4LF8F 2MZJA 4NA1A 3PEJA 3PHTA 2GV1A 4DOZA 2B7CB 1E6YA 1HYSB 2Z4PA 3AB4B 3OL6A 1FRJA 2YTCA 1DTQA 1S79A 4RNNA 1E6VB 2LDIA 2BEFA 2IM0A 5KFPA 4UT4A 5CYQA 4TU8A 2W7PA 5ITHA 4DSKA 4TXSA 2DKOB 1OQ6A 3NMAA 1KHWA 2QT7A 4UTGA 3T1YF 1N48A 3HD1A 2RHQB 1Y7PA 1R0AA 1S1WA 4USVA 1H2VZ 4DQQA 1H7XA 3P3DA 2DNPA 4P71A 3CO9A 4CYUB 4NOHA 1RJJA 4K4YA 1RDRA 1VK8A 4NLXA 2DNOA 3UD3P 4CLWA 2B8PA 2Z30B 1UMJA 2V2ZA 3TANA 2IFXA 4MK9A 4NE9C 2HBRB 2W7AA 2MEWA 2KRBA 3NGDA 4OZJA 3CC2S 3JAMU 3CC4S 3NS5A 3Q8QB 3JSBA 4ZVSB 4C8OA 1RWMB 1FTCA 2HGNA 1DZ5A 4PCQA 3EPIA 3CIZA 4QOTA 3U1MA 1DTTB 3SQOP 5GAEU 4IFVA 1QJHA 2EG2A 3W8PA 5C24B 1R8PA 1ZAWA 2ZM6F 2DGQA 3H7HB 4OFZA 3W7BA 3LW5C 3PXGa 3Q22A 3R9LA 2XC9A 3EDRB 2VJUA 4M5DB 2EKNA 1KHVA 1MWYA 3IAM9 1SB6A 3ILLA 1AT1B 2WAQD 4WCEQ 3GIKA 3OSNA 4NASA 3FBEA 3ZZ0A 1MN9A 4UOGA 3WX4A 4M8LA 4M5IA 4EUVA 1U45A 3FEYB 5DQIA 1MWQA 1IM4A 4LVNP 3TUPA 1HW9A 1KWMA 3HVWA 4ED8A 3MM5B 2MXYA 4OJ1A 3G87A 4RLEA 1T9YA 4QR1A 2QV6A 5E3RA 2XZTB 2LXIA 2ZOFA 4C9DA 2RDJA 2ZZMA 1SUQB 5IM0A 3M2VA 3AOBA 3R8YA 3H2UB 3G4SS 2ZKTA 4MKVA 1TK5A 2GJFA 4URSA 2AYGA 1REVB 4DUYF 1SJFA 2BJ3A 2XZWA 3VHQA 2BABA 3M8WA 2AX0A 5ETKA 1K73T 4YB1P 2KO1A 2CJAA 3E3XA 5KFQA 2QJ3A 1ZAXA 1OPIA 4ECQA 1RT1A 1VOMA 1UPPA 5ETNA 4C8KA 2DH8A 1CJVA 2KXFA 1S9EB 4DHVA 3FMBA 4P7TA 4DDFA 5JMNA 4KQZA 2BM1A 2HW3A 5JUMA 4RBUA 1I51B 3MD3A 1JLFB 3ET6B 4DUTA 3EXYA 5LXRA 4EBEA 2HQGA 2J8SA 2UXBF 3NS6A 1OYEA 3W62A 4C7QA 2W9BB 3CEDA 4OHVA 5GAGU 2NS1B 1O5JA 4LF9J 2ZD1A 3HHLD 2OEMA 5KT5A 2DO0A 3VAKA 3C14A 2UXCF 3Q83A 3R5JB 2RUSA 1XMOJ 1TL1B 2C3MA 3RAMA 1IKVB 3W1YC 2MZQA 4LF4F 5IWAF 4FXDA 4ZHRB 2RU3A 4N7TA 1FWKA 2V8PA 1V3SA 1FKAF 4FKXA 5K5MA 4WU3A 1IR2A 5GMKa 4B3MJ 3ETOA 3IFEA 2GZOA 2GHWA 3KLGB 2K8GA 3QAEA 2RRNA 4DSJA 4EYHB 4OYBA 2M3DA 2BRKA 4WYWA 1ZETA 2OSRA 3ULHA 9RUBA 4Q8EA 1ICEB 2FZKB 4N77A 2NUHA 2VBZA 4RBTA 2R7XA 5F0UA 1DAXA 5I4MA 3IS9A 3TZYA 1JJCB 1RT5A 1DHMA 4IFYB 4CH0S 5J2NA 1N32F 1S1TA 2FHKA 1RU2A 1N52B 1VRTB 2IM2A 2F4FA 1S6OA 3QGIA 2V69A 2XULA 3NGTA 1UVMA 1T03A 3CWJA 4RW6B 4C11B 2PGCA 4E0DA 1ROFA 2WSCC 1K8AT 3M30B 2G4BA 1S7HA 4RU9A 1UWBA 2OFHX 2E5LF 2DEJA 5IFMA 4H4KC 1FJ7A 2JWNA 1VQLS 3MUTP 4A8KA 5CXTA 1CLFA 2YKNA 2MZSA 3PIPQ 3QZ8A 2LA6A 4I69A 2XSJA 2HQ3A 4NXNF 4E98A 4CLPA 1NBEB 2PMHA 4BS2A 3GFYA 3BO4A 4FVCA 2GQ2A 4CQ1A 1HBUB 1S1UA 2CG8A 5CD4H 5C42B 3PYEA 4IH7A 2H65B 1C0UB 3POTA 1TKTA 3V4MA 3QATA 2MPUA 4DG1A 1Y11A 4TQSA 4M5GA 1PAEX 2E1AA 5D0GA 2QZ8A 2Q3PA 2DXDA 4YY3F 1L3SA 4F4WA 2OJ3A 5IT9U 1JLGB 1X4BA 4K59A 5L9NA 3CMQA 2N3LA 4ZPCA 4ED6A 3KDNA 4ZIVA 2AEJA 3O5TB 2MB0B 1TKZA 8AT1B 5F8GA 5IS2A 3FKBA 2EC0A 3BPDA 2CZ4A 1FNMA 4C98A 2AD9A 3TO8A 1RTHB 4TQRA 4DV7F 2JOQA 2RE1A 4J9PA 4F3OA 2YX7A 3DYAB 1WSRA 2GJIA 3N6NA 1RLDA 2KXHA 5HANA 4FVMA 3AHPA 3T5JA 1ZM3A 2FHJD 3O3LA 2VUGA 2LA4A 3AD9C 1JIHA 3I5CA 3TAMB 3PACA 2PMZD 4TKTA 2KVQE 4P7VA 2XYHB 2CZ9A 4USMA 1NJXA 2M8DB 4CO0A 4JI5F 2GVZB 1FKPA 1H72C 5A0YB 1UVKA 2R8KA 1JLEA 1U4BA 1QM9A 1AUSL 3D7SB 4HDHA 3NGKA 2MHNA 4B3OA 3HSDA 4DR7J 2CQCA 2H4YB 3ELHA 2QLXA 1FRXA 2H9ZA 3AXMA 1UWAA 3BN4A 3M1VA 1FF2A 3M05A 2MKHA 4OYPA 5B0BA 1UJ5A 2VOPA 2AGQA 4GMKA 5C7PA 5KFSA 4DV2F 2JLFA 2GNKA 1W2BR 2L9WA 2W7OA 1HI8A 3KJVA 2XQCA 4L73A 2RB7A 1U0SA 3MMCA 2YWHA 3T9NA 1QAJA 4F0KA 4ED5A 2ZBRA 3FCVA 1D9DA 1YGYA 3RB0A 4M1KA 1RHMB 2C2OB 1P1LA 2COLA 4C3MA 4DFMA 2VASA 2YNIA 4CO4A 2DHGA 2C3YA 4ILLA 1LOUA 4CH1A 1XNQF 1JLAB 2DRDA 1FE4A 2UUAJ 4ZVFA 4B3RF 3L7PA 1RT6B 3K5PA 5FDLA 1N5QA 2D3OR 1OY8A 2HG4A 3MAAB 4J9RA 2HGLA 2CPXA 1UA0A 2GJ2A 3FNNA 2C2EA 4MIAA 2W1BA 3VAFA 1VR6A 1RA6A 1SQEA 4TYBA 1NO8A 2V6AA 5D77A 5K8OA 2W01A 1N0VC 4K7QA 4MTPA 1XJWB 3SFGA 4I64A 1X5SA 3MEKA 3AXKA 4CLLA 4KHPF 1J5EF 4I2PA 3ZZTA 1EIYB 2VH7A 3KK3A 3K89A 3ZNUA 4ELVA 1UVIA 3NNHA 3PRBA 4DR6F 4OYIA 3GJRB 3AOAA 4EU0A 1FJGJ 3KWMA 5ETSA 4O3QA 5D78A 1FDAA 4RW7A 2POKA 3PTWA 3RR7A 1WF0A 1FX2A 1DBDA 3KLFB 4V19J 4ELUA 2RVJA 1NH8A 3J7YI 1S9GB 2CQBA 3BPSP 1Q53A 1B99A 3FVYA 1WTBA 5A8WA 3GFZA 1JLQB 1NRKA 1TKDA 2XS5A 1S6QA 1U1PA 3BGLA 4LF6J 4P6QA 3GYXB 4DI6A 1N5YB 3O1LA 1X31C 4AD6A
chains in the Genus database with same CATH topology
2XM3A 2VJVA 4ER8A 2XMAA 2EC2A 2VHGA 2F4FA 2VICA 2XO6A 2VIHA 2A6OA 2A6MA 2F5GA 2VJUA 2XQCA 2FYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XM3 A;  2VJV A;  4ER8 A;  2XMA A;  2EC2 A;  2VHG A;  2F4F A;  2VIC A;  2XO6 A;  2VIH A;  2A6O A;  2A6M A;  2F5G A;  2VJU A;  2XQC A;  2FYX A; 
#chains in the Genus database with same CATH topology
 2BQ3 A;  3GR0 A;  2F9J A;  1VC0 A;  4YDD B;  1BQM A;  1N88 A;  5L46 A;  3OPK A;  1Q95 G;  4KH0 B;  4X62 J;  1P9Q C;  4J5O A;  1SH2 A;  2A2D A;  2VC1 A;  2ZH3 A;  3GP9 A;  1N4L A;  2OPS A;  3CT9 A;  4I7F A;  3TYT A;  4PXD A;  2CQG A;  4CLF A;  3BQ0 A;  3QRP A;  2VG6 A;  3ILO A;  3AAW B;  3SV4 A;  2CPF A;  2YNG B;  4DSI A;  2UV8 A;  4O3N A;  4ZJL A;  2ZVI A;  4F0H A;  3KOA A;  1N0U A;  4Y65 A;  1M1H A;  4WYL A;  1PJ7 A;  2FVP A;  2DPI A;  5T7L A;  3PG9 A;  2MKK A;  2G0C A;  3OHA A;  3DRX A;  4L76 A;  1RP5 A;  2X3G A;  1NUE A;  2V9K A;  2FIU A;  2QA1 A;  5KFR A;  5F9N A;  5ETO A;  1JLB A;  5K8M A;  1WHX A;  5J2Q B;  5KT2 A;  4WXO A;  2LEB A;  2FLO A;  4OZL A;  2B3T B;  4F2R A;  4F26 A;  2XMM A;  5FD1 A;  4AXJ A;  2XO6 A;  3DCA A;  2H4W B;  4CTA B;  3HPO A;  3HUL A;  3QMQ A;  8ATC B;  1SH3 A;  3BBF A;  3UO0 A;  4FXV A;  4LRE A;  2I6W A;  1UCN A;  2V2K A;  1K0T A;  3NWR A;  4J9L A;  2F9D A;  4PPZ A;  4GVL A;  4ANE A;  1R8H A;  1V3Z A;  3QSI A;  3IXQ A;  4HHH A;  4DXL A;  2XS2 A;  1UPM B;  1IBK J;  1Q0N A;  1U6B A;  2JEI A;  4G1P A;  4KKO B;  2NR0 A;  5JJB A;  4D3H A;  2CPI A;  3NP5 A;  4RZR A;  4P75 A;  3SV3 A;  1JQG A;  3MZI A;  1NEE A;  1TL3 B;  1VIO A;  1QUV A;  1LWC B;  1KQF B;  5EWE A;  5KFX A;  4KFB B;  2NXC A;  4R5P B;  3ADA C;  2BZ2 A;  3DHX A;  1I94 F;  3PEH A;  4K4S A;  1GT8 A;  3DGP B;  2M2B A;  1S1X A;  2ZUG A;  4F02 A;  3MED B;  1YDL A;  1D3W A;  1UJ4 A;  1HNW F;  1QSS A;  1IKY B;  5BR8 F;  1LW2 B;  3RB3 A;  3GIJ A;  3ZC4 A;  1IQZ A;  1WWH A;  2VQE J;  1JJ2 R;  3C3L A;  3AT1 B;  1RAJ A;  4NA3 A;  1PJ5 A;  2DVI A;  2AJ4 A;  1JK9 B;  1UA1 A;  3UE2 A;  2CAJ A;  1GNK A;  2YBV A;  1HMV B;  2HHW A;  2FTR A;  2B6A A;  2E9T A;  3A8E A;  4ANC A;  4DV4 J;  1PJ6 A;  1QVF R;  1KVJ A;  1TL4 A;  3OL8 A;  1HW8 A;  2B43 A;  3IR6 B;  2RD5 C;  4F25 A;  2YKO A;  2VON A;  4JI3 J;  2F8H A;  2XMA A;  3OLB A;  2Y1I A;  1W26 A;  2XLJ A;  3MFH A;  2PEB A;  1NSQ A;  1BWV A;  