4ERDA

Crystal structure of the c-terminal domain of tetrahymena telomerase protein p65 in complex with stem iv of telomerase rna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
NCLIKIINIPQGTLKAEVVLAVRHLGYEFYCDYIDGQAMIRFQNSDEQRLAIQKLLNHNNNKLQIEIRGQICDVISTIPEDEEKNYWNYIKFKKNEFRKFFFMKKQQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Telomerase associated protein p65
publication title Structural Basis for Telomerase RNA Recognition and RNP Assembly by the Holoenzyme La Family Protein p65.
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Rna binding protein/rna
total genus 29
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4erdA00
1HD0A 2MSTA 1AUDA 2DISA 5JVGQ 3K0JA 1FJ7A 2K8GA 1U1NA 1WHWA 2HGMA 3VALA 2RRAA 2LXIA 1SXLA 3J7YU 2AYEA 1VQNS 2PEHA 2M70A 3CCJS 3CCSS 2F9JA 2KRBA 3NNHA 5CA5A 1VC6A 2QFJA 2CQ3A 2DIVA 3UCUP 2CPFA 3MI7X 1NJIT 3BEGB 2D9OA 2XS5A 1VQLS 3TP2A 2MKHA 2KN4A 3S7RA 2OIHA 2F9DA 2ZJPQ 4PRFA 2DNKA 2GHPA 1G2EA 2KU7A 2I2YA 1OO0B 2CPZA 1VC0A 1H2UX 3VAJA 1Q86T 4WKRA 1H2TZ 2DNNA 2G0CA 2DGQA 2AYGA 3THPA 5CYJA 2HGLA 4IO9Q 3BO3A 1X0FA 2LA4A 1K73T 1NO8A 3CD6S 3TO8A 3CCUS 1UW4A 1U1PA 2FY1A 4WCEQ 2NZ4A 4C7QA 3FEXB 2CPHA 1A7GE 3NNAA 2KM8C 4CH1A 3L3CA 2LYVA 3CPWR 2CPDA 1JJHA 3B4MA 1X4BA 1Q7YT 1M1KT 1WHYA 3SDEB 3R1LA 2NLWA 4OZ0A 2KG1A 3VAFA 5BJRA 1U6BA 2I38A 5IQQA 3CCVS 2KXNB 2MMYA 2LMIA 2JX2A 2OTJS 2L9WA 2KI2A 2MGZB 2WBRA 2RUGA 3G6ES 5LJ3Y 3DXBA 2OSRA 2N3LA 2RQCA 3NS6A 2U1AA 4PKDB 1F9FA 2M7SA 4UQTA 2RNEA 3ZZYA 1L3KA 2M88A 3S01A 2DO0A 3MUTP 2E5JA 1UFWA 2CQIA 4C0OC 1KQSR 2CQBA 1WHXA 1DZ5A 1DRZA 1VQ7S 2KT5A 1U1QA 1VC5A 2MQOA 3MD3A 2N7CA 2UP1A 2DHAA 1X5OA 4TU7A 4P6QA 2DHGA 2JVRA 2FHOB 1SJ4P 5DDRC 1ZZFA 2QA4S 2EK1A 2MKKA 1K9MT 5D77A 1VQ4S 3TYTA 4ZKAA 3CMAS 1M5OC 2DGVA 3EX7B 4PR6A 3CTRA 1HA1A 1ZH5A 4BS2A 2MZQA 1WEZA 1YJNS 3P3DA 1KOHA 2KXFA 4CIOA 2J0SD 1N8RT 3VAIA 1ZZNA 1X4DA 1U1OA 2CQ4A 1SJFA 2LECA 2N82B 2M4MA 2J0QD 2X1AA 3P5TL 2KM8B 2AD9A 1XN9A 2U2FA 2MZTA 3CUNA 2D3OR 5ITHA 2J8AA 1WWHA 2FPHX 5JVHQ 4W90B 3IRWP 2XS7A 1KOOA 1W2BR 3P6YC 2DNZA 2YTCA 2CPXA 4IUFA 2MZJA 2CQDA 2DHSA 2B0GA 1X4GA 2RVJA 1P1TA 1X5PA 2ADBA 2VOOA 2DNQA 2MKSA 2MKJA 2CQGA 3UWTA 2X1FA 1R8HA 4TU8A 1HD1A 3NNCA 1WF2A 2XNRA 2MQNA 5HL7Q 5DDQC 1U1RA 2EK6A 3FEYB 1D9AA 3SXLA 1SJ3P 4F02A 1R8PA 2HZCA 1X4HA 3EGNA 2MSSA 3SDEA 4YOEA 5LXRA 3CMES 1KD1T 1K8AT 1FXLA 2JVOA 2MY8A 2CJKA 4RU2A 3Q2TC 2MQLA 2HGNA 2M52A 1O0PA 3H2UB 1BY9A 2XSFA 2BOPA 2OTLS 4F26A 1WEYA 3S8SA 3MXHP 2VOPA 1VQOS 2MGZA 2KFYA 2MHNA 1DHMA 2DNMA 1WTBA 2D9PA 5DDOC 2MQQA 2QEXS 2LCWA 2MY7A 1M90T 5IM0B 3MD1A 3CCLS 3CULA 3NS5A 1A9NB 2EVZA 1FT8A 2DITA 2DNHA 3R1HA 4UY8T 3G9CA 3IWNC 4YB1P 2J76E 4LJMA 5EN1A 4ERDA 3P49B 2YWKA 5DM7Q 2YH1A 5HO4A 3DLLQ 1JJ2R 3CCMS 1Q81T 1DBDA 3MUMP 1JJ4A 1OPIA 1WF0A 3VAGA 1CVJA 1OIAA 3HI9A 4U67Q 3HHNB 5DDPC 2KHCA 3JB9k 2L41A 1VBZA 4CH0S 5CXTA 3U1LA 3D2WA 2KXHA 1N52B 3NMRA 1X4EA 3CCRS 4YUDA 1FJEB 4V19X 1YWXA 2DGTA 2E5IA 2A3JA 2CQ0A 1U1LA 2KVIA 4IOCQ 2LEBA 2MQMA 2CQ1A 2DB1A 2MKIA 2DNLA 2E5HA 2RS8A 2JRSA 5D78A 3B4DA 2DGWA 2MXYA 2LA6A 2FC9A 2RS2A 1KC8T 1SJRA 2MB0B 2DNRA 2XB2D 1URNA 3MURP 3I55S 1P27B 2MPUA 3G71S 3CC2S 1HL6A 1B7FA 3US5A 1PGZA 3BO4A 2CPYA 2XS2A 3ZZZA 1X4FA 2DNGA 2Q79A 2CPEA 2FC8A 1UP1A 1H2VZ 5GMKa 1UAWA 2DGOA 1U1KA 1IQTA 3OW2R 5FJ4A 3EGZA 4WFNQ 2AYBA 2LQ5A 1YIJS 3BS9A 1FHTA 2DGSA 1VQ9S 1VQ5S 4WFAQ 1PO6A 1RK8A 3Q2SC 1FJCA 2DGXA 3CCES 3VF0B 2KG0A 4W92B 2YKAA 3LQVA 1VBXA 2DIUA 2MYFA 1H6KX 3I56S 1YJ9S 1FO1A 5LXYA 2F3JA 1U6FA 3MUVP 5GADU 2G4BA 1SJQA 