4ER9A

Crystal structure of cytochrome b562 from salmonella enterica subsp. enterica serovar typhimurium str. 14028s
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
105
structure length
105
Chain Sequence
ADLEDNMDILNDNLKVVEKTDSAPELKAALTKMRAAALDAQKATPPKLEDKAPDSPEMKDFRHGFDILVGQIDGALKLANEGNVKEAKAAAEALKTTRNTYHKKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Crystal structure of cytochrome b562 from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Electron transport
total genus 45
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2012-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4er9A00
3HNLA 3NMIA 2YLDA 3FOPA 4JEBA 1M6TA 2CCYA 3NMKA 1CPRA 4U9DA 3HNKA 1LM3B 2XM0A 3TOLA 4WGZA 1E85A 1YYXA 4NC3A 1GQAA 3M4BA 1CGOA 2XLHA 4EIYA 4CJGA 2XLMA 4CIPA 4N4WA 3ZQYA 5AGFA 5JSLA 4JKVA 3HNJA 5JUAA 3QVZA 1QQ3A 3C63A 1S05A 1YZCA 5JRAA 3IQ6A 4CJOA 3TOMA 1BBHA 4CDVA 3C62A 3HNIA 3ZTMA 3ZWIA 3FOOA 1E84A 1CPQA 3ZQVA 1QPUA 2J9BA 5JS5A 4D4NA 1E83A 2XL6A 2YL7A 2YKZA 5JVEA 2QLAA 4JE9A 5JP7A 3QW1A 5B3IA 5JLIA 3L1MA 4CX9A 3ZTZA 3IQ5A 4N6HA 2XLOA 4WGYA 1EKYA 1APCA 3VRCA 2YLGA 2XLWA 4JEAA 3M4CA 3QVYA 2YLIA 4IAQA 3QW0A 1MQVA 4IARA 1RCPA 3U8PA 1NBBA 2XL8A 1JAFA 1A7VA 2XLVA 4CDAA 4L6RA 1YYJA 3DE9A 256BA 4ULVA 1E86A 5JT4A 3NMJA 2BC5A 2XLEA 1CGNA 4U9EA 1YZAA 4D4XA 2XM4A 2J8WA 3DE8A 4IB4A 3M15A 2XLDA 2YL0A 3M79A 4CDYA 4ER9A 2YL3A 2YL1A
chains in the Genus database with same CATH superfamily
3HNLA 3TJ6A 4CS8C 1VK5A 2PBEA 5KYUA 4N6CA 4H4KC 4OIOF 1JR8A 2YLDA 1HE1A 2Y3BA 4MVQA 2MYSA 4JEBA 2HV7A 3EH1A 2OJQA 3EHMA 5KYXA 4Q7CA 1FNTc 2R05A 3TOLA 2OU6A 2XSEA 4NTBA 1H9GA 1MNDA 2TMVP 2WB7A 2OOCA 2EPLX 3SXYA 4CS9C 1NG1A 2LP4A 2UUHA 3AOUA 5T3TA 3NYMA 2H7VC 1K40A 3WG7C 4CJGA 3MYFA 3T6JA 5HSWA 1I5NA 2A1DD 2F22A 4IRUA 4C3BA 3GWLA 2IXMA 4MQ9F 4OD5A 4GEHA 1OCCC 3SXKA 3ABLC 4E0IA 1KTMA 1T9KA 3EPVA 3GEHA 5JUAA 3QVZA 1Z3IX 2NUTB 4BEMJ 5EHHA 3ASOC 2PFDA 5T3WA 3MFNA 1HW2A 4KI2A 3C8GB 3ZC4A 3RQFA 1BR1A 3LUTB 4GYTA 5EK0A 1L7CA 3M1CB 1AEPA 4N06A 4CDVA 5BQIA 1OQCA 3MLGA 4PJLA 1ST6A 4XLPF 3ZWIA 2J9UA 2FGYA 2QNLA 1M57C 1LIHA 4MNDA 2KJGA 3WODF 1CPQA 3AG3C 5L0CA 3OA1A 3B29A 4XEVA 3I5QA 1RJ9A 4PFPA 4AE4A 2A6HF 4RD9A 3LEOA 1FAPB 1T6QA 2OQMA 3B71A 1OKKA 2W9YA 1LE2A 2HV6A 2YL7A 4MTFA 5DQZA 3GODA 1IZMA 1WN0A 3NYJA 3AG1C 4K1OA 2QLAA 1LS4A 1D0XA 2VH3A 4BPMA 4JE9A 1TWCA 3PHF2 2XXAB 3LJBA 2EINC 4YT8A 3ABMC 3RVYA 3MX3A 4MS2A 1A0BA 4XPXA 4YK5A 4WGYA 4NTFA 5K0IA 1YARO 1J8YF 1HMDA 2RD9A 5T1DB 2R7WA 1R5ID 4JEAA 1WWPA 1HW1A 1Q0MA 5L0IA 4I3MA 1H9TA 1D0ZA 3FMSA 5FCLA 1Q0FA 1SF8A 4YL1A 1MQVA 1LPEA 1NU9C 5COFA 2JD3A 5HV9A 1U0BB 4IARA 1C03A 1ZHWA 1G8XA 3ITFA 2HKVA 1RCPA 1H6GA 3RVZA 2KGOA 2XL8A 1OW8A 1SZIA 4DOZA 4W8KA 3TQOA 5L3QA 3EFOB 1A7VA 3S84A 1H7IA 1GM5A 2LSEA 4FWVA 4XQ1A 2OCCC 2XL4A 3DWWA 4L6RA 4LDQA 3BEHA 1QSPA 1YYJA 2DYSC 3E70C 