4QQB A;  1IBL F;  2XS7 A;  4AND A;  2V4J A;  1QSY A;  3GSD A;  5B7W A;  1R0C B;  1F3V A;  1FO1 A;  2DNG A;  3BN7 A;  2G13 A;  3SDE B;  2CQ0 A;  2YKP A;  2FYX A;  3UR3 C;  1JKH A;  4ATN A;  3NCP A;  5CD4 A;  2QO3 A;  2DCL A;  3CUN A;  1HQU A;  4JI4 J;  4DL5 A;  3MWB A;  1ZM2 A;  3VZH A;  3ONQ A;  2RU9 A;  3I31 A;  5GAD I;  1MWZ A;  1U49 A;  2MKS A;  3W65 A;  4P9S A;  3J80 Y;  2M0G B;  4BWM A;  5ADZ A;  1B0V A;  2EI5 A;  2RML A;  1I5O B;  2KM8 B;  2RQM A;  3HT3 A;  1LKZ A;  5HAT A;  4F0M A;  1Y00 A;  4ZCL A;  1TL5 A;  4C8Y A;  3DOL A;  2RDD A;  4Z2X A;  1FFW B;  2VHG A;  4WFY A;  2DNM A;  2MZR A;  2FPH X;  1UEK A;  2Q43 A;  2DY1 A;  2VD3 A;  3FBF A;  1RAE B;  4DR5 F;  4BLG A;  2Z2M A;  1FHT A;  2KH9 A;  3Q8V A;  1DQ8 A;  4DFK A;  1RE1 B;  2FLL A;  4X4S A;  5D4N A;  2F63 A;  1FCA A;  3M2U A;  1YVF A;  4P72 A;  4NLV A;  1R6V A;  1ZBT A;  2ZZT A;  4BDP A;  1NPK A;  2HHH F;  1L3T A;  1VQM S;  3OFH A;  4LF8 J;  3A8K A;  2E7X A;  2VA2 A;  4KH1 B;  2ZE2 A;  4NCG B;  3F0N A;  4FF3 A;  4XO0 A;  1SC1 B;  3RAQ A;  4DX7 A;  4CO3 A;  4M63 A;  2PFD A;  3WZ0 A;  4GVB B;  4FDF A;  3CCE S;  4HR2 A;  4I1T A;  2VBX A;  3CJT A;  3K5O A;  3I4P A;  4DZ6 A;  1R6Y A;  4NEZ A;  1WEL A;  2GX8 A;  1L3U A;  3DKD A;  3PZP A;  2JL9 A;  5D4L A;  1SV5 A;  1U24 A;  2E66 A;  1R3N A;  2GA7 A;  3T1Y J;  4RUB A;  2LYV A;  2VKZ G;  2ZWO A;  4JI7 F;  4KE5 A;  2GO9 A;  4DR3 F;  4YN3 B;  4CZC A;  2XNR A;  4QIE A;  4JV0 A;  2XWY A;  1OS5 A;  3Q0A A;  1HQ2 A;  3D9B A;  1VQK S;  2NQP A;  2C3U A;  2DIT A;  5KFK A;  5E7O B;  4EI2 A;  4OI1 A;  4ICL B;  4DN0 A;  4JP8 A;  4IUF A;  1ACM B;  3ENV A;  1D09 B;  3I6P A;  1Y3J A;  4Y28 C;  5J1E B;  2YXL A;  1FK9 A;  1RT2 A;  6FD1 A;  1F9E B;  4U7U K;  3LP1 A;  3UCG A;  1P1T A;  1X60 A;  5D3G A;  3SMZ A;  1TL7 B;  1X4E A;  1WF2 A;  3PYG A;  3NAI A;  4P52 A;  2IRY A;  2DGU A;  3VAG A;  2ZH1 A;  2DNR A;  3I55 S;  2LP4 A;  5F3T A;  4DWI A;  2B4U A;  1UAW A;  4DX5 A;  2K7J A;  2E9R X;  3HFV A;  1Y5N B;  4OYO A;  4Q8F A;  2QLB B;  4ZJO A;  4FP9 A;  1MU2 A;  5D15 A;  4CLY A;  2ZM6 J;  1NDL A;  1YTY A;  2G1H A;  4QPT A;  3NGR A;  4R0E A;  1YJW S;  4U67 Q;  4KPC A;  2HQD A;  1MRO B;  1XER A;  4U9R A;  1WJ9 A;  5CZV A;  4DL7 A;  3WBZ A;  2ZEJ A;  3UW1 A;  4F04 B;  2OPR B;  4NXM F;  4IH6 A;  1K9M T;  2ILY A;  2YKA A;  4J91 A;  2IM3 A;  3DRR A;  1F3F A;  1Q5V A;  5A2Q U;  4OHY A;  3TW0 A;  1M0S A;  2HFU A;  2BAN B;  3DDK A;  1HBN B;  1XR5 A;  3HHN B;  3OL7 A;  3I32 A;  1EAY C;  4ZVH A;  4P74 A;  4NMX A;  4WTO B;  2ZDO A;  3CD6 S;  4IDK A;  3PJX A;  3MR2 A;  4C4W A;  2BBE A;  3ISN D;  1XTZ A;  3JTO A;  1NND A;  3HVT B;  3PR4 A;  3D6F B;  3W60 A;  4O23 A;  3LPE A;  2F8M A;  4W92 B;  2VPX B;  5J1P A;  5KG5 A;  5SZT A;  2WZ1 A;  4F3M A;  3SXL A;  2XGP A;  5ETM A;  3C15 B;  3LTO A;  2V9W A;  2B4P A;  4TU7 A;  3K5L A;  3M8P B;  3T1H F;  1HYS A;  5HJY A;  4B9L A;  3EYZ A;  4YME A;  3JSY A;  1DQA A;  2I0X A;  3H5X A;  2DK2 A;  2WHO A;  1PBA A;  1DFD A;  5ETP A;  4NYZ A;  2KJW A;  4DUY J;  4EYI B;  1E6V A;  1WC3 A;  4A8S A;  1UTA A;  1IBM F;  1PYS B;  3LA0 A;  1PKU A;  3TAR A;  3EIC A;  3PO5 A;  2MKI A;  4O0I A;  2N4C A;  2R7Q A;  2A2C A;  5G0R B;  5L39 A;  2QMU B;  3TVK A;  1IKW B;  4CM0 A;  1WI6 A;  4ECV A;  1FFG B;  3D67 A;  4UQG A;  2HS0 A;  4MKY A;  1UET A;  4Y6I A;  2B9E A;  3BGO P;  3E01 B;  4QYR A;  3HSJ A;  2NPI A;  4F4K A;  4ID5 B;  1WKL A;  3V6K A;  3N0V A;  1U09 A;  5DQG A;  2UXB J;  5KFG A;  3M9N B;  3CJ4 A;  2B4O A;  4IH5 A;  3NGU A;  4YUD A;  1O8B A;  2HNY B;  1NB7 A;  3V6H A;  4ZVR B;  2UXC J;  3PX0 A;  2FJA B;  3SCL E;  4UF4 A;  3UWT A;  4J9U E;  3BB5 A;  1H2T Z;  4FN5 A;  4IG3 B;  2C2N A;  3Q2S C;  4LF4 J;  5IWA J;  3IBW A;  1HI1 A;  1DTT A;  2AJ2 A;  4QWC A;  4ECZ A;  5C24 A;  3J7Y U;  3QO9 B;  3CD0 A;  2BJ7 A;  2ZVS A;  3P4U B;  2G2Z A;  2C28 A;  4FBT A;  2DBB A;  4QBU A;  2QMX A;  2E5I A;  2GGP B;  4M5D A;  1AXQ A;  4DF8 A;  3DU6 A;  3CF5 Q;  3R7B B;  3TNV A;  5KT7 A;  1NK6 A;  1V5V A;  2DYA A;  2NCK L;  3M8S A;  2DIV A;  3W3S A;  4GC7 A;  2VBW A;  1S5Z A;  4R8U A;  4YB6 A;  1L5U A;  2XB2 D;  1UZD A;  1RB0 A;  4CT9 A;  1N32 J;  4NL5 A;  1VQN S;  3HXM A;  4TY8 B;  1F2G A;  1LEO A;  4LVO P;  4OZ2 A;  3MM5 A;  3P5T L;  2AEM A;  4ZVP B;  1J2V A;  1CS4 B;  2AHO B;  1UW9 A;  4KJI A;  4YDX A;  3PHE A;  3V81 A;  2E5L J;  1SKW A;  2KZZ A;  1SUQ A;  3R5D A;  1RCO B;  3TVZ A;  3QWP A;  4RNH A;  3OXG A;  3LGH A;  3JTN A;  5KG6 A;  1REV A;  3CCU S;  4YB7 A;  4K4W A;  2QL5 B;  3FJ2 A;  4UQT A;  1N5S A;  1ZZF A;  2MJU A;  4EMD A;  2BUN A;  5DDP C;  2CQP A;  1S48 A;  1HBO B;  1EQ0 A;  4NXN J;  4DJB A;  2SXL A;  4QW8 A;  3OTB A;  1GK8 A;  3MEC B;  2WK4 A;  5B0G A;  2FVC A;  2MKC A;  2K7K A;  5DZ7 A;  4MJK A;  3HX9 A;  3ENA A;  1S9E A;  2R9L A;  2EKY A;  3CGI A;  1S1V B;  3DM2 B;  2MQO A;  2ALY B;  4X65 F;  1C0T B;  3VCD A;  3KNA A;  3BO3 A;  1JLF A;  4Q2M A;  5I3P A;  4AQY F;  3PJ9 A;  4FKY A;  3Q8R B;  2W9C B;  1VI7 A;  3VAH A;  4YY3 J;  4WZQ A;  4L75 A;  2MLZ A;  1B70 B;  4Q43 A;  1R0B G;  4I0W A;  2W9B A;  1UJ6 A;  5I42 B;  1FRI A;  1GXL A;  2GIR A;  1MLA A;  3BV8 A;  2E1C A;  3LO3 A;  2U2F A;  4GKJ F;  3KTQ A;  2HK3 A;  2FVQ A;  4AE5 A;  5ETR A;  2J76 E;  3ZFV A;  2GQC A;  1HA1 A;  2W24 A;  1M1G A;  4DV7 J;  1IKV A;  3VF0 B;  1R89 A;  1BHN A;  4ZHR A;  3Q23 A;  1VJW A;  3PW7 A;  3FZ2 A;  2FY1 A;  5KFF A;  3HM9 A;  5F8J A;  1TEL A;  2ZJQ Q;  2LQ8 A;  2ZH7 A;  5KFE A;  4WFB Q;  3MFI A;  1FES A;  3PRV A;  2AGP A;  3CJK B;  3KLG A;  1L3V A;  1CUL B;  3Q8Y A;  5BJR A;  1RI7 A;  5LXY A;  1M5H A;  3JS9 A;  1FKO B;  1RHK B;  2XGQ A;  1U2R A;  3DFE A;  3QRR A;  2Z0G A;  1VRU B;  1JLC B;  3CCV S;  4AL5 A;  3EGN A;  3P6Y C;  4IFY A;  2IVM A;  2CWK A;  3D0H E;  1X4C A;  5K8N A;  2EXU A;  3BYP A;  4USU A;  2XM3 A;  4UY8 5;  5LT5 A;  4DV2 J;  1WC4 A;  2R7U A;  2V8H A;  1S72 S;  1H98 A;  1KNZ A;  4RW6 A;  4B08 A;  4C11 A;  1WOP A;  3M30 A;  2E29 A;  2X1F A;  1V6H A;  4K5S A;  3I0R B;  5FLX Y;  4JI0 F;  1GX6 A;  2ZIT A;  2F3J A;  2GVD A;  2P6S A;  3KUH A;  1ZA1 B;  2OP5 A;  4M5L A;  2VPW B;  3G86 A;  4RW8 B;  1U1Q A;  4DV1 F;  1IBC B;  4QIG A;  3WHI A;  3G8Q A;  4I2Q B;  1VJQ A;  4N56 A;  4QR0 A;  2X3D A;  3KMS A;  2PI4 A;  3VR1 A;  1XNQ J;  3R27 A;  3SBM A;  1Q8L A;  4IOB A;  2OLW A;  3BH6 B;  4DV6 J;  1RT7 B;  4B3R J;  2HND A;  4G1I A;  3VQS A;  1TMM