5H1SV 4LIRA 2VODA 5GAGU 2K3KA 2GO9A 3RW7A 2M2BA 3CXCR 1D8ZA 1VQPS 1WEXA 2VONA 1OWXA 4Z2XA 2RRBA 5IM0A 2KYXA 3MOJB 2M8HA 2E5GA 3ULHA 1YTYA 3UCZP 5LSLA 2L08A 2RU3A 2CQCA 3CCQS 1JMTA 2DHXA 1QM9A 2DGUA 3UD3P 2XNQA 1VBYA 2DNYA 1WHVA 1WI6A 2O3DA 2RQ4A 2MZRA 2ADCA 2CQ2A 1WG5A 2E44A 2JWNA 1WG4A 2HYIB 5IFMA 2DH7A 1YITS 5LSOA 2DNOA 2LXUA 4ED5A 2DO4A 1QVFR 4EGLA 3G96A 2MZSA 4WIIA 2KH9A 2OJ3A 3PIPQ 5GVQA 3G8TA 4LMZA 2X1BA 1FNXH 1X4CA 1M5PC 1NU4A 4QPTA 3UCGA 3LPYA 5DETA 1X4AA 5MLCV 1YI2S 1RKJA 1VQ6S 1S72S 2MZ1A 1N54B 1X5TA 2RT3A 3MDFA 5LJ5Y 2CPIA 2LKZA 1Q82T 3RW6A 3THTA 2ZJQQ 2HVZA 3CC7S 1U1MA 1WELA 3UD4P 1U2FA 3H2VE 4M5DB 4QU6A 3VAMA 2DK2A 4FXVA 3VAHA 1WG1A 2MJNA 2SXLA 2DH8A 5GAHU 2BZ2A 1M5VC 3N9UC 2PE8A 2MQPA 2X1GA 2CPJA 2MJUA 2ERRA 2CQPA 4QQBA 2YH0A 1N88A 2KRRA 4C4WA 4WFBQ 2AYMA 4IOAQ 2V94A 2MKCA 3PIOQ 2DNPA 2N3OA 1YHQS 1S79A 2M9KA 3UE2A 5GAEU 4OZ1A 1VQ8S 3J7ZT 4QU7A 4WF9Q 1X5SA 3CF5Q 4FXWA 3S6EA 1M5KC 3BO2A 4Y0FA 4Y00A 3R27A 3G4SS 2G1DA 2ZJRQ 4CQ1A 1VQKS 3SMZA 1VQMS 2M8DB 2DH9A 4A8XA 2M0GB 4TU9A 1YJWS 3VAKA 3V4MA 4F25A 5DM6Q 4TLQA 2CQHA 1WI8A 3U1MA 1WF1A 4J5OA 3CC4S 2LEAA 2OSQA 1QVGR 3G8SA
chains in the Genus database with same CATH superfamily
3HKWA 4GKJF 3K0JA 3CJKB 5F0UA 4F67A 2C22A 3Q86A 3MMCA 2NS1B 2ZOFA 1FRMA 1I1GA 2XY7A 2QL7B 4R0JA 1Z1ZA 3Q8UA 4XTTA 3X3UA 1R0AA 4OI6A 5HBMA 1S1VA 1EETA 4ZHRB 1P9QC 1S1WA 5HP1B 2AYGA 5CYJA 2E1RA 3H0PA 1NO8A 3BQ2A 3TUPA 1RB0A 1HBMA 2PO4A 1LNQA 2IPOB 4WP3A 2ZH1A 1N33F 1PBUA 5D6GA 5E41A 1OYDA 2VC1A 3OXFA 1MG7A 4C8YA 2JNJA 2ZH5A 2O5DA 2FTRA 2KJVA 5IQQA 4FBTA 2IVYA 2UVUA 2PA8D 2PD1A 3ZZYA 3ZTQA 2HW3A 1QE1A 4DR2F 1U4BA 4W4MA 1SL0A 4B3MF 1HBOB 4PQAA 3K5MA 1QY7A 4MAKA 5B0BA 5IS2A 4MTPA 4DZ6A 2UP1A 2JVRA 1RBAA 2RQMA 4X84A 2MKKA 3IR6B 3K5LA 1U0HB 1J2VA 2J9DE 3VVUA 2EFPA 3CTRA 5C7PA 2XO7A 5HLFA 3E51A 4LVOP 2IRXA 3DDKA 1IWGA 1UEVA 5HAOA 2HNDB 2YWEA 2C42A 3NGUA 4RWWA 1SQEA 3ZZUA 2HFNA 3QFWA 4DFPA 4GMKA 2JFDA 2UUBJ 2COLA 3MAAB 3H5UA 4Y65A 5KG1A 1ZAWA 3MCSA 2HZCA 4HI1A 4DZDA 5FDLB 4O3PA 4USKA 1IR0A 5LXRA 1QLNA 4KV8A 1CPZA 2MY8A 5F8MA 3TZZA 4HEA9 1WEYA 3FJ2A 2VOPA 1FK9B 4DR1J 4U7CA 4KFBA 3M2VB 4CTAB 3KOAA 2VG7B 2KHDA 4A8FA 3CULA 5ETKA 3G9CA 3G8QA 2OFGX 3F41A 3H2LA 3I0RA 4N8OA 1U2RA 3G6YA 3UQSA 3DGPB 4NL5A 1WF0A 2QLJB 2YNGA 4CYUB 5AJ3F 1DLOA 4OYPA 3V81A 3V6DA 3FQKA 4WKYA 4DLGA 1XR5A 3DRRB 1FNMA 2DRDA 3R97A 1JB0C 4V19X 3TVZA 5MAOA 5CAAA 3AQOA 3TVKA 2MKIA 2UXDJ 1VHFA 4PQUA 1YDLA 2HAFA 3RRGA 4YFUA 4CRJA 2FC9A 1TTHB 2O1PA 4DL5A 1X8DA 3D3CJ 1DURA 1RWPB 3ILJA 1K47A 4PWDA 5DZ7A 1LWFA 5CZVA 1HI0P 1UZDA 4LRCA 3A8KA 1RT2A 1IM6A 1EQ0A 3SSRA 1MMDA 4WFNQ 3C16B 3GIKA 3D6MB 3M32B 2OPPB 5HMXA 3VCDA 3R5GA 5EWGA 4F04B 5KFJA 1SVDA 2VD3A 3CCWA 3BDPA 1JLQA 1FO1A 1U6FA 1V3SA 4F0MA 5BYRA 4NMXA 2XI3A 1VRTA 3HT3A 4B9VA 4Z2XA 4FYDA 1MWQA 2LQBA 3J81j 2FD2A 5A6PA 2GHWA 2Y0SD 1RGVA 2D41A 1QM9A 3AD8C 2DPJA 1QAYA 2EWHA 2AEFA 3D54A 2JWNA 3A3PB 1TKXA 3CDUA 3H8YA 4HL9A 4DSKA 2V4QA 1VRQC 1S6PA 1NSPA 2KH9A 3UPFA 3MEGA 4LMZA 4EBDA 1PYOB 4O4GA 2XHWA 4DR3F 2VICA 4ES1A 2AKWB 1SIZA 4KY3A 1Q82T 1R8BA 3ILIA 1T0TV 1G4CA 3NCRA 3PRVA 2P9EA 4DQIA 4C0BA 3OBIA 2BZ2A 1FXDA 4HR2A 1YRTA 2MJUA 1N0VC 2MKCA 2XMWA 1PJ5A 1TP7A 4PXEA 2M9KA 4F4YA 5BR8F 1YRXA 2XGPA 3QQCD 3OL8A 4DSFA 3NGTA 1VQKS 3VAKA 2MKYA 4DV2F 2EFVA 2VFVA 4TNOA 2FYXA 1N32F 3CJ5A 2JLEA 5CYMA 5IT0A 2ILYA 1NSKL 2RRAA 2NREA 4C8NA 4OJGA 3F44A 3GZ7A 5KFWA 1Q8LA 2DJWA 2QYGA 4YY3F 1ZM9A 4HYKA 2K1RB 4USMA 3OQ2A 1CJVA 1RXOB 1N36F 2LQJA 3PVXA 3LGHA 5F8NA 2AEJA 4OZ3A 2VBYA 4B3TJ 5IC4B 1XNQF 3J80Y 3BSOA 1S57A 3BZQA 3TX8A 3T41A 4N47A 4CWBA 1IWAA 1Y11A 2UUAF 4WP9A 2MMYA 2R3VA 4B3RF 3SQOP 2UVWA 4DR4F 3BQ1A 4KGKA 4ZOSA 4F0HA 4KGMA 3BN4A 2AJQA 4YDXA 1NK0A 2VKZG 1DRZA 1NH7A 4JI8J 1TFWA 2ZEJA 2EC0A 4CO5A 2QA4S 2Z56B 2QTWA 4J91A 2V2KA 4XK8C 3W66A 4Y28C 1WEZA 3FKBA 4IDKB 1TL5A 1U8WA 2J5AA 2J0QD 4GVBA 3OT9A 3JQJA 2U2FA 3PR4A 3W8GA 4NZ7A 2HNZB 4I2QB 1C0UB 3ZC4A 4F3MA 3OVAA 3R5AA 3P6YC 2YTCA 3RBXA 2C3MA 1DQAA 2X1FA 2E9ZA 2WVBA 4C2MA 5HI7A 1HKAA 3HSDA 3EGNA 1JXEA 1VS3A 5I3UA 2PIIA 4IQMA 2JH3A 3PDNA 3PG9A 2HHTA 4DG1A 1BY9A 4RBUA 2OTLS 2LCWA 5HK4A 3MD1A 4LFAJ 5F8HA 1HYSB 2UUCF 2IMWP 3J81U 2QRRA 2HFUA 5GADI 1A9NB 3VZHA 3OTOF 4K8RA 1GEHA 1XR6A 2YWKA 1YGYA 3DHXA 1S1XA 3HHLD 2CADA 1DQ8A 1Y9OA 4HKQA 4CH0S 1GAOA 4QYZJ 4CO3A 3EXCX 1I5OB 3P4UB 2FZKB 2B4OA 1CG2A 4AQYJ 3ILOA 3CE8A 5D78A 2RS2A 4U6PA 4KH0B 1OS5A 2HNYA 2B3TB 2RKIB 2BW7A 2MPUA 1FRJA 3HZGA 4X4UA 2UXBJ 5KFBA 4DQPA 1T9TA 5J2PA 5IT9U 2DGOA 2RDDA 3H5XA 4MT1A 1RA6A 1JLGA 2BJ7A 1RK8A 1E6VA 4DL2A 3HULA 3G2XA 3H98A 3QLHB 3BF4A 3IG1B 5DQIA 1T95A 5HQ8A 3G82A 5K8MA 3KK1A 1H7WA 1X7VA 2VODA 4X4OA 3OFHA 1OY9A 2GIFA 3JAMU 3QWUA 1SC4B 4DSIA 1SJ1A 2E7XA 4N77A 2VPXB 4ANEA 3GJTB 3TAMB 1TELA 1WC1A 2L08A 5LSLA 2RRNA 1HFEL 2HWIA 1FRHA 3ZO7A 5GMDA 3Q0AA 1DARA 1RT1A 3FUYA 3GIJA 3PIPQ 2G2YA 1FNXH 1RKJA 2BRLA 4NOHA 4QIEA 2QN6B 3MDFA 4OLPA 5DQGA 4K4ZA 1U1MA 4EEYA 2XGQA 3W61A 2DK2A 4NLPA 5D3GA 4X4NA 4WU3A 2KT2A 1EZZB 4ZP7A 2ERRA 2HRUA 3M1VA 4J9LA 1FKOB 2V94A 4PEOA 5GAEU 2GFFA 4FXWA 4JV0A 4LR9A 2HBQB 5L9XA 3KLVA 1TL7A 5E3AA 1XMQJ 2NYIA 5G0RA 4WP8A 2YQ0A 1V3ZA 3N28A 3GONA 3E8OA 3D5MA 1F0XA 3OHBA 1NPPA 1SKRA 4ELVA 1HQUA 1QUPA 1S0OA 3DOMA 3WC2A 2R2SA 2AYEA 1U25A 2PEHA 2ZOGA 4ECRA 3RRKA 3NCQA 3QO9B 4CH7A 2GZOA 7FDRA 1R0BG 4CLYA 2DNKA 1JLAB 2NXJA 2D69A 3LAKA 5CH7B 2ATLA 3R2DJ 2VA3A 4FP9A 3PW0A 1H3DA 3HHLB 3J7YI 3L3CA 5I42B 4P74A 2NXEA 4K7QA 3KUHA 3GV8B 2OTJS 3D7SB 3DU5A 2XO6A 4DUTA 3HK2A 2LU2A 1CS4B 2AJ4A 4M5KA 2B7BB 2OSRA 2XLKA 4EYHB 2M7SA 3H4BA 3ENVA 4R5PA 3W5YA 1MNEA 1YK9A 1S4FA 2HIQA 3BR9A 1UWBB 3C8YA 4I2PB 2W4PA 4DV3J 4MIWA 4WXWA 1SJ4P 4QYZK 2WTFA 1NKBA 2R8KA 4RW8A 5F41A 3CDAA 1HA1A 2GVDA 2B9XA 1N8RT 3ENAA 4ECTA 1X4DA 1U1OA 4KAIA 2QYCA 4DV4J 2AD9A 2BE9B 2MZTA 4IKAA 5A8KA 4R8UB 4OIXA 2HVHA 1IVZA 3RYLA 3T19A 2CPXA 3E01A 1CLFA 4IUFA 2MZJA 1WOPA 4OI0A 4WPAA 3UWTA 1MMLA 3DC2A 1T9WA 3FFIB 4U95A 3SXLA 2VPWB 3PW7A 2ZFHA 1SUQB 3AD9C 1UA0A 4WK3A 4M63A 5L1KA 1W26A 1NDCA 2HQIA 5A8WB 3HMJG 4DV7F 2KFYA 1K0VA 1R0AB 1WTBA 2DR6A 1N56A 4X64F 4NLVA 2P8IA 4ZJQA 1FT8A 4B08A 4G1IA 2V8DA 4CO4A 1RCXB 2RMLA 3AOCA 1K1QA 3PO4A 1HBMB 4YR3A 2HQGA 4B02A 3A3OB 2OHDA 3T1HJ 1XWLA 5HMYA 3HHDA 1N52B 5E3QA 1FJEB 3TEGA 1PC5A 4FYXB 4OX9J 2LEBA 2XM3A 5F9LA 4N7TA 4USTA 4K5SA 4OX7A 1CC7A 4EMDA 3W64A 3M05A 4PZVA 1UEUA 1P27B 2HK2A 4Z7CA 4IG0B 4QOTA 2X3GA 2V0NA 1X4FA 4FYVB 2DT9A 3A3NB 4XIUA 1LEOA 3PTWA 1Q78A 2DGXA 3MPVA 4ZP9A 1NMEB 4AYBD 4DLEA 4LF1A 4DPUA 1UETA 5ADZA 2C3OA 2QE5A 2F3JA 5FD1A 1UJ4A 3MR5A 1PIEA 5H1SV 2H9ZA 5KFEA 5B0GA 3QFHA 2M8HA 3IFEA 5KT4A 3A1YG 1GH8A 4C8KA 3ZNJ1 2C1EB 4CCHA 1T05B 1XEZA 3KMSA 1FVQA 5JXSA 4GVLA 4P9SA 1RWMB 2GMJA 4JI3F 4QPTA 3M30A 1PBAA 3RW6A 1PC4A 1NKCA 5LMNF 5KFDA 4M5DB 4DV0J 3VAHA 3TANA 1C1BA 4ECQA 1WG1A 3M8QA 4LF7J 4RW4B 2DR8A 1P8GA 3R5BA 4I6WA 5C24A 5HMWA 2DBBA 2OPRB 1L3SA 3KHRA 3UE2A 3M8YA 4ED8A 4WE1A 1DLOB 1RCOB 4G1PA 3V6DB 2G1DA 3K5OA 2ZJRQ 1XERA 4F7VA 3V4MA 3JSBA 3P8BB 1M1HA 1HHQA 4I68A 3T6JA 1RT5A 4DPTA 2W2OP 4N8NA 2J6SA 1PAUB 2W24A 3V2UC 4DCPB 2MKHA 1EHWA 3S7RA 2F9DA 1D09B 