4ER9A

Crystal structure of cytochrome b562 from salmonella enterica subsp. enterica serovar typhimurium str. 14028s
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
105
structure length
105
Chain Sequence
ADLEDNMDILNDNLKVVEKTDSAPELKAALTKMRAAALDAQKATPPKLEDKAPDSPEMKDFRHGFDILVGQIDGALKLANEGNVKEAKAAAEALKTTRNTYHKKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Crystal structure of cytochrome b562 from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Electron transport
total genus 45
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2012-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4er9A00
1E84A 2XL6A 5JS5A 1BBHA 4D4XA 1NBBA 2CCYA 1QPUA 2XM0A 4JE9A 2XLVA 2XLMA 4U9EA 4U9DA 3QVZA 4JEAA 3M15A 2J9BA 2BC5A 2YKZA 3L1MA 1CGOA 3IQ5A 1GQAA 2YL3A 4EIYA 1YZAA 2XLWA 4CDYA 1A7VA 3M79A 4ER9A 1LM3B 3ZWIA 4D4NA 2YL1A 3M4BA 4NC3A 3QW0A 1YYJA 2XLHA 5JLIA 5JVEA 2XLDA 1CPQA 1CPRA 2XLOA 4ULVA 3U8PA 3HNJA 1M6TA 3QVYA 4CJGA 2YLGA 3HNLA 3NMKA 4WGZA 5JRAA 5B3IA 3HNKA 3NMJA 5JP7A 1YYXA 3ZQYA 1APCA 1JAFA 3C62A 3FOOA 3IQ6A 3QW1A 4N4WA 3DE8A 4JKVA 1YZCA 4IAQA 4CDVA 1E83A 1E85A 2YL7A 3C63A 4IARA 5JSLA 3TOLA 4JEBA 4L6RA 4N6HA 2XM4A 2YLIA 4CIPA 1E86A 5AGFA 3FOPA 5JT4A 1S05A 2XLEA 4CJOA 3M4CA 2YLDA 4WGYA 3NMIA 256BA 4CDAA 4CX9A 3ZQVA 1QQ3A 3TOMA 1RCPA 1EKYA 3DE9A 2J8WA 3ZTMA 1CGNA 2XL8A 3VRCA 1MQVA 4IB4A 5JUAA 3ZTZA 2YL0A 2QLAA 3HNIA
chains in the Genus database with same CATH superfamily
1J8MF 1XWJA 2UUIA 4PJLA 3WHNA 1RJ9A 2OEVA 1TFOB 3ASNC 5L3VA 2O9XA 5HV9A 4PJNA 4CS9A 2MWQA 2QE9A 2RD9A 4Q5SF 5E33A 1OR2A 2CCYA 1O5HA 1TWGA 1TQGA 2QNLA 2Z15A 4U5FE 4B6IA 3S84A 2QTVA 4H4KC 4U5DE 2C03A 3TD7A 3HKKA 5KYNA 3V5ZA 3TQOA 3ASOC 2E87A 4JEAA 2Q7RA 2YRFA 3M15A 3SXZA 5D91A 4XTKA 1ORSC 2BC5A 2YKZA 3L1MA 2D4UA 2HMZA 3R2PA 3IPMO 4JIOA 2YL3A 3E9VA 4C3DA 4CDYA 1WASA 1SYQA 3EG9A 2M64A 4CS9C 1A7VA 3VYWA 1B68A 2Y3DA 2NUPB 1E2XA 3F46A 4ER9A 3U3BA 3V7OA 3NDBB 3DJUB 4JW1A 1Y4CA 2OJQA 4MVQA 5D92A 2LIGA 4JJFA 3ZWIA 4DBRA 3M4BA 1TWHA 3LNRA 2VASA 4U5CE 1YYJA 3DXJF 2JD3A 1NZEA 4Z9HA 5A6BD 3N2ZB 5E3CA 3MFNA 3SNHA 4EBJA 5L0CA 4AX2A 2XS8A 3JRTA 4FX5A 4ULVA 3SXMA 1O3UA 3HNJA 1T5OA 3CSKA 1VB5A 3OEOA 4XLPF 3U8VA 2I8BA 3HNLA 3DZAA 5AC5A 5B3IA 3DM5A 4UDVA 5JP7A 2DGJA 2OG2A 2J7PA 3CAXA 3K1IC 5TJ5E 1APCA 5AC4A 3CZ6A 3DAGA 1NLXA 4HEAJ 3C62A 4RD9A 2Y3BA 3QZCA 1AEPA 1LPEA 2H7VC 2UUHA 4I1OB 4O79A 3GM2A 1HMDA 3JTLO 5L0JA 4E18A 4YL0A 3DE8A 1FFHA 4JKVA 2CNWA 1Q0DA 1YZCA 2PF4E 2R7XA 4AE4A 4LDQA 4NTFA 1RKEB 3C63A 4BEMJ 1T01A 1JMWA 3B71A 2G62A 2HKVA 3MLGA 2WL8A 4K0DA 4YT5A 2WZFA 2XS1A 2L6GA 4CSAA 2AVKA 2KSFA 2ZPAA 2WB7A 3DAFA 4MW3A 3RQFA 4CS8A 1SF8A 1WATA 4E0IA 2V3CC 2LFFA 1HW2A 2P61A 5KYWA 1ZHTA 5A6KA 3S0XA 3V5YA 3FOPA 3BEHA 5JT4A 4CJOA 3JRMO 3M4CA 3US6A 2AU5A 3DD7A 1BZ4A 256BA 1FTSA 3S28A 4G7HF 3S27A 1HE1A 2PNOA 2PBEA 1K40A 2GWWA 