4XLNF 4AL0A 2AWCA 2PX3A 1Z6AA 2L6FA 3ABKC 2IXOA 1R4TA 2HMZA 3O6XA 1I4ZA 4ULVA 4NY3A 2WZGA 1E86A 3NMJA 3EGXB 5KYWB 2BC5A 2M4EA 1V54C 2PX0A 3RFYA 4OIQF 4CBEA 1EQ1A 3AG4C 3S0XA 1T6IA 1ZU4A 2NUTA 3POVA 3IEEA 4G7ZF 3RQEA 4BJTA 4ER9A 3C8GA 3DMDA 2LFDA 2YL3A 1NU7D 3PMRA 3I4UA 5D92A 2LFFA 3B9QA 4KNVA 4C7OB 2ZXOA 3SEOA 4ZLDA 1ZU5A 3FOPA 2HJMA 1ZHXA 4C3EA 2OEVA 2P0NA 3ZSUA 1ZW2A 2MHRA 3A9CA 2CCYA 3JZ0A 3L8IA 4EBKA 4U9DA 1EI7A 4O79A 1J8MF 1U6HA 3UMIA 2QTVA 4EWCA 1OXBA 2OEXA 2QY9A 4DVZA 1C17M 1E85A 2VCCA 3JYYA 4OIPF 5F5FA 1VOMA 2Z15A 4U5EE 3DI5A 4DJ9A 4EIYA 4GQHA 2Q9AA 2XLMA 1EA8A 2J0WA 3ZQYA 2IBFA 1ORSC 3EH2A 5AGFA 4YN0B 1FMWA 2VASA 3LNRA 5JSLA 3HNJA 2OJED 4XPWA 4JCZA 1YAUO 4MVSA 2Q9BA 2R7RA 2H8AA 4KNWA 4QDLA 3SP1A 3VAYA 1LVKA 4CSAA 4K7BA 3C63A 3EZHA 1S05A 3G50A 4HEAJ 3QMKA 1Y4CA 3V7OA 2KYHA 1D1CA 5TJ5E 2UUIA 1A7DA 3GORA 2R7VA 1OKKD 1SMYF 5D91A 4F4BA 1RKEB 2WL8A 2DI3A 2H7OA 4LDRA 3C62A 4BJ6A 3HNIA 3EFOA 4LERA 3X2QC 3FDQA 3FOOA 4ZLCA 1Y6DA 3V5XA 4EBJA 1E84A 2OKUA 4XPYA 5CI9A 2GFHA 3VM6A 2YZSA 2DGJA 1LI5A 2ZPAA 1QPUA 3EHNA 1M2VB 2J9BA 1D0YA 1ORJA 2YQYA 4X0RA 4A4AA 4MVZA 4E17A 1TR2A 5BQHA 3V5YA 4JW1A 2H7BA 2LK4A 4BG0A 1FTSA 5AC5A 4J7YA 2XL6A 1A41A 2KK1A 4A2NB 4OD4A 2YKZA 1KNYA 3EGXA 5JVEA 5KYWA 1I4YA 5JP7A 1TWHA 2EIMC 3UR3C 1MMDA 3L1MA 1RMVA 3ZTZA 4BJ6C 1Z5ZA 4JJGA 1V74B 1VLSA 2R02A 3S28A 4RDAA 1VMAA 2W4MA 4OINF 1BZ4A 4I1MA 3VRCA 4DBRA 2XLWA 4IWBA 1M56C 1L3PA 3M4CA 3SZRA 4Q5SF 3W2VA 2D4UA 1JPNA 3EZIA 3JTLO 4KC9A 3QW0A 1VTMP 3C18A 4G78A 1VYIA 2HZ8A 2L6GA 3C7JA 3O39A 3WHNA 1YDIA 3LS0A 1PV3A 3U8PA 1TWGA 2VCAA 3RIPA 5F5HA 4LLCA 1O87A 5KYYB 1V55C 3K6BA 5L0DA 2Q9CA 3GM2A 3KL4A 2KC3A 2XLVA 2J9VA 3AQBA 2EIKC 2L81A 3QTHA 1QLEC 4DVYP 2YVKA 2LD6A 4E7SA 1YA9A 3DE9A 1LS1A 1Q0DA 1QKRA 256BA 4MW8A 2KQ9A 4JCHA 2LQGA 3C8GD 1O3UA 3T6BA 1JOGA 5JT4A 5CIVA 4U5BE 1C02A 3ECSA 2IOQA 2XLEA 1OR3A 5B1BC 2V26A 2A69F 4XEFA 3Q7GA 1FR0A 1T5OA 1YZAA 1DOVA 1NSGB 3CZ6A 3DJUB 4PACA 3U3BA 2I8BA 2CGEA 4G7HF 4IB4A 2W4BA 1PD0A 3U8VA 1TKNA 2NSGA 1QVXA 2R7QA 3H2UA 4Q4ZF 1O5HA 1Q0GA 1TQGA 2G3KA 4WJ0A 5DVWA 1Z63A 2EPNA 4C3DA 3EG9B 2IYLD 2YL1A 2PP4A 3LESA 3Q6NA 3EGDB 4M63A 4PJMA 2Y39A 3ATPA 2HSBA 3ZG1A 5DQTA 1K04A 4YL3A 2A6EF 1UG7A 3JT1A 4YJWA 4ANJA 2ASRA 2J46A 4O6YA 1RKEA 2R9RB 2ZD9A 4DXWA 3BRJA 1FFHA 3JSEO 3SXZA 1VYKA 2BL2A 1M2OA 3FAPB 2X51A 3DD7A 3NMKA 2Q7RA 1SYQA 1CPRA 1WTYA 4RBNA 3UGOA 1G5ZA 3HNKA 3IQCA 4YT4A 2R7TA 1M2VA 2IM8A 2YEVA 2R7SA 3HKKA 1YYXA 3L0IA 4U5HA 4NC3A 3TK0A 3UMHA 2CYDA 3K1HA 3PCVA 3M4BA 4DRHB 4CIHA 1ZZPA 2XLHA 4WABA 2Y69C 3UMKA 3O55A 3K7DA 2B0HA 2P7VA 1DOWA 1FFTC 3K66A 3W2WA 5E2QA 5DS4A 5A6BD 2CDQA 4LDKA 2E87A 1GS9A 3CSKA 2M64A 2C04A 4MVUA 2A68F 4PR9A 3KYIA 3C8ZA 4JRZA 4PJJA 3EJNA 4MVRA 2HSQA 3N2ZB 4AL1A 3T4RA 1JPJA 1YZCA 4MW3A 2VB6A 1CGME 5JRAA 4JTAB 2KW3C 3RF3A 3J06A 4G7OF 1RXQA 3W8HA 3S29A 5KYYA 