A;  1RWU A;  4J7C A;  1X4A A;  1HBU A;  5GAD U;  5C42 A;  4NLT A;  3MCO A;  1KVI A;  1BY9 A;  2CPZ A;  5KAK A;  3TX8 A;  4HHU A;  1C0U A;  3OD2 A;  2K2P A;  4J9M A;  5H1S V;  3EZO A;  3VGT A;  1C2P A;  2VG5 B;  3C6T A;  3UCU P;  2IDE A;  4C8L A;  4KHP J;  1J5E J;  3FMW A;  1RIS A;  3DLG A;  4P2X A;  2A10 A;  1NKB A;  3SZ2 A;  1TZ0 A;  5B0E A;  4GKK F;  2LCW A;  4DR6 J;  1ZOT A;  4K4Z A;  4ID8 A;  3R5B A;  3E2E A;  2A6O A;  2JH3 A;  2KN4 A;  1U25 A;  2J7W A;  4C3K A;  2CQ3 A;  3DYA A;  5LMN F;  2HZV A;  3N9U C;  4P2S A;  4MMO A;  2ZH8 A;  3HHL C;  2H3E B;  1KLN A;  2CA9 A;  3BSC A;  2A3J A;  1NK5 A;  5E33 A;  4USH A;  3TAM A;  5HVF A;  2YPZ A;  3OLA A;  2M52 A;  2QA4 G;  3RB6 A;  2Z2Z A;  2GVZ A;  1YRU A;  2F1F A;  5A0Y A;  3M2R B;  3CJ8 A;  4QU6 A;  2L08 A;  1FER A;  2CYY A;  2V0N A;  4JI6 F;  3M8R A;  3CCW A;  2O1P A;  5J1N A;  2HFO A;  4RW4 B;  4A48 A;  2BV3 A;  2FGC A;  1T05 B;  4NLR A;  1HBM B;  4KO0 B;  4J9O A;  3MM9 A;  1Z2L A;  3PYF A;  2XO7 A;  1RT4 B;  4QZV B;  3K2Y A;  2G2Y A;  2HVI A;  5J2M B;  3JSR A;  3ITH B;  2B51 A;  3NEK A;  5DO2 A;  5LL6 d;  4JI8 J;  2OH2 A;  2R8I A;  4B3S F;  2X1A A;  3IC1 A;  3OVS A;  3IM8 A;  4LSN B;  4AT1 B;  4F4A A;  3NAH A;  4IO1 A;  4I6W A;  2UUA F;  2EBE A;  1B0P A;  1KBR A;  5E3P A;  2AT1 B;  1JLA A;  2PSZ A;  3J7A N;  1QD1 A;  1LWE B;  1RYR A;  4DSE A;  4DCO B;  2VQF F;  2IJF A;  4DN9 A;  1RT6 A;  2XLI A;  5EHH A;  5GVQ A;  3R6G B;  3GMG A;  3G8T A;  5HVG A;  1SBR A;  2LXF A;  2GAG C;  5K8P A;  3OBI A;  2XLK A;  1WAC A;  5CCM A;  4CNY A;  3Q2T C;  2FQQ B;  3QIP B;  1VK3 A;  4PPD A;  1FDD A;  2GMJ A;  1U0H B;  3R97 A;  4PXC A;  2CAD A;  3LP2 B;  4LJM A;  1U1N A;  3IP0 A;  1KOH A;  1NME B;  2ZZN A;  1Q8K A;  2CG4 A;  1SH0 A;  4ZCM A;  2AKW B;  2V2V A;  3LAM A;  3TWZ A;  3H5Y A;  4XIU A;  3AQP A;  5F3Z A;  3G9C A;  3MCN A;  3R1H A;  1HHT P;  1Q1K A;  4BC7 A;  4ERD A;  2W8L A;  2OPP B;  4L3K A;  3M32 B;  3KLF A;  1FRH A;  3MM8 A;  4RL1 A;  3KG1 A;  3UVJ B;  1I94 J;  1RYS A;  4CLK A;  1YBU A;  5L1K A;  7FD1 A;  4DPT A;  2AQ4 A;  4KTQ A;  2JEF A;  3T3F A;  1EHW A;  4F3Q A;  1JLQ A;  2B5J B;  2MQM A;  1HNW J;  4D3G A;  3QBC A;  4IR9 A;  4X66 F;  1QE1 B;  5BR8 J;  1SKU B;  4EZ9 A;  4LBP A;  2CJK A;  4OX8 A;  2W2Q P;  3KKF A;  4PWD B;  1B7F A;  4C0O C;  2Y0B B;  3L09 A;  4LRD A;  2ZNZ A;  2HBY B;  3I5B A;  4YB5 A;  5F8H A;  3K0J A;  3LAN A;  2ZH9 A;  2AGO A;  1TAQ A;  2J9D E;  2C2K B;  2C2M B;  3BQ2 A;  5DQH A;  2C22 A;  5D0H A;  3QT5 A;  2BA9 A;  3DXS X;  2BKN A;  5JXS A;  4LSZ B;  2R42 A;  4X4T A;  1YJ7 A;  3GON A;  4ES3 A;  2WB4 A;  4MK7 A;  5LJ3 Y;  5H9E J;  2HFS A;  2UP1 A;  3F41 A;  2YNH B;  2D69 A;  1NK0 A;  3X3U A;  4M5K A;  4OHW A;  5KFM A;  3GPA A;  4X4N A;  4PUO B;  2KG1 A;  4WF9 Q;  1IJF B;  2BKP A;  4K2X A;  3MR5 A;  4WFX A;  2YNG A;  1IBL J;  4PG8 A;  5DLG A;  4KY3 A;  2ZOG A;  2NSB A;  6AT1 B;  2ASY A;  4PG4 A;  1WC1 A;  5AXK A;  3BGR B;  4NX9 A;  2MLY A;  2ZBP A;  2J9D A;  3HO1 A;  1BGX T;  3M8Z A;  2KL8 A;  4R0J A;  2VPY B;  3KK2 B;  4QWA A;  4KC5 A;  2G0I A;  1QUP A;  1KLM A;  2QGF B;  3DOK B;  1AFJ A;  3FEZ A;  4ZS6 A;  3R2C J;  5J2Q A;  5CAA A;  3HHK A;  3CCQ S;  1GMU A;  2V4Q A;  4HAC B;  4CO2 A;  1FRL A;  1WSV A;  3UDL A;  3CJQ A;  1VQ5 S;  1HQE B;  3GZ7 A;  4RNO A;  1RBA A;  2RS2 A;  3WIU A;  4M94 A;  2J9E A;  4OZ5 A;  3KK1 B;  3GJQ B;  4I67 A;  1MN7 A;  3M6U A;  1WKJ A;  4K0K F;  2HUR A;  4ECW A;  1VQ8 S;  2ZUA A;  2OEL A;  3HFK A;  5C2G A;  2LEC A;  4DR5 J;  1WKK A;  4KRW A;  4LFA F;  1R27 B;  4ELT A;  4KKO A;  3N6M A;  3CVK A;  2P9C A;  4XPC A;  2WW4 A;  2QE5 A;  2ZBI A;  3D66 A;  1TL3 A;  3MAH A;  1LWC A;  2HIQ A;  4KFB A;  1YIJ S;  5EUH A;  4R5P A;  4WFN Q;  2HHH J;  4YQW A;  2ADB A;  2D9O A;  4IRC A;  3QAU A;  1M90 T;  4LUB A;  4RPF A;  3K7R A;  3MED A;  1S0M A;  2HVZ A;  1IKY A;  1LW2 A;  2WW8 A;  2AYB A;  2ADC A;  2BX6 A;  1DJ0 A;  1FWP A;  3GE9 A;  5IM0 B;  3EZ5 A;  1GTE A;  2WVB A;  1RT3 B;  2P8I A;  3V6D B;  4MKA A;  4WE1 B;  3TX0 A;  1YJV A;  4RUC A;  1HWK A;  3BO2 A;  3BSN A;  1HMV A;  1JMT A;  2I9S A;  3JTP A;  1T02 A;  4ECY A;  4Y34 A;  1VLO A;  4JI7 J;  1U2F A;  4DR3 J;  2K3I A;  3G6V A;  2X7I A;  1RT1 B;  1MSW D;  2UVR A;  1UEV A;  2RQK A;  3DRS B;  2YWG A;  1NSK L;  5U47 A;  3TR5 A;  2P2C B;  1N5T A;  4ZP6 A;  3FGV A;  2A1B A;  2L48 A;  4ETX A;  2JVO A;  1H0H B;  2CJY B;  4OL8 A;  1T94 A;  3HKW A;  4LT6 A;  2YVS A;  3PFE A;  4WKY A;  4H4O B;  2EFN A;  3SDE A;  1X5T A;  1G1X A;  4ZCI A;  5EX3 A;  1ZM4 A;  2KJV A;  3N6L A;  2D1C A;  1WOS A;  2OAU A;  4TNO A;  2Z57 B;  3HLU A;  1WG1 A;  4PXB A;  3ZZZ A;  2IBO A;  2CDQ A;  2VFV A;  5LM7 E;  4J9K A;  4DL2 A;  4OX9 F;  2AJF E;  3MR6 A;  2Z2L A;  2PFF B;  2FDN A;  2B7B B;  1D0E A;  2M70 A;  4NLS A;  2P9G A;  1HWI A;  2MTL A;  2DGO A;  4USK A;  1FD2 A;  3W64 A;  3FCW A;  2DEI A;  4LRF A;  1CJK B;  2VFT A;  1BQN B;  2FZG B;  2LVW A;  3OVB A;  4NXM J;  1RSC A;  1J5O B;  1WF1 A;  3CCM S;  2VOD A;  3P8B B;  4RBV A;  3GII A;  2OUG A;  2R7R A;  4TLQ A;  4RUH A;  4FYD A;  1S4E A;  2KHC A;  1S76 D;  1H74 A;  3DI6 B;  5IZH A;  4W90 B;  3PJW A;  1VBY A;  3R7S B;  4LQ3 A;  4Q2L A;  2FGO A;  3D6H B;  4X64 F;  2R2S A;  2YWK A;  4DSF A;  4NA2 A;  3AOD A;  3GV5 B;  4DV5 F;  3OR1 B;  4WBF A;  1S4F A;  1CJT A;  3B54 A;  2WON B;  1N36 J;  3SFU A;  4NCG A;  3MCM A;  1YJR A;  3T1H J;  1T03 B;  2ZFH A;  2OTL S;  1UWB B;  1KRP A;  1NSP A;  1WEX A;  2MQQ A;  3ENW A;  1IBM J;  5EWF A;  2DRA A;  2VF3 A;  5GAH I;  1EET B;  2I5J B;  1F6T A;  2YKN B;  3J7Z T;  3MPY A;  2V8D A;  1Z4U A;  5CZX A;  4KGX B;  4H54 A;  2DNQ A;  4LIR A;  4LIW A;  2UVV A;  1APS A;  3CJ3 A;  4DFP A;  2XYG B;  1S97 A;  3WQP A;  5SUH A;  1ARO P;  4KSE B;  3BZQ A;  3IRX B;  3WDO A;  5CYJ A;  3MUM P;  3JAM Y;  4ICL A;  2KB2 A;  2HSE B;  2FHJ A;  3POT B;  1FEE A;  1NK8 A;  4DEZ A;  2ZH2 A;  2UUC F;  3HD2 A;  2JC1 A;  5J1E A;  3R1L A;  5CHC B;  1SC4 B;  1RBO B;  3I5A A;  1TL7 A;  2J7U A;  5E3A A;  4ZN3 A;  3K57 A;  2Q79 A;  4CLU A;  2UV8 G;  1RAO A;  4WK1 A;  3BSA A;  1NM2 A;  1VCT A;  2WRM A;  1TUV A;  2QLF B;  3BM7 A;  3S8S A;  1VHF A;  4EO6 A;  1AZS A;  3DLE B;  1Q16 B;  4B9N A;  2H5I B;  2MYF A;  5BYR A;  1WNE A;  3D5M A;  4NLY A;  3OQ2 A;  1S59 A;  2QC3 A;  3VQT A;  3OVA A;  1XMB A;  4DR1 F;  2E44 A;  2CPH A;  4OHX A;  3K59 A;  3DDN A;  1MRO A;  5A8R