1MROA 4PYDA 3FBCA 2IRYA 1UMJA 1RHJB 1QAXA 2B51A 4A4JA 4WCEQ 3RU0A 4FF3A 2BOAA 2CPHA 4RW9A 1O8BA 4ZVFA 4C9DA 4ICLB 1JJHA 1VRTB 3ISND 5KOXA 4USJC 4FNHA 4ECVA 4EBCA 2KG1A 2FLOA 2GMHA 2XMVA 2F8HA 3DI6B 2I38A 3GILA 2ZHOA 4ENOA 2WBRA 1IR2A 3TAPA 1F9FA 2FY8A 3SV4A 4UQTA 4ZCKA 3NMAA 1RTDB 2F4VF 5G4DA 2B4UA 1HLWA 1HPZB 4FPRA 1BLUA 4JV5J 4H4KC 1VQ7S 2FZCB 2WW8A 4K4WA 4UUXA 2DHAA 4ELTA 3PHEA 3KXDA 5EWEA 3IN5A 4EYIB 3PXGa 2DEJA 3EPIA 3FMBA 1V9OA 3PX6A 4OYBA 2VV5A 1Q79A 4OX6A 2CJ9A 2PMWA 2ZC3A 1NAQA 4ZN1A 2UU9F 1RTIB 3I4PA 4G1QA 4WIQA 5J2NB 3AD7C 1NJYA 1WWHA 5JVHQ 3SYZA 1X31C 1Y3JA 1A0OB 4JYAJ 3HLUA 4ZPAA 5HSPA 3I9ZA 3RB6A 5J2MA 2BX6A 2MQNA 4HHHA 5CYMB 1SCJB 5DGAA 4LSLA 2MSSA 3SDEA 3QNWB 2M5YA 5L38A 1N6QB 4FF4A 1T9VA 4Y3CA 3I4HX 2ZBIA 4TY8B 4HH0A 3KLEB 1H0HB 5E3RA 2D3UA 2D9PA 2MQQA 4JUZA 3O2IA 4MKAA 4P10A 1JLEA 3GIMA 4NLSA 4P72A 2OLWA 4JI4F 4K4VA 3KHHA 4IO1A 4ZLJA 3OFGA 3BSCA 2ATCB 4L75A 2KHCA 3AA8A 1SBRA 3LUYA 4Q8FA 4MMOA 4NI2B 5DZ6A 2E5IA 4NYPA 1CC8A 4F4ZA 2MQMA 1HNWF 1BWEA 1NK9A 2ZOMA 3OJUA 3GFZA 3Q8PB 2CJYB 1O6XA 4LIWA 2V2QA 4DU8A 1FDNA 1WUUA 3EGVA 2G2ZA 3MMAA 3LP0A 1PGZA 3OUYB 1IBKF 2DNGA 3NGRA 4OMFG 1JK9B 3T5KA 4DDFA 2XBPA 3C46A 3MGJA 2A6MA 1KLMB 1KVIA 2VB6A 1RWKB 2DGSA 1VQ5S 4WFAQ 5IV3A 3S1TA 2BKPA 3DMJA 4IR9A 3MCNA 3GE9A 2C2EA 3CJ8A 2R8IA 4Y2MA 1RHRB 2R8HA 3W60A 2EPIA 1O51A 2W8KA 1D8ZA 2WONB 3D68A 3HD2A 4ID5A 2IDEA 5IM0A 1NDPA 1V5IB 3RR7A 2AZ1A 4ZCLA 3UD3P 1VBYA 1C4CA 1C0TA 1ZYQA 1ZM2A 4YP3A 2HAIA 1D1UA 1WDDA 4ED5A 1JLBB 4PUOA 1YZ6A 4O0NA 2JEGA 1XR7A 4Q8EA 5T7LA 4KHPJ 2R7UA 5DETA 5MLCV 1VISA 5LJ5Y 4DG1B 5A8RB 3DLKA 1KN6A 2RU9A 1UZHA 2XZWA 2E7VA 1HQEB 2SXLA 5GAHU 4CT9A 1KEKA 4DFJA 2OPQA 3MCMA 5EUHA 3UN2A 2AYMA 5KFOA 2VFTA 1U0SA 2PC6A 1X5SA 3G86A 3W62A 2VKRA 2Z0GA 3NRBA 3UVJA 2AJ2A 1WKKA 5M2PA 3BBBA 1RTZA 2ASDA 1VLOA 3O1LA 2IAJB 5DM6Q 2XY6A 3FBBA 2XLIA 2IA0A 4DV6J 2DXFA 1WKJA 4DX8H 1T03A 5CZXA 4DF4A 5DG9A 5IXUA 1S6QB 4OHVA 4A47A 4ECYA 5F8JA 2HHSA 2WHOA 3NBPA 3DLEB 2R7QA 4LF9J 2VDHA 1MW7A 4WTOB 3K58A 3ZFVA 1TZ0A 4LF5J 2W2NP 2DY1A 3FMWA 4RW7B 2HVIA 4DSJA 2ZZNA 3NG8A 3AT1B 3MAHA 3AJDA 3IP0A 4OYMA 1CULA 3NGDA 1WDTA 3FEXB 2FZGB 2VG5A 4OZLA 2ZBPA 4UOGA 3B4MA 1T9XA 1WHYA 1AFIA 4EU0A 3NWRA 5AXNA 3IMQJ 1JX4A 2HG4A 3CD0A 3CCVS 3QAEA 2JX2A 3J7A1 2W9CB 3PRBA 2N3LA 3NS6A 1QJHA 3Q22A 2Y1JA 4NLYA 2R9LA 1ZA1B 5HATA 2W9BB 4ZCIA 3OVSA 3M9NB 3MM8B 3LP2A 4KT0C 2MQOA 3MD3A 2B8QA 3UO0A 1J5EF 3CDBA 1VRUA 2C2KB 4FN5A 3CJKA 4ANCA 1F5AA 3D1OA 2IRUA 3AOBA 1LW2B 5J2QB 1UTAA 1S12A 5D3GB 4CIOA 4DUYJ 4YHHJ 4Q2MA 4TLRA 1CSJA 4TN2A 1IKWB 2RD5C 4ZHRA 2YPYA 4DBQA 1UL3A 3LP1A 2ZH8A 2R42A 5HP1A 3KDOA 2EKYA 1K44A 5L1JA 5CCMA 2WVFA 2YVSA 2V8PA 4TU8A 4BHQA 2XNRA 5HL7Q 5DDQC 3IAS9 3VGVA 2Y8WA 3GYXB 5F8GA 2ZUGA 2CZ4A 4WWSA 3GLJA 5HN0A 4C8OA 1NCLA 2MHNA 3PW2A 1DHMA 1Q8KA 3MTJA 4FYYB 1FRIA 1JLCA 3CCLS 4D3GA 2RHSB 4NLDA 3GJQB 4O3NA 2XULA 1LXJA 3PR5B 4KO0B 2EG2A 1HBOA 3P49B 2EI5A 3DLLQ 1FFGB 2ASYA 3QJLA 1UEKA 3FQLA 4DL0C 5E33A 2B4VA 4EO8A 5DG8A 5D15A 4A8KA 2FVSA 1U0HA 3X1LB 3UDVA 4ED3A 3QT6A 4ZP8A 2WK4A 2KVIA 4FKXA 1WC0A 1QSLA 2DNLA 1N5TA 2PMZD 2XB2D 1RAAB 1G3OA 4P52A 4DQQA 1LK5A 2BKOA 3H40A 3UN5A 1TFYA 4F4WA 4V1Ak 2HNDA 1OMSA 1IR1A 5IC6B 1O5JA 3IA0A 2VASA 3MAAA 7FD1A 2MTLA 1B0VA 2FJDB 3AXKA 3TUIC 1LWXA 4JI0J 4PWUA 5FDLA 6FD1A 5HJYA 2CJAA 3PEHA 4NXNJ 4RW8B 5KFYA 4OX8A 2GVDB 1NSQA 1RJJA 4Y2AA 3WX8A 4YEAA 3M2VA 4CTAA 2RRBA 1NDKA 2BBEA 2VG7A 3MOJB 3RJMB 1YTYA 1C1CB 1TKTA 4J9KA 1Z2ZA 3UW1A 1ZETA 4DR5J 1ZPVA 3E01B 1M5SA 1WI6A 2IA6A 1SKUB 3GR1A 2VUGA 3DGPA 