3R7CA 3JSZA 3NRHA 3ZTMA 1D1AA 1XZQA 2P1AA 4BEJA 2KNHA 3A11A 4EKWA 1TWAA 1OXKA 2QE9A 3ZQVA 1ZHYA 3LEVA 1BR2A 2QUPA 3ZDLA 3FAJA 3EQLF 4D4NA 1E83A 2D5RB 3U2MA 2XXAA 2EIJC 4E0HA 3Q7LA 3DAGA 5COGA 4QI2A 3MBGA 4O6NA 3PDMP 2RSEB 4AE4B 5L0GA 2IXNA 1JMWA 3QW1A 3W4YA 2R7UA 2HUJA 4Z9JA 5E3CA 4DBQA 5B3IA 2I15A 2XS8A 3T6GB 3OEOA 5L0JA 3K1IA 3DKAA 1LE4A 1OW7A 1EKYA 1APCA 3KPHA 2HFIA 2YLGA 3G4XA 5L3VA 1IW7F 5A6BA 4LACB 2J7PA 3EG9A 4NTAA 4AK9A 2WZLA 3EGDA 3NG1A 1QZXA 1E2XA 1KU2A 2Y3GA 2CW0F 1HMOA 1WOLA 1YJGA 1YVIA 3DM9B 2ICWG 2WZFA 3G4ZA 3GM1A 3LNMB 5COMA 1T01A 4CSAC 5BQGA 2B0JA 2XS1A 5DLJA 1Z23A 4ULWA 3K1IC 2HJ3A 4MTOA 1OCZC 1YLMA 3ZVRA 4CDAA 1OR2A 5DS6A 5F28E 1JRAA 2X0CA 2Q4FA 3R2PA 4U5FE 1WGWA 1TFKB 3H65A 4OIRF 3LAYA 2Q3TA 2JX0A 2NSFA 2VC9A 3NKEA 4JURI 3VYWA 2CNWA 2FAPB 2AVKA 3LLIA 4EUKB 4PK4A 2JPUA 4P9FA 3RKOF 3ZIBA 3DJNB 5B1AC 3O10A 4QI0A 5A69A 4NQFA 1CGNA 2GAQA 2J9WA 2YHSA 4D4XA 4XTKA 4G0HA 4YT5A 3JRMO 2ETSA 4MVMA 5EGYA 3M15A 2YL0A 3M79A 4C7OA 3AGTA 3LS1A 2AU5A 5A6KA 2GWWA 2DB4A 3SXMA 2L7AA 3L8JA 2EPMX 2O9XA 4H54A 3RQGA 3S9OA 3S27A 1MMNA 3GEIA 3F46A 3SYNA 4FESA 5BUOA 3DAFA 3NMIA 4J7TA 4IGGA 1GGQA 2G62A 4E7ZA 4FAPB 2IXPA 4I44A 4JIOA 3RW0A 3W8IA 1AUEA 2ZXWC 1M6TA 1PD1A 2NUPB 1UFBA 5E3AA 1BDJB 3N0TA 4HFFB 3I5PA 1LM3B 2XM0A 1N1CA 1SR2A 1S7ZA 1NFNA 2P6VA 3CEXA 1ZW3A 1F1MA 1VB5A 4HFKB 4WGZA 3AJMA 3DZAA 1T6UA 4AX2A 5L0HA 1MMGA 1GQAA 3HLZA 1CGOA 3F47A 3X1OA 4XWJA 4DRIB 3VF0A 3GEEA 3LLKA 4JTCB 3RH3A 1NFOA 2R7OA 1V4AA 3UNGC 4CIPA 4N4WA 4YWQA 4J32B 1LI7A 2Q00A 2ZXRA 3NDBB 3CAXA 2WVOA 5KYNA 2GDCA 1RKCA 4JKVA 4BJ5A 2EPKX 2KSFA 4CS7A 3S90A 4Z9IA 3AQCA 3HJCA 2XRHA 1G4WR 1QQ3A 3GWNA 2A0BA 5DS5A 5FZTA 2J45A 5IY5C 2MWQA 2HMQA 1FMVA 2AP3A 1ZYRF 3B0VC 5L0FA 4E18A 1WASA 5KYUB 2P61A 4U5DE 5AC4A 3B0PA 3FHDA 3AG2C 3IQ6A 1ZHZA 1NZEA 3QZCA 4W8PA 1BBHA 1VLTA 4XEKA 4HE8D 3TOMA 4CJOA 1W2WA 1ZHTA 2PF4E 2L6HA 3TULA 5CI8A 4J30B 1Q0KA 3T9OA 5KYXB 4ONSA 4BJ5C 3AGUA 1MMAA 2LIGA 3U9JA 2FFHA 1B68A 2AWYA 1A7EA 2VCBA 5JS5A 3IQTA 4B6IA 1HE9A 3HTKC 4O6MA 2ZXPA 3TD7A 4JTDB 1YA7O 4KBLA 5E33A 2J7PD 4I1OB 3RYLA 1AVOB 2EPOA 2L9JA 4BJ1A 4R32A 3U9MA 1ZVZA 2NPUA 2OG2A 3Q6MA 4PFOA 1OCOC 4YL0A 2G3VA 5JLIA 4CX9A 3KYJA 3ASNC 2WVNA 1LKXA 3IHUA 3IQ5A 4DRJB 4N6HA 3U0CA 2XLOA 1WATA 1TFOB 3SNHA 1MNEA 2C03A 1D1BA 3CQZA 3JRTA 5GPGB 1Z7Qc 3US6A 5B3SC 3U5SA 3QVYA 1U89A 4K0DA 2R25A 4JVSA 2YWAA 2YLIA 3E9VA 4IAQA 3IPMO 2R7XA 3KH2A 3NKDA 2NG1A 2V3CC 2DYRC 3U2LA 4JC7A 2CNWD 1NBBA 2EILC 3B0UX 3FXHA 1XZPA 2Y3DA 4IJJA 2LCHA 2WVQA 4JZAA 5A6AA 2J0XA 1XWJA 1JAFA 3NYLA 1HY5A 3MYIA 3GM3A 2NUPA 4P6IC 4U5CE 3OWTA 3DXJF 2BE5F 2A0UA 3JCUQ 4YT2A 3V5ZA 3JYHA 4MTGA 2GA0A 1RJ9B 3UGPA 3K33A 1NLXA 4MVOA 2PNOA 3GANA 3KKBA 3U3FA 3WAQA 3FVYA 4CS8A 4EHPA 5A6JA 3L34A 2R03A 1PCXA 4Z9HA 4JJFA 2HS5A 4EBBA 3H2VA 1BR4A 2Y3HA 4U9EA 2XM4A 2J8WA 4FX5A 3DM5A 4NCQA 3KMIA 3DE8A 3N24A 4P9TA 3TJ5A 4UDVA 1OW6A 2XLDA 2YRFA 4O7GA 1ORYA 4U5GA 4CDYA 2W45A 4IAOA 4CS9A 4PJNA 1OCRC 1G4US 1K05A 4LLEA