3LS0A 2Q9AA 1RCPA 4XPWA 4EWCA 4I1MA 1DOVA 3LNMB 4CS8C 1FMWA 1UFBA 2V26A 4DVZA 2J8WA 2JX0A 4CS7A 4K1OA 2IXMA 4JTAB 1D1AA 3LUTB 2GA0A 2R7OA 1MMNA 1NU7D 4BEJA 1MQVA 1QLEC 3JYHA 1D1BA 4FAPB 4KNWA 3I4UA 3UGPA 1G5ZA 3T6JA 3C18A 3HNIA 4OINF 1DOWA 1E84A 2D5RB 1HE9A 2XL6A 3WG7C 4ANJA 3JSZA 4K7BA 2QY9A 4EKWA 3FAPB 1YA7O 5L0IA 3Q6MA 2EILC 5KYWB 2WVOA 4OIPF 1SMYF 2YZSA 2YHSA 1RKCA 2Q3TA 5DVWA 4C3BA 1QPUA 2XM0A 4A2NB 1T6IA 1VYIA 1EA8A 2R03A 4QDLA 3A9CA 3EQLF 3AOUA 1LS1A 1ZHWA 2B0JA 4XPYA 3QVZA 4QI2A 1RXQA 1IW7F 3RQGA 4BJ6C 1JPJA 4G0HA 1D1CA 3K33A 2J9BA 3TJ5A 3C8ZA 3W4YA 4MTGA 3PMRA 3MYIA 1GQAA 1LVKA 4EIYA 1YZAA 3AG3C 4JJGA 5A6BA 1ZHZA 3NKDA 1O87A 1I5NA 2VC9A 4YK5A 1M2OA 2YEVA 5A6AA 1LM3B 5CIVA 4IAOA 3L8JA 4BG0A 2ETSA 4NY3A 1SR2A 3CQZA 1NG1A 1OCRC 1JOGA 2BL2A 4MVOA 4X0RA 3ATPA 3SXKA 5KYXA 5GPGB 2LFDA 2A68F 3MYFA 2EIKC 2AP3A 2R7VA 3VAYA 2H8AA 4KI2A 5DS4A 2Y39A 2HZ8A 1IZMA 3TULA 2OKUA 1J8YF 1VOMA 1OCOC 3B9QA 4JVSA 2XXAB 4W8KA 3B0UX 4WGZA 2BE5F 4LDKA 2R7QA 4P9FA 2EPNA 3EGDA 3U0CA 1MMGA 2WVQA 3LEVA 4OIOF 3GWNA 1YYXA 3EFOA 1ZVZA 1G4WR 2FGYA 2L7AA 3DMDA 2M4EA 1Q0GA 3NKEA 4JRZA 4NQFA 4IJJA 3A11A 1ZZPA 4XQ1A 5FZTA 3GM3A 1N1CA 1UG7A 2KC3A 3QW1A 1ZHXA 4LACB 3DI5A 4PFPA 5DLJA 1RJ9B 3U5SA 3RQEA 4J32B 3IEEA 1LE4A 5KYXB 3FXHA 1K05A 4LLEA 1D0XA 4XPXA 3KYIA 3L34A 1QZXA 4DJ9A 1E85A 1VTMP 3PHF2 2KYHA 2H7BA 4MTFA 2ZXWC 3RKOF 3KMIA 3UMIA 4Z9JA 1Z5ZA 4HE8D 4FWVA 5HSWA 2KGOA 4JEBA 4IWBA 2R7WA 5L0DA 4N6HA 2NUTA 4XEVA 4YWQA 3EHNA 3W2VA 3FDQA 4CIPA 3O10A 5A69A 4BJ1A 2Y3GA 1E86A 3EG9B 3EZIA 3OA1A 3AQCA 4PJJA 3TJ6A 1S05A 1WTYA 2IOQA 1K04A 1VLSA 2MYSA 3EGXA 2GFHA 3GODA 4JTCB 2EPOA 2YLDA 1R4TA 3GM1A 3T6BA 3UR3C 4CDAA 4CX9A 4E7SA 5KYYA 4DOZA 1TFKB 1PV3A 1QSPA 5COMA 3FMSA 4KC9A 3RIPA 3RVZA 4EBKA 1D0YA 5COGA 3OWTA 4Q7CA 1M2VA 3GANA 1AUEA 2HFIA 2WZGA 3GEEA 4E7ZA 1WWPA 2PFDA 3KYJA 4MW8A 3C7JA 1F1MA 2H7OA 3N0TA 2LP4A 1OCCC 3PCVA 3RW0A 4IB4A 1A7EA 1RMVA 5JUAA 3GORA 1NSGB 3VM6A 1T9KA 1OCZC 4MS2A 1CGNA 2P7VA 3M1CB 5KYUA 2R7UA 2DI3A 3FHDA 3I5QA 4I44A 4CIHA 1BR2A 1OQCA 3S29A 4D4XA 5JS5A 2L6FA 5EK0A 4G7ZF 1R5ID 2Q4FA 4OD4A 2HSQA 2VB6A 3AG1C 3JT1A 4KNVA 3T9OA 4OIRF 3G4XA 1OR3A 3UMHA 4PK4A 4DRJB 2A1DD 4XWJA 4JE9A 1VK5A 1C17M 2FFHA 2IM8A 3ECSA 2HS5A 2XLMA 3H65A 4IGGA 3ZDLA 4E0HA 1ZU4A 3O39A 4CSAC 3RF3A 1ZW2A 4JTDB 1XZPA 5F5HA 1MNEA 1CGOA 3IQ5A 4AE4B 2GDCA 1JR8A 2VCBA 2HV7A 3Q6NA 4C7OA 2LD6A 2NPUA 3T6GB 1Y6DA 3FAJA 2EPKX 1YVIA 3M79A 4AL0A 1T6QA 1WN0A 3B0PA 3EH1A 1V4AA 3QMKA 2KNHA 2OCCC 3GEHA 4N06A 4YT8A 4OIQF 1Q0FA 1WOLA 2A0BA 4MVRA 2R7RA 2TMVP 2VCAA 1T6UA 4P6IC 5L0HA 3EZHA 1LIHA 1NU9C 1QVXA 3HJCA 3KH2A 2XLHA 3QW0A 3DJNB 1ZU5A 4NC3A 5JLIA 2LQGA 2YQYA 3LLKA 4CBEA 2MHRA 1NFNA 2IBFA 2R05A 2X51A 2XLDA 3WODF 1CPQA 2KJGA 1Z23A 2W4BA 3NYMA 3ZC4A 2XLOA 2Y69C 3C8GA 3QVYA 4MVUA 3DWWA 4GQHA 4EBBA 3X2QC 2IXPA 2PP4A 1CGME 3U2LA 3RYLA 