1VIXA 4CYUA 1QVFR 4CLWA 3DDNA 4WIIA 4ZJOA 1NRKA 2CFXA 5AE3A 1EARA 4KPCA 1YI2S 4LFBJ 2CPIA 2JZ5A 3H2VE 2V5HG 3M7VA 5E3CA 3LF0A 1M5VC 1SKSA 4DQSA 2H4YB 1I3OB 1LFWA 3DGVA 2WCXA 5ETTA 3NEKA 3EUNA 1VQ8S 2F4FA 3C16A 3J7ZT 3M32A 2VDIA 2OPPA 3BO2A 2R4FA 1FWLA 2ZZMA 2VH7A 1JNRB 5KFPA 4B3TF 1S99A 1FERA 2M3DA 3V5RA 1Y10A 2G0IA 3CGIA 2IDLA 5KFLA 4IG3A 2HMIB 2IM0A 2R8JA 2LEPA 3JTPA 2KRBA 3MM9B 4L6V3 2E7WA 2CPFA 3BEGB 2P9CA 2Z2YB 3QGIA 4QWCA 4WZMA 3NLCA 5KFCA 4K0KJ 4I7FB 3BGUA 4JBCA 1X0FA 2H3EB 4NLUA 3Q8SB 1VMBA 1Y3KA 5I3QA 4C7QA 3GU0A 1WC3A 3EZ5A 3T1YJ 1B0PA 5FIIA 1T3NA 4J90A 1RAGB 1H98A 1HMVA 5KFTA 3TI0A 2PDAA 2DR7A 1WSVA 5IZHA 3QSYB 1YVFA 1LV5A 1WORA 5IT4A 5LJ3Y 3DXBA 3CEDA 1EP4B 1V3RA 3CSKA 2F8MA 1NHVA 4IFVB 1YQHA 3Q89A 2FHMA 4EBEA 3K57A 4ATNA 2FHOB 4C98A 5DDRC 2RDIA 2AMCB 1U7LA 3J7AN 4QR0A 5AT1B 3M8QB 3T9ZA 1KOHA 5JJBA 3VAIA 1HNZJ 2LECA 3D28A 3GTYX 1DFDA 2B9YA 3IXQA 1NZ8A 4CLKA 2K1RA 2J8AA 4B9SA 2FPHX 4NLWA 1W2BR 4WE1B 5LMUF 2DNZA 3J81Y 4O3RA 2I0XA 4NRUA 1X5PA 2UZAA 3BN7A 2VOOA 2DNQA 2MKSA 2FJVA 2CQGA 1HI1A 1TR0A 5KT3A 4ZCMA 3DRXA 4DX7A 4F02A 2JJ4D 4USWA 1CEZA 1MU2B 1HR0J 4O4RA 1UVKA 2E1PA 1TL4A 3HVWA 4NLTA 2MQLA 3H2UB 4AL7A 4I56A 5T41A 2DNMA 2PA3A 3SSQA 5DDOC 2MY7A 2NYHA 3BPDA 1T8EA 4KIAA 4GKJJ 3OL7A 3OR1A 3BSNA 2ZH6A 3OD2A 3ZZTA 1UJ6A 1W7WA 2H5IB 3PX4A 3HHKA 1RHMB 4BC9A 1Q81T 3MUMP 5IT9Y 3DHWC 3AFGA 3E3XA 3NP5A 4ED1A 2W4DA 3L7UA 2HVDA 2GIQA 3JB9k 1VBZA 4KGZB 3NMRA 4DL4A 2VBWA 2YX1A 5E7OB 3RTVA 2E9RX 2CJXB 5L46A 3TQEA 4KKOB 1GNKA 3DYAB 3B8HA 1KC8T 5H9EJ 2CDQA 4B9MA 4I64A 1N33J 3I55S 1ELOA 2HNZA 4I2QA 4PXDA 1S97A 1C0UA 3A8JA 1SL2A 2A1BA 1L3VA 1DTQB 2DD8S 3K8VA 3TQ1A 3BS9A 4KC5A 2HWTA 1PO6A 3PFEA 3DKDA 3Q8VA 3LQVA 3SV3A 2QA1A 2JL9A 4DR2J 3D1QA 4CNZA 3VZIA 3T3FA 1DY3A 5GADU 2OMLA 3DRPB 2K3KA 4PXBA 1YG0A 4UF4A 3TNVA 1HYSA 2BDPA 1JMTA 2QT7A 1KVJA 2EG1A 2ZH4A 3R2CJ 2DNYA 2RE1A 4L72B 2LFVA 4A8YA 2GV1A 2E44A 4XO0A 2DH7A 4WU2A 1YITS 4TVAB 1S0VA 2UUTA 4WFZA 1K0TA 2MLZA 1CJTB 1B3TA 4DL6A 5GVQA 4PWWA 5KAKA 4LF4F 1NU4A 4QIFA 1I6JA 1F3VA 1Y7PA 1WELA 2Q43A 2AJ0A 3TA0A 2RKIA 2XTJP 2UV8G 3QJJA 4ZMMA 3M6VA 3EYZA 4NA3A 1RT3A 4F4KA 2MQPA 1IKYB 2YKMB 2CQPA 2HHWA 5AXKA 2KB2A 2IM3A 3D6HB 4JI2F 4K2XA 3F56A 5T14A 1QTMA 4WF9Q 3C14A 3MM6B 3QGPA 4Y00A 2IJRA 4LQ9A 2BACA 3P96A 3KWMA 3IG1A 2RILA 2HK3A 1IKXB 1HBUB 5CHCB 4B17A 5AJ3J 2FLNA 2W8LA 1D9DA 1HIYA 3TAMA 3ILLA 4NZ0A 1TVRB 5H9FK 1RAIB 3TAQA 4J9VA 4BWMA 2AU0A 3TZXA 1VC6A 4ZVSB 1HNXF 2CNLB 4NCGB 3M6XA 2Q6CA 4J9UE 1H2UX 3MTKA 3VAJA 2G13A 2DGQA 4KJIA 4DV3F 3OSNA 1SV5A 3FCWA 4CM0A 4R25A 3AXMA 1CJKB 4CZCA 2FY1A 2NZ4A 3PRDA 4WTYA 4U7UD 3NNAA 4M94A 5D4PA 2KM8C 3OVBA 4QWBA 3OTEA 4ID5B 3ISZA 2B9WA 3JQKA 3CDEA 4DV4F 2ZKTA 1NHUA 4RW6A 3NAIA 3W7BA 4PABA 1HARA 1FKOA 1Q4RA 3ELHA 5KFHA 3K2YA 2G1HA 2FHJA 2J7KA 4O23A 5K8OA 1YKWA 2Z8QA 2XHCA 1ZAXA 5T7LB 3ZZPA 4MKVA 2WOMB 1AT1B 5B7WA 3OR2B 3ZXWA 4AFFA 4EUVA 3A12A 2V50A 4Q7AA 3NOCA 3D66A 3NY0A 5H9EK 1FRKA 1ZM3A 3QO9A 4DR3J 3KK3A 5ETRA 1WACA 3P5TL 4WJBA 6AT1B 2QSFA 4DS4A 3CJ3A 1JLAA 5ETVA 2AGPA 2O67A 1EAYC 3KLFB 1KOOA 4X66F 4U7UK 1EKSA 1VI7A 2HQDA 3BV8A 3EJMA 2QO3A 1X4GA 5KG7A 2ADBA 4MFBB 2Z58B 2OEJA 3HHLA 1S9EB 1TUVA 2C2ZB 3UN3A 5K14B 1P1LA 4ZK7M 5BR8J 1VCTA 2Q3PA 1K8AT 4WYLA 3Q2TC 4ITSA 1O0PA 4NA1A 3RB3A 2NUHA 4B9LA 3ETOA 1VQOS 4DV2J 3H90A 1CS4A 1N32J 2J7UA 3IC1A 2YWFA 1RYRA 4P2MA 4HTIA 2EVZA 2I9SA 3IWNC 2D3O1 3GG1A 5GAGI 1Q95G 1UWBA 4E8UA 4URGA 1VDHA 4OI3A 5B09A 1FXRA 3TJ9A 1VOMA 1WTFA 3HKZD 3IBCB 4YY3J 3POTB 1S77D 3AY0A 4ZS6A 3GYNA 2Z2ZA 4L3NA 4N5SA 