chains in the Genus database with same CATH topology
3HNLA 3NMIA 2YLDA 3FOPA 4JEBA 1M6TA 2CCYA 3NMKA 1CPRA 4U9DA 3HNKA 1LM3B 2XM0A 3TOLA 4WGZA 1E85A 1YYXA 4NC3A 1GQAA 3M4BA 1CGOA 2XLHA 4EIYA 4CJGA 2XLMA 4CIPA 4N4WA 3ZQYA 5AGFA 5JSLA 4JKVA 3HNJA 5JUAA 3QVZA 1QQ3A 3C63A 1S05A 1YZCA 5JRAA 3IQ6A 4CJOA 3TOMA 1BBHA 4CDVA 3C62A 3HNIA 3ZTMA 3ZWIA 3FOOA 1E84A 1CPQA 3ZQVA 1QPUA 2J9BA 5JS5A 4D4NA 1E83A 2XL6A 2YL7A 2YKZA 5JVEA 2QLAA 4JE9A 5JP7A 3QW1A 5B3IA 5JLIA 3L1MA 4CX9A 3ZTZA 3IQ5A 4N6HA 2XLOA 4WGYA 1EKYA 1APCA 3VRCA 2YLGA 2XLWA 4JEAA 3M4CA 3QVYA 2YLIA 4IAQA 3QW0A 1MQVA 4IARA 1RCPA 3U8PA 1NBBA 2XL8A 1JAFA 1A7VA 2XLVA 4CDAA 4L6RA 1YYJA 3DE9A 256BA 4ULVA 1E86A 5JT4A 3NMJA 2BC5A 2XLEA 1CGNA 4U9EA 1YZAA 4D4XA 2XM4A 2J8WA 3DE8A 4IB4A 3M15A 2XLDA 2YL0A 3M79A 4CDYA 4ER9A 2YL3A 2YL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HNL A;  3NMI A;  2YLD A;  3FOP A;  4JEB A;  1M6T A;  2CCY A;  3NMK A;  1CPR A;  4U9D A;  3HNK A;  1LM3 B;  2XM0 A;  3TOL A;  4WGZ A;  1E85 A;  1YYX A;  4NC3 A;  1GQA A;  3M4B A;  1CGO A;  2XLH A;  4EIY A;  4CJG A;  2XLM A;  4CIP A;  4N4W A;  3ZQY A;  5AGF A;  5JSL A;  4JKV A;  3HNJ A;  5JUA A;  3QVZ A;  1QQ3 A;  3C63 A;  1S05 A;  1YZC A;  5JRA A;  3IQ6 A;  4CJO A;  3TOM A;  1BBH A;  4CDV A;  3C62 A;  3HNI A;  3ZTM A;  3ZWI A;  3FOO A;  1E84 A;  1CPQ A;  3ZQV A;  1QPU A;  2J9B A;  5JS5 A;  4D4N A;  1E83 A;  2XL6 A;  2YL7 A;  2YKZ A;  5JVE A;  2QLA A;  4JE9 A;  5JP7 A;  3QW1 A;  5B3I A;  5JLI A;  3L1M A;  4CX9 A;  3ZTZ A;  3IQ5 A;  4N6H A;  2XLO A;  4WGY A;  1EKY A;  1APC A;  3VRC A;  2YLG A;  2XLW A;  4JEA A;  3M4C A;  3QVY A;  2YLI A;  4IAQ A;  3QW0 A;  1MQV A;  4IAR A;  1RCP A;  3U8P A;  1NBB A;  2XL8 A;  1JAF A;  1A7V A;  2XLV A;  4CDA A;  4L6R A;  1YYJ A;  3DE9 A;  256B A;  4ULV A;  1E86 A;  5JT4 A;  3NMJ A;  2BC5 A;  2XLE A;  1CGN A;  4U9E A;  1YZA A;  4D4X A;  2XM4 A;  2J8W A;  3DE8 A;  4IB4 A;  3M15 A;  2XLD A;  2YL0 A;  3M79 A;  4CDY A;  4ER9 A;  2YL3 A;  2YL1 A; 
#chains in the Genus database with same CATH topology
 3HNL A;  3TJ6 A;  4CS8 C;  1VK5 A;  2PBE A;  5KYU A;  4N6C A;  4H4K C;  4OIO F;  1JR8 A;  2YLD A;  1HE1 A;  2Y3B A;  4MVQ A;  2MYS A;  4JEB A;  2HV7 A;  3EH1 A;  2OJQ A;  3EHM A;  5KYX A;  4Q7C A;  1FNT c;  2R05 A;  3TOL A;  2OU6 A;  2XSE A;  4NTB A;  1H9G A;  1MND A;  2TMV P;  2WB7 A;  2OOC A;  2EPL X;  3SXY A;  4CS9 C;  1NG1 A;  2LP4 A;  2UUH A;  3AOU A;  5T3T A;  3NYM A;  2H7V C;  1K40 A;  3WG7 C;  4CJG A;  3MYF A;  3T6J A;  5HSW A;  1I5N A;  2A1D D;  2F22 A;  4IRU A;  4C3B A;  3GWL A;  2IXM A;  4MQ9 F;  4OD5 A;  4GEH A;  1OCC C;  3SXK A;  3ABL C;  4E0I A;  1KTM A;  1T9K A;  3EPV A;  3GEH A;  5JUA A;  3QVZ A;  1Z3I X;  