3LJBA 4G78A 1NFOA 1TR2A 5L3QA 2G3VA 4J7YA 1LS4A 1U0BB 1Z3IX 3EJNA 1OXBA 3HNKA 3NMJA 4MVMA 3ZQYA 2YWAA 4C3EA 4RDAA 4YT4A 3S90A 1ZW3A 3NYLA 1Z63A 3AG2C 3LESA 1V54C 2XRHA 3R7CA 3K66A 4E17A 2Q00A 4ZLDA 1ZYRF 2AWCA 4JZAA 4KBLA 1H9GA 3AJMA 3IQ6A 4PJMA 1GGQA 3T4RA 2VCCA 4G7OF 4N4WA 4EHPA 3I5PA 2RSEB 3FVYA 5DQTA 3B0VC 2LCHA 3JCUQ 4ZLCA 4MTOA 1E83A 2YL7A 1ZHYA 2P0NA 1BR1A 2CW0F 1M56C 4IARA 3L8IA 3ZG1A 2NUPA 4OD5A 5JSLA 3UMKA 1YARO 3H2VA 2DYRC 2W4MA 2IXNA 2OOCA 3MX3A 5BQIA 2J0WA 4L6RA 3J06A 2Y3HA 4GYTA 2YLIA 2DB4A 5BQHA 3EPVA 2C04A 4DRHB 4JURI 1PCXA 2A6EF 3RH3A 3RVYA 5E3AA 3C8GD 1JPNA 5B1AC 2XLEA 3JYYA 3O55A 3DM9B 4WGYA 4ONSA 3UGOA 4F4BA 2L6HA 1I4ZA 2EIMC 1U6HA 1YJGA 1V55C 2HSBA 3AQBA 4H54A 4MVSA 1QQ3A 3W8IA 3ZQVA 2IXOA 2ZXOA 4EUKB 5F5FA 4JCHA 1EQ1A 1M57C 2ASRA 3DE9A 2NG1A 2I15A 3MBGA 3POVA 3JSEO 2GAQA 3NYJA 3ZTMA 3ZIBA 4R32A 2XL8A 2VH3A 1Z6AA 4U5EE 3SP1A 2ZD9A 2XL4A 4ULWA 1FR0A 3KL4A 4DRIB 2HJ3A 4O6YA 1YAUO 4WJ0A 1PD0A 3V5XA 1MNDA 1XZQA 4MQ9F 3ZTZA 2YL0A 3RFYA 4U5HA 5AGFA 3IQTA 5F28E 2OJED 2P6VA 2YVKA 3JZ0A 3TK0A 2EPMX 4YN0B 3EGDB 3VF0A 4Q4ZF 4DVYP 1EI7A 3NRHA 1BBHA 3NG1A 3EFOB 2F22A 2J9VA 3K1IA 4FESA 3K7DA 3F47A 3G50A 4QI0A 1NBBA 1LI7A 5E2QA 1TWAA 1OKKD 1RKEA 2XLVA 2KK1A 3ABLC 4NTBA 4U9EA 4U9DA 3UNGC 3WAQA 2L81A 4JC7A 2W9YA 2R7TA 2WZLA 5CI9A 5EHHA 4DXWA 4NTAA 4U5GA 5T3WA 5B3SC 1G8XA 3CEXA 1ORYA 2J0XA 2XLWA 3S9OA 2HMQA 4YL1A 1Z7Qc 4O6NA 2J45A 4NCQA 3BRJA 4HFFB 4MVZA 3SYNA 4WABA 4XLNF 1KTMA 4O7GA 1L7CA 2NUTB 3ABMC 2WVNA 3O6XA 4MNDA 1A7DA 4D4NA 4DBQA 1TKNA 3LEOA 2YL1A 4M63A 1YDIA 3LAYA 3SEOA 4I3MA 4RBNA 5DQZA 2LSEA 3K1HA 5JVEA 1U89A 3E70C 2R02A 1MMDA 2G3KA 2J9UA 1AVOB 1OW8A 3EGXB 1CPRA 3GEIA 1HW1A 3H2UA 2X0CA 4YT2A 5EGYA 2J46A 5KYYB 3GWLA 3U8PA 1M6TA 4CJGA 4IRUA 2A69F 2CGEA 4GEHA 1H6GA 2YLGA 2PX0A 1LI5A 2LK4A 5BUOA 3NMKA 3L0IA 1M2VB 1WGWA 2NSFA 5FCLA 3W8HA 5JRAA 3AG4C 3G4ZA 3AGUA 2DYSC 2ICWG 4LDRA 1JAFA 4BJ5A 4Z9IA 3SZRA 3KPHA 1OW7A 2R9RB 3IHUA 3SXYA 3FOOA 5DS6A 5T1DB 2NSGA 3AGTA 2OQMA 3U2MA 2HUJA 2EPLX 3QTHA 5KYUB 1HY5A 4HFKB 2J9WA 5A6JA 1ST6A 2FAPB 1G4US 1YA9A 3DKAA 4JCZA 4LERA 3VRCA 2R7SA 1S7ZA 3U9JA 2EINC 2IYLD 4A4AA 1V74B 4PR9A 3U9MA 4IAQA 2J7PD 4CDVA 1VLTA 2EIJC 2OU6A 4W8PA 1H9TA 2CDQA 1YLMA 3KKBA 4BJ5C 1LE2A 1Q0MA 2B0HA 3EHMA 1OW6A 4N6CA 2HJMA 3TOLA 4AL1A 1TWCA 1FNTc 5COFA 5B1BC 1FFTC 2KW3C 2L9JA 4BJ6A 2XM4A 3Q7GA 1A0BA 3B29A 5T3TA 4LLCA 2OEXA 2P1AA 4XEKA 2CNWD 2PX3A 2ZXPA 4C7OB 3ZVRA 2Q9BA 1OXKA 1MMAA 3LS1A 4AK9A 3ABKC 3K6BA 4BJTA 4BPMA 5K0IA 3Q7LA 1FAPB 1C03A 3U3FA 5DS5A 5IY5C 4YJWA 4XEFA 1GM5A 1H7IA 3PDMP 3NMIA 3HLZA 5L0GA 3ZSUA 1LKXA 1D0ZA 2R25A 4U5BE 5CI8A 2XXAA 5BQGA 1Q0KA 3TOMA 1JRAA 3LLIA 1QKRA 1EKYA 2CYDA 4YL3A 3W2WA 2QUPA 3EH2A 1KNYA 4P9TA 1BR4A 5L0FA 1C02A 1SZIA 1I4YA 1FMVA 1L3PA 1VMAA 1W2WA 1A41A 4PFOA 2KQ9A 2A0UA 2Q9CA 2JPUA 3N24A 2AWYA 3ITFA 4O6MA 3C8GB 1OKKA 1KU2A 3IQCA 1PD1A 2XSEA 3X1OA 1VYKA 1ORJA 3HTKC 1BDJB 1GS9A 1HMOA 4J7TA 2A6HF 2ZXRA 2W45A 4PACA 2HV6A 2QLAA 4J30B