5EWFA 3M8RA 2HZAA 3HF5A 1N36J 2DB1A 4O3QA 3MURP 2DTJA 3BGOP 1XNQJ 1PSDA 2IM2A 3BO4A 3ZZZA 2XCAA 2Q79A 4WZQA 2Q1LA 2AYBA 2UUAJ 4LUBA 3K5PA 4LREA 2LQ5A 1YIJS 4B3RJ 3FFIA 1SUQA 4DR4J 1VRUB 1S1UB 1R27B 2YNFB 1UW9A 4H4OB 3I32A 5F0WA 3DLJA 5E5NA 2NQPA 4YB7A 2BJDA 2CJBA 4YS2A 1FEEA 2W4CA 2FJEB 1HNVB 2AGOA 5A8WA 4LVNP 4RWXA 1R6YA 2HSEB 2H5EA 3LP1B 3QSIA 1OSCA 4X4SA 2IHR1 1GFWB 1K1SA 2MDAA 1Y0HA 1HW8A 2QG9B 4X4TA 3IR7B 1OY8A 1KKHA 2C28A 2MEWA 3FVYA 3QIPB 4RKUC 1GTEA 2KZMA 1UPPA 1FRXA 4PPZA 2BABA 2AP6A 3QGHA 4P7TA 1R89A 3T5LA 5AE2A 2XQCA 2KTQA 3RB4A 4QU6A 2GJFA 2FJWA 2R7SA 4CDIA 4IG0A 1JLCB 2F7VA 3RR8A 2JC1A 1FFWB 2V68A 5KG3A 5ETNA 2HFOA 1Q53A 3N6LA 3PIOQ 2R7RA 1U47A 1S4EA 3M2RA 2JFKA 4OZ1A 2YKQA 2FJAB 1UVNA 4ZPTR 2FUG9 2UUCJ 4QCLA 3PHTA 1N5SA 3OTOJ 3G8SA 2IJNA 3MM5B 2K8GA 1ZTWA 1I94F 1ULRA 2QMWA 1TMMA 2LXIA 4TY9A 3MFHA 1YRUA 4A8SA 4ZPVR 3L7OA 3KNGA 5D4LA 4Y34A 1T05A 2VU5A 4UOFA 1QDUB 3G6XA 3ZTSA 5DJBA 3THPA 1U49A 1RBOB 3FZ2A 3CD6S 2LXFA 3UNYA 3TO8A 1FESA 1QD1A 2ZDOA 2IMOA 1PJ7A 3B6BA 3F73A 1P6TA 4M5DA 4RLEA 1YJVA 1RUSA 1VK3A 4RW4A 5BJRA 1TKTB 2R8GA 5KFGA 4ETZA 1FA0A 4DU7A 2OPRA 3BB5A 4JYAF 3GJSB 3OPKA 2ZH7A 5EX3A 4X4QA 3FSYA 4DV5F 2W7OA 4J9SA 1SI9A 4DWIA 4M5LA 1DZ5A 2W7AA 5D0RA 2GQCA 5EDWA 4KPYA 4ES3A 4TU7A 4HI2A 1NUEA 4Q5VA 3KYLA 3SCJE 5C2GA 1KONA 1F5BA 4QYRA 3CMAS 1M5OC 2J0WA 4PR6A 3IM8A 4PG4A 3TA1A 4BS2A 1FI4A 4LF8F 5HROB 2KYZA 2X1AA 3OFFA 1LFPA 3IWXA 1PILA 2O01C 1RLDA 2R7TA 3NCPA 2VQFF 1AZSA 2KKHA 4HTJA 2CA9A 3D0HE 3GFYA 2FJBB 3NNCA 1P9YA 2NSCA 4CI0B 1AA1B 4RJVA 1SJ3P 1TAQA 4ICLA 2ZHAA 2P6TA 3BBCA 3RRHA 3KLGB 4IG3B 3CJ2A 3EWGA 1NEEA 4J9QA 2ZM6J 1KD1T 2Q66A 2A10A 3DI6A 5E2QA 3KLHB 2X51A 4F26A 3S8SA 1KQGB 3BGRA 4DV1J 3W5ZA 2HURA 4KRWA 3EPGA 5IOLA 1ZAVA 4USUA 1RTDA 3W1YC 1TUWA 4OI2A 2RQKA 1HPZA 5EN1A 2Y1LB 4NMLA 2R7VA 4ZVRB 4F36A 1JJ2R 5KT2A 4J9RA 4K2JA 2BKNA 1HHSA 1KSPA 3D4JA 1HMVB 2I1RA 2GJ2A 4YMEA 2MXYA 3MHYA 2OI2A 2MB0B 4JI1F 5A6WA 3CIZA 1RTIA 1X0PA 5J2NA 4E2FB 3MR7A 3KJFB 2CPEA 4NCAA 1R3NA 3ENWA 1VQ9S 3CW2C 4RUCA 2VBXA 2F65A 3ZTOA 3FDSA 4P75A 2CIMA 3VF0B 2YKAA 5HVGA 5BYSA 2DIUA 1AW0A 3PYFA 1M0SA 1N6QA 1C4AA 3FGVA 4ID8A 3B82A 4RNNA 1XK8A 1SJQA 3O44A 4TY8A 3H5YA 2CRLA 3KLEA 3KJNB 2QA2A 4QWDA 1Q8BA 1FFSB 1VBKA 4ER8A 4DCJB 4DN0A 2O3DA 1WOOA 3MR6A 3IS9A 4F2SA 5J1PA 3N79A 2DO4A 3TWZA 3HXMA 4A8MP 4DXLA 2OJ3A 5M2RA 1BQMB 2RUSA 4NI2A 4A8OA 2RHQB 2DY9A 1X4CA 1N4LA 2E5LJ 2V6AA 3LPYA 2R2TA 2ROPA 4LRDA 2GO8A 1TV6B 2ILZA 2PN6A 1U2FA 2W2QP 2OFHX 4K4SA 1TL3B 4WBFA 2HBYB 3HVTB 4IYQA 3OUYA 3OR1B 3ZTPA 4AXIA 3HT0A 1KLMA 3QATA 1HBNB 3TVYA 4JV1A 1GXLA 4X64J 3G4SS 3KK2B 2E1AA 2M8DB 2HIYA 4TU9A 3H5SA 4N56A 3CC4S 1QVGR 1NK8A 2XC9A 2WONA 2MSTA 2DISA 4OLOA 1NXIA 3PW5A 4B9UA 2FHJD 4PG5A 4NLRA 4H4KA 1PJ6A 1VR6A 1UA1A 5U47A 2F9JA 2L3MA 2DXDA 3KG0A 3UD5A 3B78A 1TUGB 1NJWA 2ABYA 1Q0NA 2D9OA 2BEFA 1VQLS 1JLBA 2ZH2A 2G0CA 3AODA 4DCOB 3M8SA 3PACA 5A8RA 3CJ0A 5KFFA 3WBZA 2B8PA 3N5BA 3NAHA 4L76A 2CPDA 1KDNA 3H59A 3R1LA 2NLWA 2XSJB 1HQEA 4OQJA 3UR3C 2A6OA 1LKZA 3IRXA 2LMIA 1IBMJ 2MGZB 2Z2LA 3WHIA 1VQYA 3SQGB 3T5JA 3W8PA 1BQNB 3JS9A 4NASA 4ECUA 4C8MA 4C0OC 1WHXA 5IWAJ 2IAJA 2O66A 3PJ9A 2DHGA 4ED4A 3W2VB 4FZVA 3V6KA 1VFJA 1S6QA 2CNOB 2YQ1A 9ATCB 4DSLA 4HDHA 1LW0B 1LK7A 2ZE2A 1GTHA 2XYHB 1RT3B 3DLEA 3C15B 4JI3J 3NWGA 3HFKA 3KUGA 2V2VA 1UVMA 2D3OR 1EB0A 5LMNJ 3V6JA 2AEMA 3BKFA 4ECSA 4RW7A 4W90B 2XS7A 3DNCA 3C14B 5CYQB 3THVA 4CO2A 3QZ7A 1GX5A 3OTCA 1FNOA 3AH6A 3GSDA 4Y2KA 1X9MA 2BANB 2Y1IA 1R8PA 4ZPDA 3BDEA 4QR2A 1GMVA 3PNIA 3I5AA 1S59A 4RU2A 