2NUT B;  4BEM J;  5EHH A;  3ASO C;  2PFD A;  5T3W A;  3MFN A;  1HW2 A;  4KI2 A;  3C8G B;  3ZC4 A;  3RQF A;  1BR1 A;  3LUT B;  4GYT A;  5EK0 A;  1L7C A;  3M1C B;  1AEP A;  4N06 A;  4CDV A;  5BQI A;  1OQC A;  3MLG A;  4PJL A;  1ST6 A;  4XLP F;  3ZWI A;  2J9U A;  2FGY A;  2QNL A;  1M57 C;  1LIH A;  4MND A;  2KJG A;  3WOD F;  1CPQ A;  3AG3 C;  5L0C A;  3OA1 A;  3B29 A;  4XEV A;  3I5Q A;  1RJ9 A;  4PFP A;  4AE4 A;  2A6H F;  4RD9 A;  3LEO A;  1FAP B;  1T6Q A;  2OQM A;  3B71 A;  1OKK A;  2W9Y A;  1LE2 A;  2HV6 A;  2YL7 A;  4MTF A;  5DQZ A;  3GOD A;  1IZM A;  1WN0 A;  3NYJ A;  3AG1 C;  4K1O A;  2QLA A;  1LS4 A;  1D0X A;  2VH3 A;  4BPM A;  4JE9 A;  1TWC A;  3PHF 2;  2XXA B;  3LJB A;  2EIN C;  4YT8 A;  3ABM C;  3RVY A;  3MX3 A;  4MS2 A;  1A0B A;  4XPX A;  4YK5 A;  4WGY A;  4NTF A;  5K0I A;  1YAR O;  1J8Y F;  1HMD A;  2RD9 A;  5T1D B;  2R7W A;  1R5I D;  4JEA A;  1WWP A;  1HW1 A;  1Q0M A;  5L0I A;  4I3M A;  1H9T A;  1D0Z A;  3FMS A;  5FCL A;  1Q0F A;  1SF8 A;  4YL1 A;  1MQV A;  1LPE A;  1NU9 C;  5COF A;  2JD3 A;  5HV9 A;  1U0B B;  4IAR A;  1C03 A;  1ZHW A;  1G8X A;  3ITF A;  2HKV A;  1RCP A;  1H6G A;  3RVZ A;  2KGO A;  2XL8 A;  1OW8 A;  1SZI A;  4DOZ A;  4W8K A;  3TQO A;  5L3Q A;  3EFO B;  1A7V A;  3S84 A;  1H7I A;  1GM5 A;  2LSE A;  4FWV A;  4XQ1 A;  2OCC C;  2XL4 A;  3DWW A;  4L6R A;  4LDQ A;  3BEH A;  1QSP A;  1YYJ A;  2DYS C;  3E70 C;  4XLN F;  4AL0 A;  2AWC A;  2PX3 A;  1Z6A A;  2L6F A;  3ABK C;  2IXO A;  1R4T A;  2HMZ A;  3O6X A;  1I4Z A;  4ULV A;  4NY3 A;  2WZG A;  1E86 A;  3NMJ A;  3EGX B;  5KYW B;  2BC5 A;  2M4E A;  1V54 C;  2PX0 A;  3RFY A;  4OIQ F;  4CBE A;  1EQ1 A;  3AG4 C;  3S0X A;  1T6I A;  1ZU4 A;  2NUT A;  3POV A;  3IEE A;  4G7Z F;  3RQE A;  4BJT A;  4ER9 A;  3C8G A;  3DMD A;  2LFD A;  2YL3 A;  1NU7 D;  3PMR A;  3I4U A;  5D92 A;  2LFF A;  3B9Q A;  4KNV A;  4C7O B;  2ZXO A;  3SEO A;  4ZLD A;  1ZU5 A;  3FOP A;  2HJM A;  1ZHX A;  4C3E A;  2OEV A;  2P0N A;  3ZSU A;  1ZW2 A;  2MHR A;  3A9C A;  2CCY A;  3JZ0 A;  3L8I A;  4EBK A;  4U9D A;  1EI7 A;  4O79 A;  1J8M F;  1U6H A;  3UMI A;  2QTV A;  4EWC A;  1OXB A;  2OEX A;  2QY9 A;  4DVZ A;  1C17 M;  1E85 A;  2VCC A;  3JYY A;  4OIP F;  5F5F A;  1VOM A;  2Z15 A;  4U5E E;  3DI5 A;  4DJ9 A;  4EIY A;  4GQH A;  2Q9A A;  2XLM A;  1EA8 A;  2J0W A;  3ZQY A;  2IBF A;  1ORS C;  3EH2 A;  5AGF A;  4YN0 B;  1FMW A;  2VAS A;  3LNR A;  5JSL A;  3HNJ A;  2OJE D;  4XPW A;  4JCZ A;  1YAU O;  4MVS A;  2Q9B A;  2R7R A;  2H8A A;  4KNW A;  4QDL A;  3SP1 A;  3VAY A;  1LVK A;  4CSA A;  4K7B A;  3C63 A;  3EZH A;  1S05 A;  3G50 A;  4HEA J;  3QMK A;  1Y4C A;  3V7O A;  2KYH A;  1D1C A;  5TJ5 E;  2UUI A;  1A7D A;  3GOR A;  2R7V A;  1OKK D;  1SMY F;  5D91 A;  4F4B A;  1RKE B;  2WL8 A;  2DI3 A;  2H7O A;  4LDR A;  3C62 A;  4BJ6 A;  3HNI A;  3EFO A;  4LER