B;  1GH8 A;  2CQ2 A;  4O44 B;  4HL9 A;  2OPR A;  3DU5 A;  4ZPD A;  3KFW X;  5DGA A;  2ZH6 A;  4CDI A;  4A8Y A;  5K14 B;  3EGW B;  2Y8Y A;  2BAN A;  5H9E K;  1HBN A;  3H8Y A;  2QFJ A;  3I56 S;  2F7V A;  2EVZ A;  1HNI B;  4Y0F A;  4KR0 B;  3TJ9 A;  2DRB A;  2IRX A;  2X1G A;  4P2F A;  4PYA A;  4R25 A;  3HVA A;  2ZKU A;  3HVT A;  4LF5 J;  2QX0 A;  2ROP A;  4A8X A;  1LV5 A;  3MMA B;  5K9F A;  2CQ4 A;  3C15 A;  5A6W A;  4UZC A;  3AOC A;  3M8P A;  1T9T A;  2WOM A;  4CLZ A;  2R7W A;  2K3K A;  1I1G A;  2IRU A;  5D6G A;  5HP1 B;  2J6U A;  2W4C A;  2NZ4 A;  1P8G A;  1GEH A;  4O4R A;  3H2V E;  3BBB A;  2M7S A;  3A3O B;  1S57 A;  1Q7L B;  2WSE C;  1PYO B;  3GFH A;  3KHH A;  3V2U C;  4UY8 T;  2RAQ A;  3L7U A;  5G0R A;  5E2Q A;  2DR7 A;  1X5P A;  1FRK A;  4NML A;  3OTE A;  3U1L A;  4DPU A;  5M2R A;  1KS2 A;  4AFF A;  2VIH A;  2YX1 A;  1LWF B;  1VDH A;  4X65 J;  2HIY A;  2WVF A;  3E01 A;  4EGL A;  4LSL B;  4AQY J;  4ID5 A;  1T9X A;  2WVD A;  1X9W A;  2C2R A;  3TAP A;  4J90 A;  4RUA A;  1U7L A;  1U8S A;  1BC6 A;  4ZDN A;  2F65 A;  4ZPB A;  3PW0 A;  4OJ3 A;  1PC4 A;  2CXE A;  3GV7 B;  1KFD A;  5KFN A;  1H38 A;  2GIF A;  2XZD B;  2KYX A;  2E1P A;  4UW2 A;  3K17 A;  3N4W A;  1SL2 A;  4GKJ J;  4Q0B B;  1KSP A;  2MDA A;  2BMB A;  2GMH A;  1EP4 A;  4NLQ A;  3KDO A;  4NLW A;  3UN3 A;  3KK3 B;  1RCX B;  3SSS A;  1D9F A;  3TOQ A;  1Y3K A;  4K5R A;  4ECS A;  4IG3 A;  3NWG A;  3EGV A;  4KHR A;  1IWA A;  4FF2 A;  3W2V A;  5DDQ C;  2RNE A;  2OML A;  3RYL A;  2CJQ A;  3BR8 A;  1VQ7 S;  1CG2 A;  2XMT A;  2BXJ A;  4DCP B;  4CI0 B;  2K06 A;  2GGP A;  2J5A A;  2F4V F;  1ZH5 A;  3QYY A;  2U1A A;  3ZZR A;  4O4G B;  4Z7C A;  1EAR A;  4HT5 A;  2O66 A;  1Q7Y T;  2DHA A;  4MYU A;  3G82 B;  1F1B B;  2PA8 D;  1CJU B;  2EFG A;  1N8R T;  1UZH A;  2CQH A;  2HHX A;  3W2W B;  3CJ5 A;  3OV7 A;  5G4D A;  3T9Z A;  4TY8 A;  1HLW A;  1U1M A;  3BGU A;  3CJR A;  2HRT A;  2CRL A;  4RNF A;  4IOA Q;  3CCL S;  2JEJ A;  3PCO B;  2GAH C;  4FBU A;  3RW6 A;  4F7V A;  1CS4 A;  9ATC B;  2AP6 A;  3CDW A;  4JI0 J;  3ISN C;  2DNH A;  4QIV A;  5JVG Q;  5HI7 A;  1YK9 A;  2CVE A;  4DV1 J;  1XR6 A;  3NRB A;  2WSF C;  1S77 D;  3HK2 A;  3AD8 C;  4URG A;  1HL6 A;  2N82 B;  4J9S A;  1UVN A;  1HBO A;  4HTJ A;  3H90 A;  5AE2 A;  3UR0 A;  1AA1 B;  1KQS R;  3MEE B;  4YR0 A;  5KOW A;  2Z56 B;  3WX8 A;  3MEC A;  4KGK A;  2FVR A;  1C1B B;  4IQM A;  3DLH A;  3RU0 A;  3SCI E;  1XK8 A;  5F9L A;  2B4V A;  2BE7 D;  2NRE A;  1CQM A;  4DU7 A;  5IT9 Y;  2UXD F;  4LF1 A;  1ZS6 A;  3QGG A;  4KGM A;  4OYA A;  1S1V A;  3DM2 A;  2RIJ A;  3GYN A;  3NS7 B;  5J2P B;  1SJ4 P;  4F36 A;  1VRQ C;  2ALZ A;  1R8B A;  4ZLL A;  1C0T A;  2W2O P;  2YH1 A;  2RH3 A;  4JB8 B;  3D4J A;  3G71 S;  2NXJ A;  3GIM A;  2W9C A;  3HKZ D;  1C4C A;  1RHU B;  1KTV A;  3IO1 A;  1QTN B;  1R31 A;  2AYE A;  5AT1 B;  4I6Y A;  4CCH A;  5I42 A;  2VU5 A;  1NSA A;  3D0G E;  4KT0 C;  5DDR C;  4DV3 F;  1ZZN A;  2V34 A;  4A47 A;  3GYG A;  2ASL A;  3GJT B;  1PCA A;  4GKK J;  2ZBC A;  5AXL A;  3I9Z A;  2H51 B;  3EWG A;  3MOJ B;  1Y10 A;  1VQ6 S;  2F5G A;  2DNZ A;  1VBX A;  2NZC A;  4WP8 A;  3PVX A;  3HCX A;  3KLE B;  5LMN J;  2OKQ A;  2LQ5 A;  2OIH A;  3N5F A;  3D0I E;  3BF4 A;  1OY6 A;  2FJV A;  4E2F B;  3BQ1 A;  2CNL B;  2FB0 A;  5E5N A;  4URQ U;  5DJB A;  5GME A;  1T3O A;  3CJK A;  3VV2 B;  1VGY A;  4HVZ A;  2EG1 A;  3D6T B;  1NJY A;  5IV4 A;  1BUX A;  2PO4 A;  1CUL A;  1GAO A;  4JI6 J;  1FKO A;  3AA8 A;  1TKX B;  3HFZ B;  2VA3 A;  2XG8 A;  2A6M A;  2XSF A;  2I38 A;  1FFS B;  4PAB A;  4F50 A;  3A1Y G;  2BKO A;  1VRU A;  2HLU A;  3A4T A;  1XR7 A;  2DHX A;  3AJ1 A;  3P5B P;  4ZPA A;  4ZPT R;  3MEG B;  5HBM B;  4TY9 A;  1OSD A;  5DG9 A;  5KFT A;  2PEH A;  2VDH A;  5DDO C;  4DPX A;  2D7S A;  2V2Q A;  3T6B A;  1RKJ A;  3JSM B;  3OT9 A;  3I0R A;  3GIR A;  2DGT A;  3ZTQ A;  1AUD A;  1RHJ B;  1K44 A;  1IKX B;  4B3S J;  4RW8 A;  4ED7 A;  1FT8 A;  4PKD B;  3L7O A;  4I2Q A;  3FRZ A;  3PR5 B;  1F5A A;  4MFB B;  1LW0 B;  2DGS A;  4DV6 F;  1F9H A;  4QWD A;  3F44 A;  1DLO B;  1ZYQ A;  3MM7 B;  2HWI A;  4OQJ A;  2O67 A;  1VBK A;  4J37 A;  2JVR A;  2VQF J;  1RT7 A;  3AA9 A;  4JI2 F;  2BJ1 A;  3GJS B;  3K58 A;  2BVZ A;  2OFG X;  5IQQ A;  1XQI A;  4Z37 A;  5CYM B;  4NWB A;  4LR9 A;  2R3V A;  2FHO B;  4WWS A;  4G1Q B;  2XNQ A;  2ZJP Q;  3E51 A;  3M8Q B;  4S0M A;  3ZTS A;  2AIR B;  4DQS A;  2WBM A;  1HHS A;  4U7C A;  3QLH B;  4OYZ A;  3KLV A;  1JB0 C;  4TVA B;  2VG5 A;  3TUJ C;  4A8Q A;  2GO8 A;  3L9Z A;  1Y9O A;  4AYB D;  1HNX F;  2YNF B;  3C6U B;  3GB0 A;  1KTQ A;  2D3O 1;  2DR9 A;  2EWH A;  3GV8 B;  2Y9H A;  2BW2 A;  5HLF B;  2IHR 1;  3EMT A;  5KT6 A;  2RF2 B;  5E3Q A;  2G0J A;  4LF7 F;  2HFZ A;  2QRR A;  4EO8 A;  4CNZ A;  2V63 A;  2RKI B;  3VTI A;  5A8K B;  5L1I A;  3IBC B;  3H5U A;  4FYX B;  1HHQ A;  3DOM B;  2QL9 B;  3M2U B;  4CH7 A;  3KMQ A;  5I3U B;  3M2R A;  2L9D A;  3GR1 A;  2HS3 A;  5L9X A;  4X66 J;  4C3L A;  5EN1 A;  4BCA A;  2ZE2 B;  4FYV B;  1YBT A;  4RW4 A;  5GAH U;  3KHR A;  1T05 A;  2LU1 A;  2FY8 A;  3S6E A;  3NG8 A;  4WFZ A;  2L41 A;  4K4X A;  2OPQ B;  1HBM A;  4KO0 A;  1NCL A;  2DGW A;  4DZD A;  3CCR S;  4IOC Q;  5BYS A;  1X4H A;  5CH7 B;  1JXE A;  2XY6 A;  2HNZ B;  1RT4 A;  1OWX A;  1M5K C;  4ZPW R;  2ERR A;  4FF4 A;  1JXL A;  4ZP9 A;  1G4C A;  4OI0 A;  4JI8 F;  1NKE A;  1B0T A;  5M2P A;  5J2M A;  3PW4 A;  5ETL A;  3RBX A;  3T41 A;  4PRF A;  3NCR A;  4PG5 A;  4I56 A;  3LGM A;  1X4G A;  1IUJ A;  4ZLJ A;  4LRC A;  1FJE B;  3CW2 C;  2BOA A;  1EZZ B;  4LSN A;  1WD6 A;  5HMX A;  5EX0 A;  2E1R A;  3KLI B;  2HQC A;  1KC8 T;  1KON A;  3G6E S;  3FK4 A;  1KVK A;  3A8J A;  1JNZ B;  3GG1 A;  3J7A 1;  2GHP A;  1ZM9 A;  2M4M A;  1X0P A;  2Y3Y A;  3VAJ A;  2B56 A;  3IAS 9;  2RQC A;  5C5J A;  4IKA A;  4K4U A;  3QIP A;  2J9C A;  4ZVG A;  4PAA A;  1YG0 A;  1U0H A;  4NPO A;  4C6A A;  4HTI A;  4ES2 A;  1RUS A;  2MSS A;  3LP2 A;  3F56 A;  1TUW A;  4DV0 F;  3UI3 A;  2MJN A;  2YQ3 A;  5MLC V;  4DPO A;  3VWS A;  4FYY B;  2Y1R I;  2BJ8 A;  2ZHA A;  3ILI A;  4JI1 F;  4K0K J;  3QFW A;  1SC6 A;  1NZA A;  3MR3 A;  4LFA J;  1P6T A;  2MZT A;  2KI2 A;  2ZH5 A;  2ABY A;  2FD2 A;  4W98 A;  1F9F A;  3DN9 A;  3SSQ A;  1DAR A;  5HRO A;  5F8M A;  1FXL A;  1IXK A;  2ACY A;  1LK5 A;  1ZTT A;  4XPE A;  4ED4 A;  2OPP A;  3M32 A;  1MMD A;  2IJR A;  3DRP B;  3SIP B;  4IDK B;  1VFJ A;  3UVJ A;  4DR2 F;  3PX4 A;  2QSW A;  4AL6 A;  2GFF A;  1OSC A;  4RR5 A;  2B5J A;  1KOO A;  3BKF A;  1QE1 A;  4FF1 A;  2W2M P;  2CPE A;  2P9E A;  4PWD A;  3MUV P;  3IWL A;  1FDN A;  1LNQ A;  2EEY A;  3NL0 A;  3N79 A;  3QID A;  1P9Y A;  2BJD A;  2CPD A;  3RW7 A;  3LPY A;  2DB1 A;  2Y1L B;  5KFI A;  2NUU G;  2BE9 B;  1C1C A;  5HSP A;  4CLT A;  4CLS A;  3ZZU A;  2FJD B;  2BR0 A;  1KKH A;  1K0V A;  2PII A;  2BAC A;  1Q82 T;  3U02 A;  3KUE A;  1RKI A;  3VGU A;  2YNH A;  4G3I A;  4C8Z A;  1F2H A;  1T9V A;  4U8V A;  4PUO A;  1R7I A;  2FJB B;  5I3Q A;  1P27 B;  3HSG A;  3I0S B;  3D1O A;  1IWG A;  1WUU A;  1U1R A;  2CWX A;  1REG X;  2CNO B;  1NPR A;  2IAJ A;  1LXJ A;  3R7N B;  3DLL Q;  3D68 A;  4JV5 F;  4DUZ F;  3MXH P;  3LP0 A;  1WEY A;  1G3O A;  3EJM A;  2NPF A;  1B3T A;  3OHB A;  3D2W A;  1XC9 A;  3BGR A;  1YRX A;  3TQE A;  3CIM A;  1BXN A;  2QSF A;  1FD8 A;  3KK2 A;  4USI A;  3DLK B;  2W8K A;  3RZA A;  2IVF B;  1KQG B;  3DOK A;  2Z2Y B;  4LFC F;  1S9F A;  4DL4 A;  1OY9 A;  2VFR A;  5MAO A;  4HAC A;  5HMW A;  1JXV A;  1TU0 B;  2IC3 B;  4OX9 J;  3H40 A;  3HI9 A;  4PR6 A;  3TEG A;  4DX8 H;  4X4Q A;  5HQL A;  4OYW A;  3J81 j;  3THV A;  4G6V B;  1HQE A;  5FJ4 A;  2MGZ B;  4DBQ A;  2MLX A;  4ZPV R;  3KK1 A;  1KDN A;  4A8O A;  3M6X A;  1UFK A;  4FPI A;  4HH0 A;  4WJB A;  4GO7 X;  4ECR A;  4OMF G;  1TV6 B;  3QJP A;  3SYZ A;  3IM9 A;  2R8G A;  1N56 A;  2RT3 A;  4H4M B;  1WHV A;  1RZM A;  4B9M A;  3KLH B;  3SCJ E;  4X64 J;  4R8U B;  4JUZ A;  2VG7 B;  4NLO A;  4OX6 A;  2JRS A;  1VS3 A;  1X9S A;  4EK2 A;  4DV5 J;  3UD5 A;  2HZC A;  2IDL A;  3IWN C;  1MW7 A;  3MPV A;  3C19 A;  3KJN B;  3TP2 A;  4U96 A;  3OTO F;  4KV8 B;  3CPW R;  1Q4R A;  3SCK E;  1SVD A;  3J81 Y;  3V81 B;  1Q8B A;  2V4R A;  1RTD B;  3HZE A;  5IC4 B;  3OXL A;  1RT3 A;  2CFX A;  3J81 U;  3V6D A;  3UDC A;  2B9W A;  1WC6 A;  4WE1 A;  2JLG A;  2JLE A;  2QYC A;  4N76 A;  2EBG A;  3NXZ A;  3US5 A;  4A8W A;  2LEA A;  1N34 F;  2V68 A;  1TMJ A;  2YH0 A;  2LU2 A;  3LWL A;  3SQG B;  4IRK A;  1WC5 A;  1KQK A;  4KAI A;  4OZ0 A;  2J0W A;  3UFC X;  2LDY A;  2ZDP A;  2HYI B;  3MM6 A;  4NLU A;  3DRS A;  4F4Z A;  3CTR A;  4K2J A;  5CCL A;  2BE2 B;  2G9O A;  3EE3 A;  2JNJ A;  1BWE A;  4X84 A;  4K4T A;  2UUC J;  4PQU B;  2V8V A;  2HWT A;  2V67 A;  4DQP A;  3W9J A;  5DZ6 A;  2H5J B;  1BE4 A;  2OD4 A;  1YJT A;  4H4O A;  2XCP A;  3RAX A;  4GC6 A;  2VB6 A;  3TQ1 A;  3KYL A;  3CCZ A;  3H4D A;  1KFS A;  3HP6 A;  3IR5 B;  4B9V A;  3M9O B;  2HZA A;  3CNQ P;  4LF2 A;  1RU1 A;  1BLU A;  4TYA A;  4EWT A;  5KG2 A;  1ZPW X;  4OZ1 A;  2JC0 A;  1RAA B;  3OUY B;  5A2Q Y;  3QT8 A;  1HPZ B;  1TFY A;  4DR1 J;  4KPY A;  1URR A;  5B09 A;  3CD5 A;  2IVY A;  3ZNJ 1;  2NXU A;  4MH8 A;  1YQH A;  1CJK A;  1BQN A;  5L38 A;  3QSY B;  3RJM B;  2VFS A;  1J5O A;  5KFY A;  1SJQ A;  3BYR A;  4ECX A;  1HWU A;  2HHP A;  4FZV A;  4ZVE A;  2OD6 A;  1RAC B;  3DI6 A;  5HK4 A;  3LF0 A;  3DLJ A;  7FDR A;  2IYG A;  2R2R A;  1GMW D;  4WFA Q;  4WTY A;  2HQI A;  1FTR A;  2Y8W A;  3IA0 A;  4KHM A;  2JZ5 A;  5KOX A;  2HQF A;  4BWJ A;  1N36 F;  3FFI B;  3MTK A;  3OR1 A;  4ALZ A;  2WON A;  1VQP S;  1SIZ A;  2HKE A;  5L1J A;  2MKJ A;  3UD4 P;  3MF5 A;  1WTF A;  2F40 A;  4WPA A;  2GVD B;  3DNC A;  2DTJ A;  1WDD A;  4ZCK A;  2HHV A;  1HIY A;  1TP7 A;  3BH7 B;  1EET A;  2I5J A;  5EGY A;  2VJV A;  2EW9 A;  3MPU B;  4DLG A;  3IRW P;  4PQA A;  1RAI B;  2L3M A;  1VQS A;  4ZLN A;  4LRB A;  5F0W A;  4CYU A;  2XCA A;  3TJ8 A;  2QLW A;  4DQI A;  4HH1 A;  1G2E A;  4NYO A;  1NAQ A;  4YEA A;  3RR8 A;  2HND B;  3Q8S B;  1C4A A;  3OR2 B;  2YQ0 A;  2R2U A;  3MDF A;  3IRX A;  1RHQ B;  1FA0 A;  3Q24 A;  3IGV A;  1S7I A;  2D74 B;  3SEO A;  4GRS A;  1QSL A;  5BYQ A;  3O6Q A;  1NU4 A;  1W7W A;  4UST A;  4KIA A;  3BBC A;  5D0R A;  2A18 A;  3C6T B;  2MQ8 A;  5B0D A;  1OPZ A;  1TTH B;  4LR8 A;  4NLD A;  4L72 B;  4KGV B;  2BYC A;  3VVT A;  6FDR A;  3NBP B;  2C42 A;  3ILJ A;  4ED3 A;  3TZZ A;  3DLG B;  4U95 A;  2E5G A;  5AE1 A;  2VFU A;  2APO A;  2GHV C;  2D9P A;  4BC9 A;  5KTQ A;  1U1K A;  3DLE A;  3AH6 A;  2AWZ A;  5LOQ A;  4WP9 A;  4HYK A;  5KG4 A;  4OZ3 A;  3H4B A;  3UDE A;  4QU7 A;  2C1E B;  2WVE A;  2EK6 A;  3MAQ A;  4MIB A;  4OI2 A;  3T5K A;  3OFF A;  1I3O B;  5A8R A;  2YX4 A;  2XY5 A;  5KFB A;  4O44 A;  3QQC D;  1DQ9 A;  2M8H A;  2DR8 A;  2F4V J;  2KXN B;  2AJQ A;  3EVW A;  1GFW B;  1MML A;  5K14 A;  1HR0 F;  2OSQ A;  3J7Z 5;  2XYP B;  1SJ3 P;  4LF5 F;  1NLK L;  3EVM A;  3JB9 k;  1HNI A;  3U1N A;  2MY8 A;  1N6Q B;  5AXM A;  2GML A;  2D41 A;  1RAF B;  5KFU A;  2DR6 A;  3TA0 A;  4DSL A;  1NDK A;  2H54 B;  3W9I A;  1KEK A;  3MMA A;  2R7T A;  3OTD A;  3MM9 B;  3LGN A;  1WG5 A;  5KFH A;  3PY8 A;  2W2N P;  4C0B A;  4V1A k;  4HEA 9;  2NYI A;  4MAK A;  3WC0 A;  1H3D A;  1RTJ B;  4XTT A;  3B8H A;  5IC6 B;  2XI3 A;  2ZOM A;  2CUY A;  1TUG B;  3OFG A;  4ZP8 A;  5HP1 A;  1J27 A;  3B4M A;  4FYW B;  5LSR A;  3I82 A;  3IG1 B;  3HF5 A;  5C25 B;  3HJV A;  2XMK A;  2DHS A;  2LLZ A;  1OQ3 A;  4P73 A;  3OW2 R;  3CDA A;  2WCX A;  3UNY A;  5RUB A;  4DS4 A;  2B9X A;  4MYT A;  4IR1 A;  2UXD J;  3ET6 A;  4ZIT A;  3F73 A;  1PIL A;  2N7C A;  1LWF A;  2MKY A;  4NCB A;  4CO1 A;  2HBQ B;  3UQS A;  2HFV A;  3M8Y A;  1RTZ A;  1R43 A;  4LSL A;  3JYT B;  3N01 A;  1VMB A;  5AE3 A;  2Z8Q A;  3DDI A;  2DNY A;  1D8Z A;  3PV8 A;  3A3N B;  1NH7 A;  1TL1 A;  3GFX A;  4DV3 J;  3QFH A;  4FXW A;  2FJE B;  2CQI A;  4Q0B A;  3PKY A;  2EK1 A;  2RJZ A;  4AL7 A;  1N33 F;  2IYI A;  2HVE A;  4NI2 B;  3UPF A;  3KUG A;  3N28 A;  1M5O C;  4EFA C;  1L3K A;  2I8E A;  5B0A A;  5CAB A;  4B3T F;  1ULR A;  3ZTO A;  4Q5V A;  2YKM B;  4K50 A;  1HNV B;  3CDE A;  2J7K A;  5F41 A;  2MZ1 A;  5LMU F;  2DGX A;  3H42 A;  3ZO7 A;  3X1L B;  1SCJ B;  1WG4 A;  1X8D A;  1HI0 P;  2PA3 A;  3AD7 C;  4IO9 Q;  1RAD B;  4CRJ A;  2KDO A;  4OZN A;  1RWW B;  4EZ6 A;  5BXI A;  2HRU A;  3MM8 B;  5HMZ A;  1RWV B;  3U7J A;  4CM2 A;  2E5J A;  1RTI B;  4O4G A;  1NK7 A;  3K5N A;  3R6L B;  4IG0 B;  5ETV A;  5D4O A;  1ITP A;  3EM1 A;  3ZTR A;  3EPG A;  5D0E A;  3HMJ G;  5THW A;  3G82 A;  3FEX B;  1VRT A;  1CJU A;  1YIT S;  3T1A A;  1HNZ F;  3W2W A;  3ZTP A;  2J6T A;  1TAU A;  1LXN A;  1VLY A;  3C2P A;  3ZXW A;  2BM0 A;  4ZOS A;  4MKB A;  2DJW A;  3VZI A;  8RUC A;  2XI2 A;  2UZA A;  2PMW A;  3DMJ B;  1JNR B;  1VIX A;  5KFL A;  4UUW A;  1YLX A;  2OI2 