chains in the Genus database with same CATH topology
1E84A 2XL6A 5JS5A 1BBHA 4D4XA 1NBBA 2CCYA 1QPUA 2XM0A 4JE9A 2XLVA 2XLMA 4U9EA 4U9DA 3QVZA 4JEAA 3M15A 2J9BA 2BC5A 2YKZA 3L1MA 1CGOA 3IQ5A 1GQAA 2YL3A 4EIYA 1YZAA 2XLWA 4CDYA 1A7VA 3M79A 4ER9A 1LM3B 3ZWIA 4D4NA 2YL1A 3M4BA 4NC3A 3QW0A 1YYJA 2XLHA 5JLIA 5JVEA 2XLDA 1CPQA 1CPRA 2XLOA 4ULVA 3U8PA 3HNJA 1M6TA 3QVYA 4CJGA 2YLGA 3HNLA 3NMKA 4WGZA 5JRAA 5B3IA 3HNKA 3NMJA 5JP7A 1YYXA 3ZQYA 1APCA 1JAFA 3C62A 3FOOA 3IQ6A 3QW1A 4N4WA 3DE8A 4JKVA 1YZCA 4IAQA 4CDVA 1E83A 1E85A 2YL7A 3C63A 4IARA 5JSLA 3TOLA 4JEBA 4L6RA 4N6HA 2XM4A 2YLIA 4CIPA 1E86A 5AGFA 3FOPA 5JT4A 1S05A 2XLEA 4CJOA 3M4CA 2YLDA 4WGYA 3NMIA 256BA 4CDAA 4CX9A 3ZQVA 1QQ3A 3TOMA 1RCPA 1EKYA 3DE9A 2J8WA 3ZTMA 1CGNA 2XL8A 3VRCA 1MQVA 4IB4A 5JUAA 3ZTZA 2YL0A 2QLAA 3HNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E84 A;  2XL6 A;  5JS5 A;  1BBH A;  4D4X A;  1NBB A;  2CCY A;  1QPU A;  2XM0 A;  4JE9 A;  2XLV A;  2XLM A;  4U9E A;  4U9D A;  3QVZ A;  4JEA A;  3M15 A;  2J9B A;  2BC5 A;  2YKZ A;  3L1M A;  1CGO A;  3IQ5 A;  1GQA A;  2YL3 A;  4EIY A;  1YZA A;  2XLW A;  4CDY A;  1A7V A;  3M79 A;  4ER9 A;  1LM3 B;  3ZWI A;  4D4N A;  2YL1 A;  3M4B A;  4NC3 A;  3QW0 A;  1YYJ A;  2XLH A;  5JLI A;  5JVE A;  2XLD A;  1CPQ A;  1CPR A;  2XLO A;  4ULV A;  3U8P A;  3HNJ A;  1M6T A;  3QVY A;  4CJG A;  2YLG A;  3HNL A;  3NMK A;  4WGZ A;  5JRA A;  5B3I A;  3HNK A;  3NMJ A;  5JP7 A;  1YYX A;  3ZQY A;  1APC A;  1JAF A;  3C62 A;  3FOO A;  3IQ6 A;  3QW1 A;  4N4W A;  3DE8 A;  4JKV A;  1YZC A;  4IAQ A;  4CDV A;  1E83 A;  1E85 A;  2YL7 A;  3C63 A;  4IAR A;  5JSL A;  3TOL A;  4JEB A;  4L6R A;  4N6H A;  2XM4 A;  2YLI A;  4CIP A;  1E86 A;  5AGF A;  3FOP A;  5JT4 A;  1S05 A;  2XLE A;  4CJO A;  3M4C A;  2YLD A;  4WGY A;  3NMI A;  256B A;  4CDA A;  4CX9 A;  3ZQV A;  1QQ3 A;  3TOM A;  1RCP A;  1EKY A;  3DE9 A;  2J8W A;  3ZTM A;  1CGN A;  2XL8 A;  3VRC A;  1MQV A;  4IB4 A;  5JUA A;  3ZTZ A;  2YL0 A;  2QLA A;  3HNI A; 
#chains in the Genus database with same CATH topology
 1J8M F;  1XWJ A;  2UUI A;  4PJL A;  3WHN A;  1RJ9 A;  2OEV A;  1TFO B;  3ASN C;  5L3V A;  2O9X A;  5HV9 A;  4PJN A;  4CS9 A;  2MWQ A;  2QE9 A;  2RD9 A;  4Q5S F;  5E33 A;  1OR2 A;  2CCY A;  1O5H A;  1TWG A;  1TQG A;  2QNL A;  2Z15 A;  4U5F E;  4B6I A;  3S84 A;  2QTV A;  4H4K C;  4U5D E;  2C03 A;  3TD7 A;  3HKK A;  5KYN A;  3V5Z A;  3TQO A;  3ASO C;  2E87 A;  4JEA A;  2Q7R A;  2YRF A;  3M15 A;  3SXZ A;  5D91 A;  4XTK A;  1ORS C;  2BC5 A;  2YKZ A;  3L1M A;  2D4U A;  2HMZ A;  3R2P A;  3IPM O;  4JIO A;  2YL3 A;  3E9V A;  4C3D A;  4CDY A;  1WAS A;  1SYQ A;  3EG9 A;  2M64 A;  4CS9 C;  1A7V A;  3VYW A;  1B68 A;  2Y3D A;  2NUP B;  