5C25A 2FVPA 3EGWB 5CD4A 2Y3YA 1BD6A 2W9CA 1R8AA 2ZH3A 2ZDPA 2G9OA 2QLBB 2ZBCA 2W9BA 2DITA 2DNHA 4KQZA 3MM8A 3IAM9 1SV5B 2MQ8A 4DR7J 1J5OA 3PYGA 4DI6A 3L9ZA 4RR5A 1RHKB 3HHNB 1MLAA 1H72C 5CXTA 3U1LA 3PO5A 2XWYA 5K9FA 1NJZA 1LW2A 5J2QA 2A3JA 3M6WA 3O5TB 4RW6B 3B4DA 2G2OA 2LA6A 2YX7A 2NUUG 1IKWA 5IV4A 1ZOTA 1HNIB 1AYEA 3N6NA 1URRA 2IBKA 2NPIA 1UP1A 9RUBA 1KTQA 5GMKa 1S6UA 3OV7A 3RBEA 2OEKA 1FWPA 3Q2SC 3KMQA 2W25A 2MYFA 2HRYA 2ROGA 1IJEB 3GV5B 1RHQB 4K4TA 1JWWA 1WEXA 3BBFA 3KK3B 5A76A 1ITPA 2B9EA 4ZN3A 2WSCC 1T94A 3O6QA 3CCQS 4KO0A 1LXNA 2VG6A 2UUWA 2ADCA 1WG4A 2RF2A 4DPYA 4NA2A 2CJQA 2FHKA 2VPYB 2UU9J 2RB7A 2X1BA 4P71A 2D3ZA 5DG7A 1RBLA 2AJ1A 1M5PC 2VHGA 1X60A 3UCGA 1LQ9A 2AZ3A 1N54B 1X5TA 5D8HB 4CNYA 3CC7S 2EFNA 3RB0A 2LQ8A 1NHKL 4FXVA 3I5BA 2CKWA 3LWLA 1SH2A 2ALYB 3D6FB 2NCKL 4ZLNA 4K0KF 2BVZA 2A18A 3FNNA 5CABA 3S6EA 4DF8A 1M5KC 3I9V9 1VHIA 3C3LA 1L3UA 4ZLPA 4UW2A 4FF1A 1NZAA 2GX8A 3KLIB 3D6TB 1YJWS 4JI4J 1F2HA 2CQHA 3ET6B 1FJ7A 1KQKA 4CLPA 3ZTRA 3LALA 3MECB 3MEEB 4MYTA 1U1NA 3VALA 1C1CA 4JB8B 1RZMA 1UVLA 4ALZA 3KJQB 4CLZA 2OKQA 1NPKA 1HNWJ 2FIUA 4YR2A 3IBFB 4C11B 4PRFA 1Y5NB 3CJRA 1RTJB 3LGMA 2YKNB 2HFZA 2ZBQA 4JI6F 4DOZA 4IO9Q 3BO3A 4J9OA 5CCLA 4ZIWA 3BYRA 1F60B 2CG4A 1IBKJ 2LDIA 4RBVA 1RT7B 4C8ZA 3RG6A 2C3PA 1HNZF 2HEKA 3GPAA 3KG1A 3TOQA 4TYAA 1UFLA 1JNZB 3GFXA 5KG2A 2KXNB 3CJQA 4MKBA 4UZBA 3K8WA 1RP5A 1IUJA 2RNEA 2B6AB 2M88A 4ECZA 2CQIA 4LR8A 3GQCA 2HKEA 2N7CA 3AB2B 3GIIA 5A2QU 4O0IA 4NXMF 4UZCA 2DCUB 2HMIA 3TZYA 4EZ9A 2VFRA 1HWLA 1YJNS 3CWJA 3K89A 4E0DA 2GJIA 3C6TB 1IJFB 3MM9A 4Q43A 1HI8A 4B3OA 5D0HA 3DLGB 2L48A 1XN9A 2FQQB 3M2RB 4I7FA 4FKYA 4MK8A 2ZHBA 5ETMA 2V67A 4QIGA 1HD1A 4B9NA 5DLGA 2E9TA 1B70B 3D9BA 1KBRA 1S9GA 1S9FA 4KB7A 2X7IA 1EP4A 4NLGA 3HO1A 3QZ8A 3MCOA 4IFVA 4Y2CA 4BC7A 1ROFA 2J76E 2LLZA 1NBEB 5K5MA 3I0SA 1RA7A 1R8CA 2DXEA 2DCLA 2RJZA 3PW4A 3VV2B 3N6MA 2ZKUA 1XTZA 4YB5A 2WVEA 2PI4A 3HHEA 2OD6A 2CDRB 2AJFE 2ZWPA 1YWXA 2FLLA 4JI5F 3SCKE 3PKMA 1C2PA 2CQ1A 2E5HA 2RS8A 2JRSA 2HHVA 4OHWA 2DNRA 4DHVA 4ANDA 4LBIA 3E2EA 3FSIA 4IFYA 2WSEC 1NLKL 4X65F 1RDRA 1UCNA 1U1KA 3I82A 2VQEF 3EZUA 2BJEA 4OZJA 3CCES 4HHUA 1MU2A 1NB7A 4URQU 4V19J 1B4SA 2IIHA 5LXYA 3IGNA 4PG8A 4MJKA 3DRYA 3CXCR 1GMWD 3TJ8A 2J9CA 1JKHA 1J5EJ 4OJHA 3UCZP 2RU3A 2XNQA 4LSZB 4E98A 1WHVA 4DR6F 1AZSB 2RQ4A 2CQ2A 3Q83A 4HH1A 4PCQA 2F63A 1UWAA 4G65A 3CMQA 1VQ6S 1EX8A 2NXUA 1RABB 4KKOA 4M5JA 3MZIA 3GMGA 1RWUA 3DYAA 2J8SA 2PI5A 3T1AA 1XMOF 4DUZF 2YWHA 2NZCA 1YJRA 3BGRB 3WQPA 3M9MB 2Z30B 3IR5B 3L09A 4B3SJ 1RI7A 2YKOA 3C2PA 4F2RA 3VWSA 1DTQA 2FDNA 3UNGC 2KDOA 5KFVA 4QJVA 2HHHF 4RUHA 2ROEA 3U1NA 4ED7A 3CF5Q 3M8PA 2XLJA 3JYTB 1F5CA 2QIFA 4QW8A 2M0GB 3TARA 2POKA 4ECWA 2R7OA 1WI8A 3DRPA 1TL1B 3M8WA 3FC9A 3MFIA 1U09A 1RTHB 2CAJA 4C3KA 4CLTA 2BA9A 3CCTA 1KQFB 2JC0A 4OZ5A 4RUBA 4NE9C 1QSSA 4PXCA 3EICA 2PFDA 3OLAA 1N5YB 3JQMA 3CCJS 4OHYA 1B0TA 2CQ3A 5GMEA 3W65A 3QBCA 5D0EA 2IYIA 5B0FA 4KGVB 3TP2A 4RU9A 2ZJPQ 1OO0B 1CJTA 3MMBB 1Q86T 5KFSA 2QGFB 4I1TA 3I5CA 3TZWA 5J1EB 3WIUA 1QAJA 2WBMA 2XMUA 5K20B 4ZVOB 4WFXA 3R5DA 4LFCF 4GO5X 3VQTA 1FJGF 2LYVA 3CPWR 3R3TA 2EEYA 3HSGA 2UXCJ 1SKWA 4BLGA 1IKYA 4FBUA 2YKMA 3BYPA 2L9WA 3EMTA 1U02A 3G6ES 3IS9B 2FGCA 2H48B 1A6LA 2U1AA 4PKDB 2BM0A 1YBTA 2LQ9A 4YB6A 3MPUB 4K50A 1L3KA 2XEXA 3MM6A 2DO0A 3F0NA 4HACA 2HFVA 1D0EA 8AT1B 3ETMA 4DPOA 1VC5A 1IKXA 1HBUA 2PT0A 4NLOA 4KHMA 1REGX 3R7NB 3OL9A 2DYAA 3V4IB 3AJ1A 2DGVA 3C6UB 4O3OA 1KFSA 3B54A 2IJFA 4DL3A 1REVB 1TVRA 2YXLA 4LSNA 4A8QA 4L73A 2EBEA 1GXUA 5D4NA 3KJVB 4NCGA 