A;  4O3R A;  3PW5 A;  1RK8 A;  2HFN A;  2WB1 D;  2G1D A;  2BW7 A;  3IBF B;  1GTH A;  1RQ0 A;  4DF4 A;  1EQM A;  3ETM A;  1X5O A;  1JJH A;  4PWW A;  2AJ1 A;  3ENQ A;  2Q6C A;  3AQO A;  3MEE A;  2E7W A;  2CZV C;  1T3N A;  1C1B A;  3IMQ J;  4JI2 J;  3V4I B;  1F0X A;  4Y3C A;  1DUR A;  2VC0 A;  4USJ C;  1YZ6 A;  2XMU A;  2UVU A;  2GCF A;  1IR1 A;  1EB0 A;  2QN6 B;  5J2P A;  5DGB A;  2EFQ A;  1KLM B;  1JLG A;  2HVH A;  4C8N A;  1XN9 A;  1HKA A;  1MNE A;  3MTJ A;  3OJS A;  1HNX J;  1Y5I B;  1XMQ F;  3JQM A;  4X4V A;  5AJ3 F;  4UZB A;  1U8W A;  4NLP A;  3G8S A;  1FRM A;  3LWM A;  4H4K A;  1RTH A;  3TUZ C;  1YX2 A;  5E41 A;  1WOO A;  3QRQ A;  2CVI A;  2HMI B;  1U48 A;  4NEY A;  1H2U X;  5IOL A;  3NGS A;  1U02 A;  5F8L A;  2J6S A;  1W2I A;  3RBZ A;  4LF7 J;  1TVR B;  1H6K X;  3KLE A;  4ZMM A;  4WKR A;  1LFP A;  4B9S A;  1AFI A;  2KHD A;  5HO4 A;  1RA7 A;  2JX2 A;  4ZN1 A;  2AW0 A;  1T8E A;  2UUB F;  1B64 A;  3H59 A;  2KZM A;  2PT0 A;  1SPB P;  2R2T A;  1VQ9 S;  3VAM A;  3HT0 A;  5IT0 A;  3DGV A;  4YFU A;  4DFJ A;  2OMO A;  1GXT A;  3P49 B;  4YP3 A;  3GLJ A;  2ATC B;  2N3O A;  3H5S A;  4A4J A;  2XBP A;  1TKX A;  4N8N A;  1N5V A;  2PC6 A;  4DCJ B;  1FXD A;  2XMV A;  2K1R B;  1IVZ A;  3PFO A;  3S01 A;  1Q79 A;  1YJU A;  1YRT A;  2PD1 A;  1TK8 A;  3CUL A;  3MEG A;  4HDG A;  5HBM A;  5F8I A;  1SJR A;  1QVG R;  3RTV A;  2N4D A;  3FUY A;  3TZW A;  2KM8 C;  4PXE A;  4WP3 A;  1O0P A;  3B82 A;  4XDD A;  3Q8P B;  5L1L A;  4TN2 A;  1YZ7 A;  2FZC B;  3EDQ B;  1RXO B;  3JSM A;  2RRA A;  4KB7 A;  2KRR A;  1UFL A;  2HHS A;  3HHL B;  4WIQ A;  5DLF A;  1IKX A;  1RGV A;  3PX6 A;  3LAK A;  4I4B A;  1VIS A;  4N5S A;  3JQK A;  4MFB A;  1LW0 A;  1R8A A;  2CNK B;  1B7Y B;  1DLO A;  3FQK A;  4P10 A;  2DIS A;  3MM7 A;  2V50 A;  3O2I A;  3I4H X;  5L8R C;  1DRZ A;  3P96 A;  1ZAV A;  3C16 B;  2UUT A;  3MAA A;  4X4O A;  3G6Y A;  4NCA A;  4C2M A;  3NKY A;  5CYM A;  2C2D A;  2KKH A;  4G1Q A;  3TZX A;  3PM9 A;  4Y2I A;  1S6P B;  3M8Q A;  2ZHO A;  1PC5 A;  1U1L A;  3QLH A;  3HHD A;  1SKR A;  2V94 A;  3KHL A;  3OL9 A;  2CPJ A;  3Q8U A;  3MPW A;  4G65 A;  2IJN A;  2FLP A;  3M4X A;  3CJ2 A;  1IN0 A;  4F8R A;  3QWU A;  1FVS A;  4DV0 J;  2YNF A;  3C6U A;  3J80 U;  1RBL A;  2W4P A;  1U26 A;  4OJG A;  4RW9 B;  4JI1 J;  3AJ2 A;  4IYQ A;  1XNR F;  1RWK B;  4MT1 A;  2Y0S D;  2AU0 A;  5HLF A;  1M1K T;  3D1H A;  1VHI A;  2VIC A;  2RF2 A;  5HQM A;  3OSP A;  1NJI T;  5H9F J;  2RKI A;  5DM7 Q;  1S9G A;  5A8K A;  2NXE A;  3ISZ A;  2NLW A;  4BBY A;  4JBC A;  3M6W A;  2R8J A;  3MMB B;  4Y00 A;  2JSX A;  4DQR A;  4F4Y A;  4U6P A;  2JFK A;  4DR2 J;  2R7S A;  1JJ4 A;  3DOM A;  1QTM A;  2IM1 A;  3CJS A;  5I3U A;  4JYA F;  1CC7 A;  1Y5L B;  5KG1 A;  3MOZ A;  1E6Y B;  1N5Y A;  4DPY A;  1NK4 A;  3EUN A;  1CJT B;  2VZ9 A;  2Y1J A;  1DTQ B;  3RG6 A;  2RQ4 A;  4UOF A;  2BOP A;  2NXN A;  2VBY A;  5LSL A;  4JV1 A;  2VPZ B;  5HAO A;  1NZ8 A;  4YHH F;  4DL0 C;  1SL0 A;  5CYQ B;  2OPQ A;  5KG3 A;  1Q8I A;  2H48 B;  3BKU A;  1URN A;  2HNZ A;  1XIQ A;  2BRL A;  2JEG A;  1R0A B;  1S1W B;  1RLC L;  4PEO A;  4B9U A;  3NMR A;  1B4S A;  1EKS A;  1FDB A;  4ETZ A;  2EFP A;  4DR4 F;  2LQ9 A;  4TU9 A;  3N5B A;  4TLR A;  1ELO A;  3FSI A;  3UCZ P;  4JV5 J;  4DUZ J;  3HZG A;  1A0O B;  4ES1 A;  3T19 A;  1PO6 A;  3IWX A;  3KLI A;  4FPR A;  3KG4 A;  3THT A;  2GW8 A;  4C0H A;  1RAB B;  4O0N A;  3CCJ S;  2DPJ A;  3D3B J;  1X9M A;  1QLN A;  1R8C A;  1PSD A;  4UOC A;  2BQR A;  4ED1 A;  1AB8 A;  1VQ4 S;  4HLB A;  3CDU A;  4LFC J;  1TFW A;  1S99 A;  3RBE A;  4ZVU B;  2MMY A;  3BKT A;  1M5S A;  4CTA A;  3MUR P;  1SJ1 A;  3KXD A;  1HWL A;  5ETT A;  1VC6 A;  1GMV A;  1UVJ A;  4IFV B;  2BDP A;  2V8G A;  3IN5 A;  1AZS B;  4JOU A;  2CDR B;  2QEX S;  5EDW A;  3T5H A;  3KG0 A;  1G6B A;  4ER8 A;  2ZJR Q;  1NHV A;  4ZKA A;  3RRK A;  4LRA A;  1KN6 A;  3CO0 P;  3B4D A;  2W2P P;  4LQ9 A;  4C48 A;  2VL1 A;  3OTC A;  3R5G A;  2FC8 A;  3QT6 A;  4NRT A;  3W5Z A;  3OFE A;  1M5V C;  2UU9 F;  2OHD A;  2GC8 A;  5IQ6 A;  4B17 A;  2B8Q A;  5B08 A;  1K47 A;  3DGP A;  2QA4 S;  1EX8 A;  3I9V 9;  3DRP A;  3LUY A;  1S0V A;  4Q7A A;  4LFB F;  3M6V A;  4DPW A;  3OTO J;  4C97 A;  3QGH A;  3MPD A;  4UUX A;  3UN2 A;  4OI4 A;  4ED2 A;  2J0Q D;  3M2V B;  3ZZP A;  1YJN S;  3B78 A;  5T41 A;  1KD1 T;  1YKW A;  3QJJ A;  2C3P A;  1OIA A;  2ZC3 A;  1ZTW A;  2WOM B;  4QJV A;  1IJE B;  4RWW A;  3EZU A;  4IRD A;  4O3O A;  1FNX H;  1RHR B;  5IT4 A;  2PE8 A;  2DXF A;  4I6A A;  4ZVO B;  1F5B A;  2ROE A;  2HHT A;  1GQE A;  1N34 J;  1VC5 A;  2NSC A;  1CJV B;  4NZ7 A;  1V9O A;  5KFD A;  1PG5 B;  3OXF A;  3I0S A;  1NB2 A;  2E5H A;  2M9K A;  1NXI A;  2LQJ A;  3NOC A;  2VOO A;  4DX6 A;  4X4P A;  5KFC A;  1NJZ A;  3HVR A;  1Q86 T;  2RHS B;  2VV5 A;  2ZC4 A;  3BJY A;  4NYP A;  4RU2 A;  1NKC A;  1IQT A;  5HJX A;  2ZD1 B;  4YOE A;  2H5E A;  3C14 B;  4J9N A;  3NY0 A;  1SI9 A;  3DLK A;  2LKZ A;  2EFO A;  1LQ9 A;  1YHQ S;  2VDI A;  2ACM A;  4NZ6 A;  1X4F A;  4J9V A;  2HLT A;  3A3P B;  4EBC A;  1V3R A;  2ZBQ A;  3AY0 A;  1EP4 B;  4OYM A;  2XHW A;  2IC3 A;  3G6X A;  3MI7 X;  1QAI A;  2L9N A;  1YI2 S;  4F2S A;  3Q89 A;  1XBW A;  1FI4 A;  1QDU B;  1RAG B;  3W2V B;  2MGZ A;  2Z58 B;  3W9H A;  1Q81 T;  2X51 A;  4DU8 A;  1QY7 A;  2JHE A;  2DT9 A;  3TA1 A;  3TAQ A;  1TV6 A;  4FS1 A;  2DIU A;  4QYZ J;  2JFD A;  2M88 A;  4CP5 A;  3THP A;  5IXU A;  4A46 A;  3IS9 B;  4L74 A;  1RT5 B;  4PZV A;  4H4M A;  1NHU A;  1D8Y A;  3NLC A;  5J2N B;  3KLH A;  1S1T B;  1H73 A;  2CJ9 A;  2IMW P;  2VG7 A;  4ECT A;  3OJU A;  1T9W A;  3BS9 A;  2CQD A;  2D3Z A;  1SQG A;  4GVB A;  4KV8 A;  2B9Y A;  4QWB A;  3W5Y A;  4A8M P;  3D6M B;  4LMZ A;  3D1Q A;  1SXL A;  2D3U A;  1RTD A;  1F5C A;  1RWO B;  1T0T V;  4A8F A;  2DY9 A;  1VQO S;  3BR9 A;  4NRU A;  2HEK A;  2XSJ B;  2YWW A;  4XK8 C;  2W9A A;  2XEX A;  2MQP A;  4LBH A;  2ATL A;  4MK8 A;  3VAL A;  4N41 A;  2ROG A;  1KP6 A;  2P5V A;  1Z2Z A;  2DR5 A;  1S1U B;  1EJ7 L;  2ZH4 A;  3SQG A;  1GX5 A;  1Q78 A;  5HQ8 A;  1X4D A;  3AFG A;  1SIW B;  2HAF A;  1Z1Z A;  2LFV A;  1I6J A;  3NNC A;  5CA5 A;  1TKT B;  3M7V A;  5FII A;  4M95 A;  1QAX A;  3KJQ B;  1FX4 A;  1UEU A;  3QGP A;  4DG1 B;  2BE2 A;  4HI1 A;  1LFW A;  4YS2 A;  2ZNY A;  1S0N A;  3U27 A;  2A0F B;  4PQU A;  1VYA A;  3K8V A;  3WC2 A;  5H9F K;  3H98 A;  2E7V A;  3RBD A;  4QPX A;  5KT4 A;  2CPY A;  1S10 