1E2X A;  3F46 A;  4ER9 A;  3U3B A;  3V7O A;  3NDB B;  3DJU B;  4JW1 A;  1Y4C A;  2OJQ A;  4MVQ A;  5D92 A;  2LIG A;  4JJF A;  3ZWI A;  4DBR A;  3M4B A;  1TWH A;  3LNR A;  2VAS A;  4U5C E;  1YYJ A;  3DXJ F;  2JD3 A;  1NZE A;  4Z9H A;  5A6B D;  3N2Z B;  5E3C A;  3MFN A;  3SNH A;  4EBJ A;  5L0C A;  4AX2 A;  2XS8 A;  3JRT A;  4FX5 A;  4ULV A;  3SXM A;  1O3U A;  3HNJ A;  1T5O A;  3CSK A;  1VB5 A;  3OEO A;  4XLP F;  3U8V A;  2I8B A;  3HNL A;  3DZA A;  5AC5 A;  5B3I A;  3DM5 A;  4UDV A;  5JP7 A;  2DGJ A;  2OG2 A;  2J7P A;  3CAX A;  3K1I C;  5TJ5 E;  1APC A;  5AC4 A;  3CZ6 A;  3DAG A;  1NLX A;  4HEA J;  3C62 A;  4RD9 A;  2Y3B A;  3QZC A;  1AEP A;  1LPE A;  2H7V C;  2UUH A;  4I1O B;  4O79 A;  3GM2 A;  1HMD A;  3JTL O;  5L0J A;  4E18 A;  4YL0 A;  3DE8 A;  1FFH A;  4JKV A;  2CNW A;  1Q0D A;  1YZC A;  2PF4 E;  2R7X A;  4AE4 A;  4LDQ A;  4NTF A;  1RKE B;  3C63 A;  4BEM J;  1T01 A;  1JMW A;  3B71 A;  2G62 A;  2HKV A;  3MLG A;  2WL8 A;  4K0D A;  4YT5 A;  2WZF A;  2XS1 A;  2L6G A;  4CSA A;  2AVK A;  2KSF A;  2ZPA A;  2WB7 A;  3DAF A;  4MW3 A;  3RQF A;  4CS8 A;  1SF8 A;  1WAT A;  4E0I A;  2V3C C;  2LFF A;  1HW2 A;  2P61 A;  5KYW A;  1ZHT A;  5A6K A;  3S0X A;  3V5Y A;  3FOP A;  3BEH A;  5JT4 A;  4CJO A;  3JRM O;  3M4C A;  3US6 A;  2AU5 A;  3DD7 A;  1BZ4 A;  256B A;  1FTS A;  3S28 A;  4G7H F;  3S27 A;  1HE1 A;  2PNO A;  2PBE A;  1K40 A;  2GWW A;  3LS0 A;  2Q9A A;  1RCP A;  4XPW A;  4EWC A;  4I1M A;  1DOV A;  3LNM B;  4CS8 C;  1FMW A;  1UFB A;  2V26 A;  4DVZ A;  2J8W A;  2JX0 A;  4CS7 A;  4K1O A;  2IXM A;  4JTA B;  1D1A A;  3LUT B;  2GA0 A;  2R7O A;  1MMN A;  1NU7 D;  4BEJ A;  1MQV A;  1QLE C;  3JYH A;  1D1B A;  4FAP B;  4KNW A;  3I4U A;  3UGP A;  1G5Z A;  3T6J A;  3C18 A;  3HNI A;  4OIN F;  1DOW A;  1E84 A;  2D5R B;  1HE9 A;  2XL6 A;  3WG7 C;  4ANJ A;  3JSZ A;  4K7B A;  2QY9 A;  4EKW A;  3FAP B;  1YA7 O;  5L0I A;  3Q6M A;  2EIL C;  5KYW B;  2WVO A;  4OIP F;  1SMY F;  2YZS A;  2YHS A;  1RKC A;  2Q3T A;  5DVW A;  4C3B A;  1QPU A;  2XM0 A;  4A2N B;  1T6I A;  1VYI A;  1EA8 A;  2R03 A;  4QDL A;  3A9C A;  3EQL F;  3AOU A;  1LS1 A;  1ZHW A;  2B0J A;  4XPY A;  3QVZ A;  4QI2 A;  1RXQ A;  1IW7 F;  3RQG A;  4BJ6 C;  1JPJ A;  4G0H A;  1D1C A;  3K33 A;  2J9B A;  3TJ5 A;  3C8Z A;  3W4Y A;  4MTG A;  3PMR A;  3MYI A;  1GQA A;  1LVK A;  4EIY A;  1YZA A;  3AG3 C;  4JJG A;  5A6B A;  1ZHZ A;  3NKD A;  1O87 A;  1I5N A;  2VC9 A;  4YK5 A;  1M2O A;  2YEV A;  5A6A A;  1LM3 B;  5CIV A;  4IAO A;  3L8J A;  4BG0 A;  2ETS A;  4NY3 A;  1SR2 A;  3CQZ A;  1NG1 A;  1OCR C;  1JOG A;  2BL2 A;  4MVO A;  4X0R A;  3ATP A;  3SXK A;  5KYX A;  5GPG B;  2LFD A;  2A68 F;  3MYF A;  2EIK C;  2AP3 A;  2R7V A;  3VAY A;  2H8A A;  4KI2 A;  5DS4 A;  2Y39 A;  2HZ8 A;  1IZM A;  3TUL A;  2OKU A;  1J8Y F;  1VOM A;  1OCO C;  3B9Q A;  4JVS