A;  3X2Q C;  3FDQ A;  3FOO A;  4ZLC A;  1Y6D A;  3V5X A;  4EBJ A;  1E84 A;  2OKU A;  4XPY A;  5CI9 A;  2GFH A;  3VM6 A;  2YZS A;  2DGJ A;  1LI5 A;  2ZPA A;  1QPU A;  3EHN A;  1M2V B;  2J9B A;  1D0Y A;  1ORJ A;  2YQY A;  4X0R A;  4A4A A;  4MVZ A;  4E17 A;  1TR2 A;  5BQH A;  3V5Y A;  4JW1 A;  2H7B A;  2LK4 A;  4BG0 A;  1FTS A;  5AC5 A;  4J7Y A;  2XL6 A;  1A41 A;  2KK1 A;  4A2N B;  4OD4 A;  2YKZ A;  1KNY A;  3EGX A;  5JVE A;  5KYW A;  1I4Y A;  5JP7 A;  1TWH A;  2EIM C;  3UR3 C;  1MMD A;  3L1M A;  1RMV A;  3ZTZ A;  4BJ6 C;  1Z5Z A;  4JJG A;  1V74 B;  1VLS A;  2R02 A;  3S28 A;  4RDA A;  1VMA A;  2W4M A;  4OIN F;  1BZ4 A;  4I1M A;  3VRC A;  4DBR A;  2XLW A;  4IWB A;  1M56 C;  1L3P A;  3M4C A;  3SZR A;  4Q5S F;  3W2V A;  2D4U A;  1JPN A;  3EZI A;  3JTL O;  4KC9 A;  3QW0 A;  1VTM P;  3C18 A;  4G78 A;  1VYI A;  2HZ8 A;  2L6G A;  3C7J A;  3O39 A;  3WHN A;  1YDI A;  3LS0 A;  1PV3 A;  3U8P A;  1TWG A;  2VCA A;  3RIP A;  5F5H A;  4LLC A;  1O87 A;  5KYY B;  1V55 C;  3K6B A;  5L0D A;  2Q9C A;  3GM2 A;  3KL4 A;  2KC3 A;  2XLV A;  2J9V A;  3AQB A;  2EIK C;  2L81 A;  3QTH A;  1QLE C;  4DVY P;  2YVK A;  2LD6 A;  4E7S A;  1YA9 A;  3DE9 A;  1LS1 A;  1Q0D A;  1QKR A;  256B A;  4MW8 A;  2KQ9 A;  4JCH A;  2LQG A;  3C8G D;  1O3U A;  3T6B A;  1JOG A;  5JT4 A;  5CIV A;  4U5B E;  1C02 A;  3ECS A;  2IOQ A;  2XLE A;  1OR3 A;  5B1B C;  2V26 A;  2A69 F;  4XEF A;  3Q7G A;  1FR0 A;  1T5O A;  1YZA A;  1DOV A;  1NSG B;  3CZ6 A;  3DJU B;  4PAC A;  3U3B A;  2I8B A;  2CGE A;  4G7H F;  4IB4 A;  2W4B A;  1PD0 A;  3U8V A;  1TKN A;  2NSG A;  1QVX A;  2R7Q A;  3H2U A;  4Q4Z F;  1O5H A;  1Q0G A;  1TQG A;  2G3K A;  4WJ0 A;  5DVW A;  1Z63 A;  2EPN A;  4C3D A;  3EG9 B;  2IYL D;  2YL1 A;  2PP4 A;  3LES A;  3Q6N A;  3EGD B;  4M63 A;  4PJM A;  2Y39 A;  3ATP A;  2HSB A;  3ZG1 A;  5DQT A;  1K04 A;  4YL3 A;  2A6E F;  1UG7 A;  3JT1 A;  4YJW A;  4ANJ A;  2ASR A;  2J46 A;  4O6Y A;  1RKE A;  2R9R B;  2ZD9 A;  4DXW A;  3BRJ A;  1FFH A;  3JSE O;  3SXZ A;  1VYK A;  2BL2 A;  1M2O A;  3FAP B;  2X51 A;  3DD7 A;  3NMK A;  2Q7R A;  1SYQ A;  1CPR A;  1WTY A;  4RBN A;  3UGO A;  1G5Z A;  3HNK A;  3IQC A;  4YT4 A;  2R7T A;  1M2V A;  2IM8 A;  2YEV A;  2R7S A;  3HKK A;  1YYX A;  3L0I A;  4U5H A;  4NC3 A;  3TK0 A;  3UMH A;  2CYD A;  3K1H A;  3PCV A;  3M4B A;  4DRH B;  4CIH A;  1ZZP A;  2XLH A;  4WAB A;  2Y69 C;  3UMK A;  3O55 A;  3K7D A;  2B0H A;  2P7V A;  1DOW A;  1FFT C;  3K66 A;  3W2W A;  5E2Q A;  5DS4 A;  5A6B D;  2CDQ A;  4LDK A;  2E87 A;  1GS9 A;  3CSK A;  2M64 A;  2C04 A;  4MVU A;  2A68 F;  4PR9 A;  3KYI A;  3C8Z A;  4JRZ A;  4PJJ A;  3EJN A;  4MVR A;  2HSQ A;  3N2Z B;  4AL1 A;  3T4R A;  1JPJ A;  1YZC A;  4MW3 A;  2VB6 A;  1CGM E;  5JRA A;  4JTA B;  2KW3 C;  3RF3 A;  3J06 A;  4G7O F;  1RXQ A;  3W8H A;  3S29 A;  5KYY A;  3R7C A;  