A;  4LF9 F;  3GU0 A;  2BQU A;  4U7U D;  1TKZ B;  1H7W A;  2FJX A;  1FVQ A;  4OJH A;  2DCU B;  2XMJ A;  1XMO F;  2AJ0 A;  3PKM A;  2YPY A;  1CQN A;  3TEH B;  2AZ3 A;  5KFO A;  4B02 A;  4OLP A;  3OUY A;  3UDV A;  1HPZ A;  3CC7 S;  2Q66 A;  5CQG A;  2WTF A;  4B3M F;  1FKP B;  3TJA A;  1NJW A;  1JLE B;  3IR7 B;  3BDE A;  2FUG 9;  1VBZ A;  3CXC R;  4YR2 A;  2OEK A;  1WDT A;  1YWX A;  1PYT A;  4JI5 J;  1Y4Z B;  1HR0 J;  4B3O B;  4ZVQ B;  3MR7 A;  2NYH A;  3RGI A;  2RUG A;  2R8H A;  1SQF A;  4HI2 A;  2XHC A;  3M1V B;  1D1U A;  1RAH B;  4FS2 A;  4WK3 A;  1YSJ A;  1S49 A;  4RNM A;  1QAY A;  2MY7 A;  5DET A;  5KT3 A;  3FFI A;  4IQX A;  1RWN B;  4FNI A;  3KJV B;  3DC2 A;  4QIW D;  3PW2 A;  2Q6B A;  4USW A;  4O3S A;  3MMC B;  2M5Y A;  4OV1 A;  4C8M A;  3BSO A;  3A13 A;  3C66 A;  4Y2A A;  3FC9 A;  4ECU A;  2G2O A;  3A12 A;  3AJD A;  4QWE A;  2QMW A;  4OI3 A;  1W25 A;  3R5A A;  3W61 A;  2C3O A;  1BQX A;  2YNI B;  2IPO B;  2QFI A;  2KTQ A;  5FLX U;  3FBC A;  5IV3 A;  1IKW A;  4ZIW A;  3TRG A;  1UP1 A;  1IR0 A;  3NCQ A;  5FDL B;  4WII A;  5KFJ A;  3RRH A;  4M5H A;  4ZJQ A;  1CVJ A;  1WHW A;  4XDC A;  3L4B C;  5DS7 A;  4DMZ A;  3OR2 A;  2KT2 A;  2HVD A;  1S6U A;  3T6J A;  4OX7 A;  2BJE A;  3SI8 A;  2OGU A;  3QNW B;  5JVH Q;  4DL3 A;  3DHW C;  2HNY A;  3TUI C;  3HJF A;  5E0O A;  4Y2M A;  2RIL A;  4Y2C A;  1U2C A;  1X7V A;  1A9N B;  3NOG A;  4I2P B;  1F60 B;  4L6V 3;  3KNG A;  2W4D A;  3BRE A;  4P2M A;  4O3P A;  3R3T A;  5HMY A;  4WZM A;  2PN6 A;  2CKW A;  2KT3 A;  3NBP A;  3GCX P;  3PIO Q;  1N33 J;  3RUB L;  3W63 A;  3HSZ A;  4K4V A;  3NNA A;  2MST A;  3QZ7 A;  4CT8 A;  3L95 X;  1O51 A;  1TR0 A;  5B0F A;  3KHG A;  3RRG A;  2DXE A;  3G96 A;  3QO9 A;  4B3T J;  1U6Z A;  3GTY X;  4AXI A;  4Z7Y A;  5LMU J;  1T9U A;  4JV2 A;  4RW7 B;  3TVY A;  2FC9 A;  5GAE I;  1FJC A;  2QG9 B;  4OIX A;  2YKQ A;  3W5X A;  3A8I A;  3CCT A;  3H25 A;  5DG7 A;  4MIW A;  1S0O A;  2OEJ A;  5B0C A;  3K5M A;  5A8W B;  2UVW A;  1KR4 A;  2YWE A;  2EFV A;  3CMA S;  1AYE A;  3H2L A;  2EPI A;  3TA2 A;  1S6Q B;  1YJ9 S;  2J8A A;  1BD6 A;  4DR7 F;  1AW0 A;  1T11 A;  1ZA2 B;  1Q5Y A;  2OO4 A;  2PDA A;  3EX7 B;  2B0G A;  3GIL A;  1HNZ J;  3H0P A;  3C8Y A;  2AZ1 A;  1N6Q A;  1VQY A;  2DH9 A;  1BQM B;  4RO0 A;  5DRK A;  3GQC A;  3VGV A;  2P6T A;  4OI6 A;  4Q44 A;  5KFV A;  1SC3 B;  4ZK7 M;  3K8W A;  2OPS B;  2J0S D;  4I7F B;  1NDC A;  1PBU A;  2VG6 B;  4ZVT B;  2CJB A;  2KG0 A;  1O6X A;  3D54 A;  3S1T A;  1RTJ A;  2YQ1 A;  3FSX A;  3IG1 A;  2ASJ A;  4L3N A;  1A6L A;  1D9A A;  5EWG A;  5C25 A;  3BEG B;  2MHE A;  5T7L B;  4U8Y A;  2ZHB A;  4EBD A;  4PYD A;  4UOH A;  4KBI A;  3GCW P;  1K1Q A;  2C2Z B;  4QCL A;  1LWX A;  1JLB B;  4HT7 A;  4LBI A;  2IA6 A;  3E8O A;  3JQJ A;  5ETQ A;  2JDJ A;  4PG6 A;  3S7R A;  3LOU A;  4KYZ A;  3T5L A;  2RDI A;  3JYT A;  4QYZ K;  4DLE A;  4FNH A;  3MMJ A;  2CJX B;  1U1O A;  2FLN A;  2RS8 A;  1XMQ J;  5AJ3 J;  5DM6 Q;  3PRD A;  3I96 A;  5C2C A;  2YY3 A;  4I68 A;  2HBZ B;  1HD1 A;  2IA0 A;  2QIF A;  4QIF A;  5KFW A;  5GAG I;  2EC2 A;  3O8W A;  4QW9 A;  2HAI A;  4WXW A;  2IMO A;  4NI2 A;  4GO5 X;  4CO5 A;  3PNI A;  1FJG F;  4XAK A;  2OTJ S;  1OYD A;  4HKQ A;  1PAU B;  4CWB A;  2YKM A;  1NPP A;  1HNV A;  2MQN A;  5LJ5 Y;  2UUB J;  3DLB A;  2FVS A;  4ZLP A;  3FSY A;  5HRO B;  2XMW A;  1GXU A;  4B9T A;  1FNO A;  4X4U A;  5AXN A;  3ZZO A;  1S1X B;  1UL3 A;  1PGZ A;  3V5R A;  1U47 A;  2QLJ B;  2HPU A;  3D3C J;  2LXU A;  2KFY A;  1RTI A;  3QJL A;  1X0F A;  1JLC A;  4ITS A;  4NLG A;  4IG0 A;  3AB2 B;  4LF6 F;  3KJF B;  4RWX A;  3CD7 A;  2O3D A;  2Q1L A;  1SKS A;  4F4X A;  2AF6 A;  1T95 A;  4M5N A;  1OJ4 A;  4OYX A;  1CC8 A;  2AX1 A;  5M2U A;  3BDP A;  2B6A B;  4X62 F;  1CBK A;  3RB4 A;  2IIH A;  1HAR A;  3JXO A;  2HK2 A;  1RWX B;  1C1C B;  1JWW A;  2DD8 S;  1FXR A;  2QA2 A;  3DMJ A;  1T7P A;  4RJV A;  4AUK A;  4WU2 A;  4OLO A;  3CSK A;  1NDP A;  3IGN A;  1PIE A;  2X1B A;  3W66 A;  2QYG A;  2KU7 A;  3VAI A;  5HL7 Q;  3I87 A;  2V5H G;  5D8H B;  1TK0 A;  3CCS S;  4KGZ B;  1RWP B;  2QL7 B;  5K20 B;  2V4J B;  3FCH A;  3GWC A;  2IAJ B;  3UNG C;  1S12 A;  3CJ0 A;  2ILZ A;  1WI8 A;  4RX6 A;  3TI0 A;  1CEZ A;  3LP0 B;  2I2Y A;  1A7G E;  2R7V A;  4QR2 A;  3V4I A;  3BGF A;  1IM6 A;  1JKH B;  3B6B A;  1TQL A;  3QT7 A;  2KFN A;  3R5C A;  1UVL A;  4ENO A;  2ASD A;  1HQU B;  5D4P A;  4ILM A;  3DXB A;  5A76 A;  3VGS A;  3WIV A;  2DH7 A;  2WBR A;  2DNL A;  2KVI A;  3GG0 A;  3O44 A;  2ZWP A;  3W8G A;  5F8N A;  2GQQ A;  4LR7 A;  1LK7 A;  1FWL A;  5A6P A;  3EGZ A;  2RSQ A;  4DL6 A;  2HWH A;  3CB4 A;  4DS5 A;  4NZ0 A;  2FHM A;  3DOL B;  4N47 A;  2IBK A;  2E1M C;  3CME S;  3DRY A;  1NK9 A;  1XNR J;  4BHQ A;  3L3C A;  3PDN A;  4X4R A;  2FJW A;  4ZP7 A;  4W4M A;  3LH2 S;  3Q86 A;  2HS4 A;  2GS8 A;  1WOR A;  2HMI A;  1IBK F;  4F67 A;  4YR3 A;  2W25 A;  2O5D A;  1TVR A;  1UKU A;  1FE0 A;  3SSR A;  2BJ9 A;  3ICL A;  5E3C A;  4E8U A;  5HN0 A;  3CE8 A;  2WVC A;  4CIO A;  4OV6 A;  5KG7 A;  4PWU A;  5T14 A;  3M9M B;  2AV5 A;  3UN5 A;  2HHU A;  4JYA J;  2I1R A;  2N7Y A;  3LQV A;  3QPI A;  2LEP A;  5KG0 A;  4Q45 A;  1YBA A;  2VQE F;  3P45 B;  1DY3 A;  1JX4 A;  2K1R A;  3R2D J;  1MG7 A;  4J9Q A;  4YHH J;  4M5J A;  1CSJ A;  2DNN A;  2F8E X;  1SV5 B;  2RRB A;  1K1S A;  2CNN B;  1XEZ A;  3FBB A;  3LAL A;  2R7O A;  3ZZY A;  1N54 B;  3ITH A;  4DV4 F;  4Y2K A;  2LQB A;  2XY7 A;  4ZA1 A;  2AMC B;  4JI3 F;  2AEF A;  3FDS A;  2HHQ A;  2KYZ A;  4N8O A;  4DR4 J;  3HHL A;  2HGM A;  4HHJ A;  3V6J A;  5LSO A;  1EKR A;  3GSI A;  3MM6 B;  2CIM A;  1LWE A;  2KT5 A;  1M5P C;  1XWL A;  2XTJ P;  3PYD A;  1G7C B;  1FK9 B;  1RT2 B;  1NHK L;  2QTW A;  1ZPV A;  2VKR A;  3LP1 B;  5D3G B;  3C16 A;  3EXC X;  3H20 A;  1SL1 A;  1UFW A;  1U6F A;  1WHY A;  3MGJ A;  5HVH A;  1Y0H A;  2UUW A;  4JI4 F;  3VVU A;  3MD1 A;  2IY5 B;  3CDB A;  3MHY A;  1WEZ A;  3FRY A;  2DGV A;  2KFZ A;  1HWJ A;  1S6P A;  5KFZ A;  3FQL A;  5KFA A;  4K8R A;  3HDS A;  1MU2 B;  2DNK A;  1OMS A;  1CPZ A;  1GMW A;  2H1Y A;  2PI5 A;  4M5M A;  1V5I B;  1OO0 B;  3EVO A;  4X2B A;  3G2X A;  4RW9 A;  3DRR B;  2XWX A;  2LMI A;  1UW4 A;  2AYM A;  2MQL A;  7AT1 B;  4RKU C;  2HRY A;  2YWF A;  4PG7 A;  2CQ1 A;  2R4F A;  5GMD A;  2UU9 J;  3MCS A;  2GIQ A;  5DG8 A;  1BMQ B;  2JJ4 D;  2J0X A;  1WC0 A;  3FZB A;  1HFE L;  3PO4 A;  4EEY A;  3C46 A;  3D28 A;  1FEH