A;  2XXA B;  4W8K A;  3B0U X;  4WGZ A;  2BE5 F;  4LDK A;  2R7Q A;  4P9F A;  2EPN A;  3EGD A;  3U0C A;  1MMG A;  2WVQ A;  3LEV A;  4OIO F;  3GWN A;  1YYX A;  3EFO A;  1ZVZ A;  1G4W R;  2FGY A;  2L7A A;  3DMD A;  2M4E A;  1Q0G A;  3NKE A;  4JRZ A;  4NQF A;  4IJJ A;  3A11 A;  1ZZP A;  4XQ1 A;  5FZT A;  3GM3 A;  1N1C A;  1UG7 A;  2KC3 A;  3QW1 A;  1ZHX A;  4LAC B;  3DI5 A;  4PFP A;  5DLJ A;  1RJ9 B;  3U5S A;  3RQE A;  4J32 B;  3IEE A;  1LE4 A;  5KYX B;  3FXH A;  1K05 A;  4LLE A;  1D0X A;  4XPX A;  3KYI A;  3L34 A;  1QZX A;  4DJ9 A;  1E85 A;  1VTM P;  3PHF 2;  2KYH A;  2H7B A;  4MTF A;  2ZXW C;  3RKO F;  3KMI A;  3UMI A;  4Z9J A;  1Z5Z A;  4HE8 D;  4FWV A;  5HSW A;  2KGO A;  4JEB A;  4IWB A;  2R7W A;  5L0D A;  4N6H A;  2NUT A;  4XEV A;  4YWQ A;  3EHN A;  3W2V A;  3FDQ A;  4CIP A;  3O10 A;  5A69 A;  4BJ1 A;  2Y3G A;  1E86 A;  3EG9 B;  3EZI A;  3OA1 A;  3AQC A;  4PJJ A;  3TJ6 A;  1S05 A;  1WTY A;  2IOQ A;  1K04 A;  1VLS A;  2MYS A;  3EGX A;  2GFH A;  3GOD A;  4JTC B;  2EPO A;  2YLD A;  1R4T A;  3GM1 A;  3T6B A;  3UR3 C;  4CDA A;  4CX9 A;  4E7S A;  5KYY A;  4DOZ A;  1TFK B;  1PV3 A;  1QSP A;  5COM A;  3FMS A;  4KC9 A;  3RIP A;  3RVZ A;  4EBK A;  1D0Y A;  5COG A;  3OWT A;  4Q7C A;  1M2V A;  3GAN A;  1AUE A;  2HFI A;  2WZG A;  3GEE A;  4E7Z A;  1WWP A;  2PFD A;  3KYJ A;  4MW8 A;  3C7J A;  1F1M A;  2H7O A;  3N0T A;  2LP4 A;  1OCC C;  3PCV A;  3RW0 A;  4IB4 A;  1A7E A;  1RMV A;  5JUA A;  3GOR A;  1NSG B;  3VM6 A;  1T9K A;  1OCZ C;  4MS2 A;  1CGN A;  2P7V A;  3M1C B;  5KYU A;  2R7U A;  2DI3 A;  3FHD A;  3I5Q A;  4I44 A;  4CIH A;  1BR2 A;  1OQC A;  3S29 A;  4D4X A;  5JS5 A;  2L6F A;  5EK0 A;  4G7Z F;  1R5I D;  2Q4F A;  4OD4 A;  2HSQ A;  2VB6 A;  3AG1 C;  3JT1 A;  4KNV A;  3T9O A;  4OIR F;  3G4X A;  1OR3 A;  3UMH A;  4PK4 A;  4DRJ B;  2A1D D;  4XWJ A;  4JE9 A;  1VK5 A;  1C17 M;  2FFH A;  2IM8 A;  3ECS A;  2HS5 A;  2XLM A;  3H65 A;  4IGG A;  3ZDL A;  4E0H A;  1ZU4 A;  3O39 A;  4CSA C;  3RF3 A;  1ZW2 A;  4JTD B;  1XZP A;  5F5H A;  1MNE A;  1CGO A;  3IQ5 A;  4AE4 B;  2GDC A;  1JR8 A;  2VCB A;  2HV7 A;  3Q6N A;  4C7O A;  2LD6 A;  2NPU A;  3T6G B;  1Y6D A;  3FAJ A;  2EPK X;  1YVI A;  3M79 A;  4AL0 A;  1T6Q A;  1WN0 A;  3B0P A;  3EH1 A;  1V4A A;  3QMK A;  2KNH A;  2OCC C;  3GEH A;  4N06 A;  4YT8 A;  4OIQ F;  1Q0F A;  1WOL A;  2A0B A;  4MVR A;  2R7R A;  2TMV P;  2VCA A;  1T6U A;  4P6I C;  5L0H A;  3EZH A;  1LIH A;  1NU9 C;  1QVX A;  3HJC A;  3KH2 A;  2XLH A;  3QW0 A;  3DJN B;  1ZU5 A;  4NC3 A;  5JLI A;  2LQG A;  2YQY A;  3LLK A;  4CBE A;  2MHR A;  1NFN A;  2IBF A;  2R05 A;  2X51 A;  2XLD A;  3WOD F;  1CPQ A;  2KJG A;  1Z23 A;  2W4B A;  3NYM A;  3ZC4 A;  2XLO A;  2Y69 C;  3C8G A;  3QVY A;  4MVU A;  3DWW A;  4GQH A;  4EBB A;  3X2Q C;  2IXP A;  2PP4 A;  1CGM E;  3U2L A;  3RYL A;  3LJB A;  