3JSZ A;  3NRH A;  3ZTM A;  1D1A A;  1XZQ A;  2P1A A;  4BEJ A;  2KNH A;  3A11 A;  4EKW A;  1TWA A;  1OXK A;  2QE9 A;  3ZQV A;  1ZHY A;  3LEV A;  1BR2 A;  2QUP A;  3ZDL A;  3FAJ A;  3EQL F;  4D4N A;  1E83 A;  2D5R B;  3U2M A;  2XXA A;  2EIJ C;  4E0H A;  3Q7L A;  3DAG A;  5COG A;  4QI2 A;  3MBG A;  4O6N A;  3PDM P;  2RSE B;  4AE4 B;  5L0G A;  2IXN A;  1JMW A;  3QW1 A;  3W4Y A;  2R7U A;  2HUJ A;  4Z9J A;  5E3C A;  4DBQ A;  5B3I A;  2I15 A;  2XS8 A;  3T6G B;  3OEO A;  5L0J A;  3K1I A;  3DKA A;  1LE4 A;  1OW7 A;  1EKY A;  1APC A;  3KPH A;  2HFI A;  2YLG A;  3G4X A;  5L3V A;  1IW7 F;  5A6B A;  4LAC B;  2J7P A;  3EG9 A;  4NTA A;  4AK9 A;  2WZL A;  3EGD A;  3NG1 A;  1QZX A;  1E2X A;  1KU2 A;  2Y3G A;  2CW0 F;  1HMO A;  1WOL A;  1YJG A;  1YVI A;  3DM9 B;  2ICW G;  2WZF A;  3G4Z A;  3GM1 A;  3LNM B;  5COM A;  1T01 A;  4CSA C;  5BQG A;  2B0J A;  2XS1 A;  5DLJ A;  1Z23 A;  4ULW A;  3K1I C;  2HJ3 A;  4MTO A;  1OCZ C;  1YLM A;  3ZVR A;  4CDA A;  1OR2 A;  5DS6 A;  5F28 E;  1JRA A;  2X0C A;  2Q4F A;  3R2P A;  4U5F E;  1WGW A;  1TFK B;  3H65 A;  4OIR F;  3LAY A;  2Q3T A;  2JX0 A;  2NSF A;  2VC9 A;  3NKE A;  4JUR I;  3VYW A;  2CNW A;  2FAP B;  2AVK A;  3LLI A;  4EUK B;  4PK4 A;  2JPU A;  4P9F A;  3RKO F;  3ZIB A;  3DJN B;  5B1A C;  3O10 A;  4QI0 A;  5A69 A;  4NQF A;  1CGN A;  2GAQ A;  2J9W A;  2YHS A;  4D4X A;  4XTK A;  4G0H A;  4YT5 A;  3JRM O;  2ETS A;  4MVM A;  5EGY A;  3M15 A;  2YL0 A;  3M79 A;  4C7O A;  3AGT A;  3LS1 A;  2AU5 A;  5A6K A;  2GWW A;  2DB4 A;  3SXM A;  2L7A A;  3L8J A;  2EPM X;  2O9X A;  4H54 A;  3RQG A;  3S9O A;  3S27 A;  1MMN A;  3GEI A;  3F46 A;  3SYN A;  4FES A;  5BUO A;  3DAF A;  3NMI A;  4J7T A;  4IGG A;  1GGQ A;  2G62 A;  4E7Z A;  4FAP B;  2IXP A;  4I44 A;  4JIO A;  3RW0 A;  3W8I A;  1AUE A;  2ZXW C;  1M6T A;  1PD1 A;  2NUP B;  1UFB A;  5E3A A;  1BDJ B;  3N0T A;  4HFF B;  3I5P A;  1LM3 B;  2XM0 A;  1N1C A;  1SR2 A;  1S7Z A;  1NFN A;  2P6V A;  3CEX A;  1ZW3 A;  1F1M A;  1VB5 A;  4HFK B;  4WGZ A;  3AJM A;  3DZA A;  1T6U A;  4AX2 A;  5L0H A;  1MMG A;  1GQA A;  3HLZ A;  1CGO A;  3F47 A;  3X1O A;  4XWJ A;  4DRI B;  3VF0 A;  3GEE A;  3LLK A;  4JTC B;  3RH3 A;  1NFO A;  2R7O A;  1V4A A;  3UNG C;  4CIP A;  4N4W A;  4YWQ A;  4J32 B;  1LI7 A;  2Q00 A;  2ZXR A;  3NDB B;  3CAX A;  2WVO A;  5KYN A;  2GDC A;  1RKC A;  4JKV A;  4BJ5 A;  2EPK X;  2KSF A;  4CS7 A;  3S90 A;  4Z9I A;  3AQC A;  3HJC A;  2XRH A;  1G4W R;  1QQ3 A;  3GWN A;  2A0B A;  5DS5 A;  5FZT A;  2J45 A;  5IY5 C;  2MWQ A;  2HMQ A;  1FMV A;  2AP3 A;  1ZYR F;  3B0V C;  5L0F A;  4E18 A;  1WAS A;  5KYU B;  2P61 A;  4U5D E;  5AC4 A;  3B0P A;  3FHD A;  3AG2 C;  3IQ6 A;  1ZHZ A;  1NZE A;  3QZC A;  4W8P A;  1BBH A;  1VLT A;  4XEK A;  4HE8 D;  3TOM A;  4CJO A;  1W2W A;  1ZHT A;  2PF4 E;  2L6H A;  3TUL A;  5CI8 A;  4J30 B;  