A;  2E9Z A;  2O01 C;  4ILR A;  1MMN A;  3HHE A;  2DHH A;  3MMB A;  4OHZ A;  2DO4 A;  4LFB J;  4V19 X;  1HD0 A;  4ED0 A;  4LF8 F;  2MZJ A;  4NA1 A;  3PEJ A;  3PHT A;  2GV1 A;  4DOZ A;  2B7C B;  1E6Y A;  1HYS B;  2Z4P A;  3AB4 B;  3OL6 A;  1FRJ A;  2YTC A;  1DTQ A;  1S79 A;  4RNN A;  1E6V B;  2LDI A;  2BEF A;  2IM0 A;  5KFP A;  4UT4 A;  5CYQ A;  4TU8 A;  2W7P A;  5ITH A;  4DSK A;  4TXS A;  2DKO B;  1OQ6 A;  3NMA A;  1KHW A;  2QT7 A;  4UTG A;  3T1Y F;  1N48 A;  3HD1 A;  2RHQ B;  1Y7P A;  1R0A A;  1S1W A;  4USV A;  1H2V Z;  4DQQ A;  1H7X A;  3P3D A;  2DNP A;  4P71 A;  3CO9 A;  4CYU B;  4NOH A;  1RJJ A;  4K4Y A;  1RDR A;  1VK8 A;  4NLX A;  2DNO A;  3UD3 P;  4CLW A;  2B8P A;  2Z30 B;  1UMJ A;  2V2Z A;  3TAN A;  2IFX A;  4MK9 A;  4NE9 C;  2HBR B;  2W7A A;  2MEW A;  2KRB A;  3NGD A;  4OZJ A;  3CC2 S;  3JAM U;  3CC4 S;  3NS5 A;  3Q8Q B;  3JSB A;  4ZVS B;  4C8O A;  1RWM B;  1FTC A;  2HGN A;  1DZ5 A;  4PCQ A;  3EPI A;  3CIZ A;  4QOT A;  3U1M A;  1DTT B;  3SQO P;  5GAE U;  4IFV A;  1QJH A;  2EG2 A;  3W8P A;  5C24 B;  1R8P A;  1ZAW A;  2ZM6 F;  2DGQ A;  3H7H B;  4OFZ A;  3W7B A;  3LW5 C;  3PXG a;  3Q22 A;  3R9L A;  2XC9 A;  3EDR B;  2VJU A;  4M5D B;  2EKN A;  1KHV A;  1MWY A;  3IAM 9;  1SB6 A;  3ILL A;  1AT1 B;  2WAQ D;  4WCE Q;  3GIK A;  3OSN A;  4NAS A;  3FBE A;  3ZZ0 A;  1MN9 A;  4UOG A;  3WX4 A;  4M8L A;  4M5I A;  4EUV A;  1U45 A;  3FEY B;  5DQI A;  1MWQ A;  1IM4 A;  4LVN P;  3TUP A;  1HW9 A;  1KWM A;  3HVW A;  4ED8 A;  3MM5 B;  2MXY A;  4OJ1 A;  3G87 A;  4RLE A;  1T9Y A;  4QR1 A;  2QV6 A;  5E3R A;  2XZT B;  2LXI A;  2ZOF A;  4C9D A;  2RDJ A;  2ZZM A;  1SUQ B;  5IM0 A;  3M2V A;  3AOB A;  3R8Y A;  3H2U B;  3G4S S;  2ZKT A;  4MKV A;  1TK5 A;  2GJF A;  4URS A;  2AYG A;  1REV B;  4DUY F;  1SJF A;  2BJ3 A;  2XZW A;  3VHQ A;  2BAB A;  3M8W A;  2AX0 A;  5ETK A;  1K73 T;  4YB1 P;  2KO1 A;  2CJA A;  3E3X A;  5KFQ A;  2QJ3 A;  1ZAX A;  1OPI A;  4ECQ A;  1RT1 A;  1VOM A;  1UPP A;  5ETN A;  4C8K A;  2DH8 A;  1CJV A;  2KXF A;  1S9E B;  4DHV A;  3FMB A;  4P7T A;  4DDF A;  5JMN A;  4KQZ A;  2BM1 A;  2HW3 A;  5JUM A;  4RBU A;  1I51 B;  3MD3 A;  1JLF B;  3ET6 B;  4DUT A;  3EXY A;  5LXR A;  4EBE A;  2HQG A;  2J8S A;  2UXB F;  3NS6 A;  1OYE A;  3W62 A;  4C7Q A;  2W9B B;  3CED A;  4OHV A;  5GAG U;  2NS1 B;  1O5J A;  4LF9 J;  2ZD1 A;  3HHL D;  2OEM A;  5KT5 A;  2DO0 A;  3VAK A;  3C14 A;  2UXC F;  3Q83 A;  3R5J B;  2RUS A;  1XMO J;  1TL1 B;  2C3M A;  3RAM A;  1IKV B;  3W1Y C;  2MZQ A;  4LF4 F;  5IWA F;  4FXD A;  4ZHR B;  2RU3 A;  4N7T A;  1FWK A;  2V8P A;  1V3S A;  1FKA F;  4FKX A;  5K5M A;  4WU3 A;  1IR2 A;  5GMK a;  4B3M J;  3ETO A;  3IFE A;  2GZO A;  2GHW A;  3KLG B;  2K8G A;  3QAE A;  2RRN A;  4DSJ A;  4EYH B;  4OYB A;  2M3D A;  2BRK A;  4WYW A;  1ZET A;  2OSR A;  3ULH A;  9RUB A;  4Q8E A;  1ICE B;  2FZK B;  4N77 A;  2NUH A;  2VBZ A;  4RBT A;  2R7X A;  5F0U A;  1DAX A;  5I4M A;  3IS9 A;  3TZY A;  1JJC B;  1RT5 A;  1DHM A;  4IFY B;  4CH0 S;  5J2N A;  1N32 F;  1S1T A;  2FHK A;  1RU2 A;  1N52 B;  1VRT B;  2IM2 A;  2F4F A;  1S6O A;  3QGI A;  2V69 A;  2XUL A;  3NGT A;  1UVM A;  1T03 A;  3CWJ A;  4RW6 B;  4C11 B;  2PGC A;  4E0D A;  1ROF A;  2WSC C;  1K8A T;  3M30 B;  2G4B A;  1S7H A;  4RU9 A;  1UWB A;  2OFH X;  2E5L F;  2DEJ A;  5IFM A;  4H4K C;  1FJ7 A;  2JWN A;  1VQL S;  3MUT P;  4A8K A;  5CXT A;  1CLF A;  2YKN A;  2MZS A;  3PIP Q;  3QZ8 A;  2LA6 A;  4I69 A;  2XSJ A;  2HQ3 A;  4NXN F;  4E98 A;  4CLP A;  1NBE B;  2PMH A;  4BS2 A;  3GFY A;  3BO4 A;  4FVC A;  2GQ2 A;  4CQ1 A;  1HBU B;  1S1U A;  2CG8 A;  5CD4 H;  5C42 B;  3PYE A;  4IH7 A;  2H65 B;  1C0U B;  3POT A;  1TKT A;  3V4M A;  3QAT A;  2MPU A;  4DG1 A;  1Y11 A;  4TQS A;  4M5G A;  1PAE X;  2E1A A;  5D0G A;  2QZ8 A;  2Q3P A;  2DXD A;  4YY3 F;  1L3S A;  4F4W A;  2OJ3 A;  5IT9 U;  1JLG B;  1X4B A;  4K59 A;  5L9N A;  3CMQ A;  2N3L A;  4ZPC A;  4ED6 A;  3KDN A;  4ZIV A;  2AEJ A;  3O5T B;  2MB0 B;  1TKZ A;  8AT1 B;  5F8G A;  5IS2 A;  3FKB A;  2EC0 A;  3BPD A;  2CZ4 A;  1FNM A;  4C98 A;  2AD9 A;  3TO8 A;  1RTH B;  4TQR A;  4DV7 F;  2JOQ A;  2RE1 A;  4J9P A;  4F3O A;  2YX7 A;  3DYA B;  1WSR A;  2GJI A;  3N6N A;  1RLD A;  2KXH A;  5HAN A;  4FVM A;  3AHP A;  3T5J A;  1ZM3 A;  2FHJ D;  3O3L A;  2VUG A;  2LA4 A;  3AD9 C;  1JIH A;  3I5C A;  3TAM B;  3PAC A;  2PMZ D;  4TKT A;  2KVQ E;  4P7V A;  2XYH B;  2CZ9 A;  4USM A;  1NJX A;  2M8D B;  4CO0 A;  4JI5 F;  2GVZ B;  1FKP A;  1H72 C;  5A0Y B;  1UVK A;  2R8K A;  1JLE A;  1U4B A;  1QM9 A;  1AUS L;  3D7S B;  4HDH A;  3NGK A;  2MHN A;  4B3O A;  3HSD A;  4DR7 J;  2CQC A;  2H4Y B;  3ELH A;  2QLX A;  1FRX A;  2H9Z A;  3AXM A;  1UWA A;  3BN4 A;  3M1V A;  1FF2 A;  3M05 A;  2MKH A;  4OYP A;  5B0B A;  1UJ5 A;  2VOP A;  2AGQ A;  4GMK A;  5C7P A;  5KFS A;  4DV2 F;  2JLF A;  2GNK A;  1W2B R;  2L9W A;  2W7O A;  1HI8 A;  3KJV A;  2XQC A;  4L73 A;  2RB7 A;  1U0S A;  3MMC A;  2YWH A;  3T9N A;  1QAJ A;  4F0K A;  4ED5 A;  2ZBR A;  3FCV A;  1D9D A;  1YGY A;  3RB0 A;  4M1K A;  1RHM B;  2C2O B;  1P1L A;  2COL A;  4C3M A;  4DFM A;  2VAS A;  2YNI A;  4CO4 A;  2DHG A;  2C3Y A;  4ILL A;  1LOU A;  4CH1 A;  1XNQ F;  1JLA B;  2DRD A;  1FE4 A;  2UUA J;  4ZVF A;  4B3R F;  3L7P A;  1RT6 B;  3K5P A;  5FDL A;  1N5Q A;  2D3O R;  1OY8 A;  2HG4 A;  3MAA B;  4J9R A;  2HGL A;  2CPX A;  1UA0 A;  2GJ2 A;  3FNN A;  2C2E A;  4MIA A;  2W1B A;  3VAF A;  1VR6 A;  1RA6 A;  1SQE A;  4TYB A;  1NO8 A;  2V6A A;  5D77 A;  5K8O A;  2W01 A;  1N0V C;  4K7Q A;  4MTP A;  1XJW B;  3SFG A;  4I64 A;  1X5S A;  3MEK A;  3AXK A;  4CLL A;  4KHP F;  1J5E F;  4I2P A;  3ZZT A;  1EIY B;  2VH7 A;  3KK3 A;  3K89 A;  3ZNU A;  4ELV A;  1UVI A;  3NNH A;  3PRB A;  4DR6 F;  4OYI A;  3GJR B;  3AOA A;  4EU0 A;  1FJG J;  3KWM A;  5ETS A;  4O3Q A;  5D78 A;  1FDA A;  4RW7 A;  2POK A;  3PTW A;  3RR7 A;  1WF0 A;  1FX2 A;  1DBD A;  3KLF B;  4V19 J;  4ELU A;  2RVJ A;  1NH8 A;  3J7Y I;  1S9G B;  2CQB A;  3BPS P;  1Q53 A;  1B99 A;  3FVY A;  1WTB A;  5A8W A;  3GFZ A;  1JLQ B;  1NRK A;  1TKD A;  2XS5 A;  1S6Q A;  1U1P A;  3BGL A;  4LF6 J;  4P6Q A;  3GYX B;  4DI6 A;  1N5Y B;  3O1L A;  1X31 C;  4AD6 A; 
#chains in the Genus database with same CATH homology
 2XM3 A;  2VJV A;  4ER8 A;  2XMA A;  2EC2 A;  2VHG A;  2F4F A;  2VIC A;  2XO6 A;  2VIH A;  2A6O A;  2A6M A;  2F5G A;  2VJU A;  2XQC A;  2FYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...