4G78 A;  1NFO A;  1TR2 A;  5L3Q A;  2G3V A;  4J7Y A;  1LS4 A;  1U0B B;  1Z3I X;  3EJN A;  1OXB A;  3HNK A;  3NMJ A;  4MVM A;  3ZQY A;  2YWA A;  4C3E A;  4RDA A;  4YT4 A;  3S90 A;  1ZW3 A;  3NYL A;  1Z63 A;  3AG2 C;  3LES A;  1V54 C;  2XRH A;  3R7C A;  3K66 A;  4E17 A;  2Q00 A;  4ZLD A;  1ZYR F;  2AWC A;  4JZA A;  4KBL A;  1H9G A;  3AJM A;  3IQ6 A;  4PJM A;  1GGQ A;  3T4R A;  2VCC A;  4G7O F;  4N4W A;  4EHP A;  3I5P A;  2RSE B;  3FVY A;  5DQT A;  3B0V C;  2LCH A;  3JCU Q;  4ZLC A;  4MTO A;  1E83 A;  2YL7 A;  1ZHY A;  2P0N A;  1BR1 A;  2CW0 F;  1M56 C;  4IAR A;  3L8I A;  3ZG1 A;  2NUP A;  4OD5 A;  5JSL A;  3UMK A;  1YAR O;  3H2V A;  2DYR C;  2W4M A;  2IXN A;  2OOC A;  3MX3 A;  5BQI A;  2J0W A;  4L6R A;  3J06 A;  2Y3H A;  4GYT A;  2YLI A;  2DB4 A;  5BQH A;  3EPV A;  2C04 A;  4DRH B;  4JUR I;  1PCX A;  2A6E F;  3RH3 A;  3RVY A;  5E3A A;  3C8G D;  1JPN A;  5B1A C;  2XLE A;  3JYY A;  3O55 A;  3DM9 B;  4WGY A;  4ONS A;  3UGO A;  4F4B A;  2L6H A;  1I4Z A;  2EIM C;  1U6H A;  1YJG A;  1V55 C;  2HSB A;  3AQB A;  4H54 A;  4MVS A;  1QQ3 A;  3W8I A;  3ZQV A;  2IXO A;  2ZXO A;  4EUK B;  5F5F A;  4JCH A;  1EQ1 A;  1M57 C;  2ASR A;  3DE9 A;  2NG1 A;  2I15 A;  3MBG A;  3POV A;  3JSE O;  2GAQ A;  3NYJ A;  3ZTM A;  3ZIB A;  4R32 A;  2XL8 A;  2VH3 A;  1Z6A A;  4U5E E;  3SP1 A;  2ZD9 A;  2XL4 A;  4ULW A;  1FR0 A;  3KL4 A;  4DRI B;  2HJ3 A;  4O6Y A;  1YAU O;  4WJ0 A;  1PD0 A;  3V5X A;  1MND A;  1XZQ A;  4MQ9 F;  3ZTZ A;  2YL0 A;  3RFY A;  4U5H A;  5AGF A;  3IQT A;  5F28 E;  2OJE D;  2P6V A;  2YVK A;  3JZ0 A;  3TK0 A;  2EPM X;  4YN0 B;  3EGD B;  3VF0 A;  4Q4Z F;  4DVY P;  1EI7 A;  3NRH A;  1BBH A;  3NG1 A;  3EFO B;  2F22 A;  2J9V A;  3K1I A;  4FES A;  3K7D A;  3F47 A;  3G50 A;  4QI0 A;  1NBB A;  1LI7 A;  5E2Q A;  1TWA A;  1OKK D;  1RKE A;  2XLV A;  2KK1 A;  3ABL C;  4NTB A;  4U9E A;  4U9D A;  3UNG C;  3WAQ A;  2L81 A;  4JC7 A;  2W9Y A;  2R7T A;  2WZL A;  5CI9 A;  5EHH A;  4DXW A;  4NTA A;  4U5G A;  5T3W A;  5B3S C;  1G8X A;  3CEX A;  1ORY A;  2J0X A;  2XLW A;  3S9O A;  2HMQ A;  4YL1 A;  1Z7Q c;  4O6N A;  2J45 A;  4NCQ A;  3BRJ A;  4HFF B;  4MVZ A;  3SYN A;  4WAB A;  4XLN F;  1KTM A;  4O7G A;  1L7C A;  2NUT B;  3ABM C;  2WVN A;  3O6X A;  4MND A;  1A7D A;  4D4N A;  4DBQ A;  1TKN A;  3LEO A;  2YL1 A;  4M63 A;  1YDI A;  3LAY A;  3SEO A;  4I3M A;  4RBN A;  5DQZ A;  2LSE A;  3K1H A;  5JVE A;  1U89 A;  3E70 C;  2R02 A;  1MMD A;  2G3K A;  2J9U A;  1AVO B;  1OW8 A;  3EGX B;  1CPR A;  3GEI A;  1HW1 A;  3H2U A;  2X0C A;  4YT2 A;  5EGY A;  2J46 A;  5KYY B;  3GWL A;  3U8P A;  1M6T A;  4CJG A;  4IRU A;  2A69 F;  2CGE A;  4GEH A;  1H6G A;  2YLG A;  2PX0 A;  1LI5 A;  2LK4 A;  5BUO A;  3NMK A;  3L0I A;  1M2V B;  1WGW A;  2NSF A;  5FCL A;  3W8H A;  5JRA A;  3AG4 C;  3G4Z A;  3AGU A;  2DYS C;  2ICW G;  4LDR A;  