1Q0K A;  3T9O A;  5KYX B;  4ONS A;  4BJ5 C;  3AGU A;  1MMA A;  2LIG A;  3U9J A;  2FFH A;  1B68 A;  2AWY A;  1A7E A;  2VCB A;  5JS5 A;  3IQT A;  4B6I A;  1HE9 A;  3HTK C;  4O6M A;  2ZXP A;  3TD7 A;  4JTD B;  1YA7 O;  4KBL A;  5E33 A;  2J7P D;  4I1O B;  3RYL A;  1AVO B;  2EPO A;  2L9J A;  4BJ1 A;  4R32 A;  3U9M A;  1ZVZ A;  2NPU A;  2OG2 A;  3Q6M A;  4PFO A;  1OCO C;  4YL0 A;  2G3V A;  5JLI A;  4CX9 A;  3KYJ A;  3ASN C;  2WVN A;  1LKX A;  3IHU A;  3IQ5 A;  4DRJ B;  4N6H A;  3U0C A;  2XLO A;  1WAT A;  1TFO B;  3SNH A;  1MNE A;  2C03 A;  1D1B A;  3CQZ A;  3JRT A;  5GPG B;  1Z7Q c;  3US6 A;  5B3S C;  3U5S A;  3QVY A;  1U89 A;  4K0D A;  2R25 A;  4JVS A;  2YWA A;  2YLI A;  3E9V A;  4IAQ A;  3IPM O;  2R7X A;  3KH2 A;  3NKD A;  2NG1 A;  2V3C C;  2DYR C;  3U2L A;  4JC7 A;  2CNW D;  1NBB A;  2EIL C;  3B0U X;  3FXH A;  1XZP A;  2Y3D A;  4IJJ A;  2LCH A;  2WVQ A;  4JZA A;  5A6A A;  2J0X A;  1XWJ A;  1JAF A;  3NYL A;  1HY5 A;  3MYI A;  3GM3 A;  2NUP A;  4P6I C;  4U5C E;  3OWT A;  3DXJ F;  2BE5 F;  2A0U A;  3JCU Q;  4YT2 A;  3V5Z A;  3JYH A;  4MTG A;  2GA0 A;  1RJ9 B;  3UGP A;  3K33 A;  1NLX A;  4MVO A;  2PNO A;  3GAN A;  3KKB A;  3U3F A;  3WAQ A;  3FVY A;  4CS8 A;  4EHP A;  5A6J A;  3L34 A;  2R03 A;  1PCX A;  4Z9H A;  4JJF A;  2HS5 A;  4EBB A;  3H2V A;  1BR4 A;  2Y3H A;  4U9E A;  2XM4 A;  2J8W A;  4FX5 A;  3DM5 A;  4NCQ A;  3KMI A;  3DE8 A;  3N24 A;  4P9T A;  3TJ5 A;  4UDV A;  1OW6 A;  2XLD A;  2YRF A;  4O7G A;  1ORY A;  4U5G A;  4CDY A;  2W45 A;  4IAO A;  4CS9 A;  4PJN A;  1OCR C;  1G4U S;  1K05 A;  4LLE A; 
#chains in the Genus database with same CATH homology
 3HNL A;  3NMI A;  2YLD A;  3FOP A;  4JEB A;  1M6T A;  2CCY A;  3NMK A;  1CPR A;  4U9D A;  3HNK A;  1LM3 B;  2XM0 A;  3TOL A;  4WGZ A;  1E85 A;  1YYX A;  4NC3 A;  1GQA A;  3M4B A;  1CGO A;  2XLH A;  4EIY A;  4CJG A;  2XLM A;  4CIP A;  4N4W A;  3ZQY A;  5AGF A;  5JSL A;  4JKV A;  3HNJ A;  5JUA A;  3QVZ A;  1QQ3 A;  3C63 A;  1S05 A;  1YZC A;  5JRA A;  3IQ6 A;  4CJO A;  3TOM A;  1BBH A;  4CDV A;  3C62 A;  3HNI A;  3ZTM A;  3ZWI A;  3FOO A;  1E84 A;  1CPQ A;  3ZQV A;  1QPU A;  2J9B A;  5JS5 A;  4D4N A;  1E83 A;  2XL6 A;  2YL7 A;  2YKZ A;  5JVE A;  2QLA A;  4JE9 A;  5JP7 A;  3QW1 A;  5B3I A;  5JLI A;  3L1M A;  4CX9 A;  3ZTZ A;  3IQ5 A;  4N6H A;  2XLO A;  4WGY A;  1EKY A;  1APC A;  3VRC A;  2YLG A;  2XLW A;  4JEA A;  3M4C A;  3QVY A;  2YLI A;  4IAQ A;  3QW0 A;  1MQV A;  4IAR A;  1RCP A;  3U8P A;  1NBB A;  2XL8 A;  1JAF A;  1A7V A;  2XLV A;  4CDA A;  4L6R A;  1YYJ A;  3DE9 A;  256B A;  4ULV A;  1E86 A;  5JT4 A;  3NMJ A;  2BC5 A;  2XLE A;  1CGN A;  4U9E A;  1YZA A;  4D4X A;  2XM4 A;  2J8W A;  3DE8 A;  4IB4 A;  3M15 A;  2XLD A;  2YL0 A;  3M79 A;  4CDY A;  4ER9 A;  2YL3 A;  2YL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...