1JAF A;  4BJ5 A;  4Z9I A;  3SZR A;  3KPH A;  1OW7 A;  2R9R B;  3IHU A;  3SXY A;  3FOO A;  5DS6 A;  5T1D B;  2NSG A;  3AGT A;  2OQM A;  3U2M A;  2HUJ A;  2EPL X;  3QTH A;  5KYU B;  1HY5 A;  4HFK B;  2J9W A;  5A6J A;  1ST6 A;  2FAP B;  1G4U S;  1YA9 A;  3DKA A;  4JCZ A;  4LER A;  3VRC A;  2R7S A;  1S7Z A;  3U9J A;  2EIN C;  2IYL D;  4A4A A;  1V74 B;  4PR9 A;  3U9M A;  4IAQ A;  2J7P D;  4CDV A;  1VLT A;  2EIJ C;  2OU6 A;  4W8P A;  1H9T A;  2CDQ A;  1YLM A;  3KKB A;  4BJ5 C;  1LE2 A;  1Q0M A;  2B0H A;  3EHM A;  1OW6 A;  4N6C A;  2HJM A;  3TOL A;  4AL1 A;  1TWC A;  1FNT c;  5COF A;  5B1B C;  1FFT C;  2KW3 C;  2L9J A;  4BJ6 A;  2XM4 A;  3Q7G A;  1A0B A;  3B29 A;  5T3T A;  4LLC A;  2OEX A;  2P1A A;  4XEK A;  2CNW D;  2PX3 A;  2ZXP A;  4C7O B;  3ZVR A;  2Q9B A;  1OXK A;  1MMA A;  3LS1 A;  4AK9 A;  3ABK C;  3K6B A;  4BJT A;  4BPM A;  5K0I A;  3Q7L A;  1FAP B;  1C03 A;  3U3F A;  5DS5 A;  5IY5 C;  4YJW A;  4XEF A;  1GM5 A;  1H7I A;  3PDM P;  3NMI A;  3HLZ A;  5L0G A;  3ZSU A;  1LKX A;  1D0Z A;  2R25 A;  4U5B E;  5CI8 A;  2XXA A;  5BQG A;  1Q0K A;  3TOM A;  1JRA A;  3LLI A;  1QKR A;  1EKY A;  2CYD A;  4YL3 A;  3W2W A;  2QUP A;  3EH2 A;  1KNY A;  4P9T A;  1BR4 A;  5L0F A;  1C02 A;  1SZI A;  1I4Y A;  1FMV A;  1L3P A;  1VMA A;  1W2W A;  1A41 A;  4PFO A;  2KQ9 A;  2A0U A;  2Q9C A;  2JPU A;  3N24 A;  2AWY A;  3ITF A;  4O6M A;  3C8G B;  1OKK A;  1KU2 A;  3IQC A;  1PD1 A;  2XSE A;  3X1O A;  1VYK A;  1ORJ A;  3HTK C;  1BDJ B;  1GS9 A;  1HMO A;  4J7T A;  2A6H F;  2ZXR A;  2W45 A;  4PAC A;  2HV6 A;  2QLA A;  4J30 B; 
#chains in the Genus database with same CATH homology
 1E84 A;  2XL6 A;  5JS5 A;  1BBH A;  4D4X A;  1NBB A;  2CCY A;  1QPU A;  2XM0 A;  4JE9 A;  2XLV A;  2XLM A;  4U9E A;  4U9D A;  3QVZ A;  4JEA A;  3M15 A;  2J9B A;  2BC5 A;  2YKZ A;  3L1M A;  1CGO A;  3IQ5 A;  1GQA A;  2YL3 A;  4EIY A;  1YZA A;  2XLW A;  4CDY A;  1A7V A;  3M79 A;  4ER9 A;  1LM3 B;  3ZWI A;  4D4N A;  2YL1 A;  3M4B A;  4NC3 A;  3QW0 A;  1YYJ A;  2XLH A;  5JLI A;  5JVE A;  2XLD A;  1CPQ A;  1CPR A;  2XLO A;  4ULV A;  3U8P A;  3HNJ A;  1M6T A;  3QVY A;  4CJG A;  2YLG A;  3HNL A;  3NMK A;  4WGZ A;  5JRA A;  5B3I A;  3HNK A;  3NMJ A;  5JP7 A;  1YYX A;  3ZQY A;  1APC A;  1JAF A;  3C62 A;  3FOO A;  3IQ6 A;  3QW1 A;  4N4W A;  3DE8 A;  4JKV A;  1YZC A;  4IAQ A;  4CDV A;  1E83 A;  1E85 A;  2YL7 A;  3C63 A;  4IAR A;  5JSL A;  3TOL A;  4JEB A;  4L6R A;  4N6H A;  2XM4 A;  2YLI A;  4CIP A;  1E86 A;  5AGF A;  3FOP A;  5JT4 A;  1S05 A;  2XLE A;  4CJO A;  3M4C A;  2YLD A;  4WGY A;  3NMI A;  256B A;  4CDA A;  4CX9 A;  3ZQV A;  1QQ3 A;  3TOM A;  1RCP A;  1EKY A;  3DE9 A;  2J8W A;  3ZTM A;  1CGN A;  2XL8 A;  3VRC A;  1MQV A;  4IB4 A;  5JUA A;  3ZTZ A;  2YL0 A;  2QLA A;  3HNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...