8RUCA 4AUKA 4OYZA 1RADB 4M5IA 1CJKA 4ECXA 2K06A 1R8HA 4M8LA 2BRKA 4DPWA 2HVEA 2BW2A 2EFGA 4X62F 1FKPB 3PZPA 2QLWA 5KFNA 1M90T 3SZ2A 4RNMA 5BYQA 1SC1B 2I5JB 3IM9A 4IRCA 1JXLA 3QWPA 1X9WA 4URSA 1TKZB 2I8EA 2QC3A 4J37A 2YH1A 1FTRA 1RHUB 4LF6J 2WOMA 3MEDA 5LT5A 3OR2A 3SIPB 4JI7J 1GXTA 4HT7A 4M5GA 2VF3A 2V8VA 5CQGA 3CD5A 2DGWA 3IRXB 2BQ3A 2V4JB 4AD6A 1RT6B 2Z57B 1HL6A 3KLFA 2XS2A 1UPMB 2FC8A 2GGPB 1RLCL 5FJ4A 4X4RA 3EGZA 4MFBA 5EGYA 4FS2A 2DVIA 2KJWA 1TK5A 5ETSA 2XMTA 1S9EA 1FJCA 4ZP6A 2KG0A 4W92B 3A13A 5K14A 4TQSA 1Y00A 2JHEA 2AQ4A 1WC6A 2ZE2B 1TAUA 5GAGU 5EHHA 1WKLA 5HVFA 2DRBA 2M2BA 3DXSX 2CWKA 4OFZA 4QWEA 2E5GA 2YPZA 2A2CA 1ZS6A 4ZIVA 1RWNB 3TW0A 5KG5A 3Q23A 2DGUA 4YN3B 1GX6A 1KHVA 1JLFA 4H54A 5IFMA 4BDPA 2DNOA 3HJFA 1F6TA 3EZOA 1TMJA 3C19A 3RUBL 2IYGA 4EGLA 3POTA 2LP4A 1S7IA 2HQCA 4R0EA 3G8TA 2WB1D 2N4DA 1WJ9A 3OL6A 4RNFA 5LMUJ 2HFSA 1X4AA 4FXDA 3BJYA 4RX6A 1PG5B 5C25B 2ZJQQ 3UD4P 2ZUAA 4RBTA 1UJ5A 4FVCA 4EI2A 5JMNA 2F8EX 3RAMA 3KUEA 3D3BJ 5HANA 2BJ1A 2UUBF 2D74B 3TA2A 4QQBA 1N88A 2WB4A 1IKVA 3FRZA 1AROP 3HHLC 5C5JA 1J5OB 2IC3B 3W5XA 4QIWD 3JSMB 2YNFA 1S1UA 4H4OA 4F3OA 4CQ1A 4GKKJ 1FCAA 4DR1F 3EVOA 3ICLA 1HNVA 1WF1A 4J5OA 2LEAA 2CZVC 2BE2B 2PEBA 2GCFA 4HT5A 3H20A 5LOQA 1PYSB 3JSRA 4TQRA 3Q8RB 4I67A 3SEOA 4KSEB 2OO4A 1XIQA 3K17A 4M1KA 3NNHA 1FDBA 2EFQA 3HZEA 3UCUP 2B5JA 4ZITA 2JOQA 5IQ6A 4IR1A 3GFHA 1G2EA 4ED0A 4WKRA 4UQGA 2DNNA 3QIPA 2HGLA 4WK1A 5FLXU 2LA4A 2OPSB 2D1CA 2B4PA 1B64A 2UXDF 4KH1B 1U1PA 3WX4A 1V6HA 3ZZ0A 2ZWOA 1YJ7A 4MK7A 1RYSA 2CNNB 1X4BA 1Q7YT 5L39A 1MWYA 1M1KT 4AT1B 1XBWA 3VQSA 2CVEA 1ICEB 3LWMA 2L9DA 2J9EA 1NK5A 2RUGA 2VG6B 2HHPA 3EVWA 4LR7A 1GK8A 2C2OB 2RF2B 4U8VA 2H65B 2K7JA 1T9YA 1KQSR 3SFGA 1QSYA 5SZTA 2CQBA 1PKUA 8ATCB 2V69A 2HBZB 4X2BA 1X5OA 3LOUA 2ZM6F 1ZZFA 3MM5A 5D77A 3RAXA 2AGQA 3BGFA 5JUMA 2WVDA 3U27A 5KFZA 4CP5A 1ZH5A 2BJ9A 3QRRA 4RNOA 2J0SD 1DAXA 4DV1F 1ZZNA 4LF4J 2YNIB 2N82B 2BR0A 4K59A 4OI4A 1LWCB 2KZZA 3CUNA 1CJUB 1NM2A 3LW5C 3IRWP 1F2GA 1Q7LB 1BHNA 4AL5A 1F1BB 2DHSA 4Q0BB 3UI3A 3HD1A 2V8GA 3DCAA 3RGIA 4IH6A 1E6YB 1WC5A 4JI2J 3M2UA 4LT6A 4YOEA 3OXGA 3CMES 2XMKA 1FXLA 2BOPA 1I51B 2B56A 2DPIA 4OV1A 2GHVC 4YR0A 4BCAA 2UVRA 4DX5A 3DM2B 4C97A 5HQMA 1XQIA 2GIRA 3PY8A 4UY8T 1FF2A 3OFEA 4LJMA 3BH7B 1L5UA 3HCXA 4ERDA 3W63A 5DM7Q 4YQWA 4EZ6A 1H74A 3KG4A 1RT4A 5HQLA 3CCMS 1OPIA 5C42A 1HNXJ 3LA0A 5DDPC 4G6VB 2HHUA 5A0YB 2AWZA 4YUDA 4AXJA 1U6ZA 3BSAA 1Z2LA 4EK2A 5HROA 3TRGA 1SJRA 1BUXA 3HFVA 4OZ2A 4GC6A 4RO0A 3BH6B 3BKUA 5SUHA 3G71S 1QAIA 1B7FA 4ES2A 3KTQA 3QPIA 2Z4PA 1R31A 1N34J 2XYPB 1UAWA 2YNHB 3D67A 2HS3A 3TX0A 1SIWB 3OSPA 4DJBA 1KR4A 2E5LF 3R9LA 3KLGA 1VBXA 1H6KX 3I87A 2FLPA 2JEIA 3DOKA 1XNRJ 3LO3A 3KLHA 2BUNA 1LOUA 4A46A 2ALZA 1VQPS 2ZD1A 4QW9A 4NYOA 4B3OB 1SL1A 3DOLA 2YBVA 3MMCB 2YKPA 3ULHA 2JEFA 2HS4A 4KHRA 5KG4A 4NEYA 4JI8F 4USVA 4F3QA 5HBMB 1S1VB 1XC9A 1EETB 5J1NA 3L95X 2JDJA 1S1WB 3TJAA 3R5CA 3G96A 3W2WA 4DS5A 1KRPA 1AFJA 2WW4A 4X66J 3LGNA 1YZ7A 2Q6BA 4UTGA 4P2SA 2ACMA 4CM2A 1Y5LB 3TUZC 5HVHA 1S9GB 3I31A 2VJUA 1R43A 3UR0A 1NK4A 2QFIA 1IBLJ 2EBGA 1UVJA 4U96A 3GG0A 3FCVA 4PG7A 2X1GA 4A8WA 3TUJC 1T9UA 4ZVQB 1PCAA 1KFDA 1YHQS 1ZPWX 1HWUA 3H7HB 2FB0A 3I0SB 2KFNA 3QT7A 4AE5A 4OYAA 2JSXA 1QE1B 3SCIE 3R27A 4OYXA 1UVIA 2RDJA 2ZVIA 1BXNA 1OQ6A 4TLQA 4IRKA 1HWIA 4JP8A 1J27A 3P45B 4LFAF 1AUDA 2PFFB 1IN0A 5F3ZA 4O44A 1H73A 1IBMF 4K4UA 1IM4A 4IFYB 2AV5A 1ZBTA 2M70A 5B0CA 5L9NA 4HDGA 4LBHA 2QFJA 3MI7X 1FEHA 5HLFB 3HFZB 2QV6A 1YBAA 5IWAF 3DFEA 2CPZA 1VC0A 1K73T 4AQYF 1BQMA 1YJTA 3GP9A 4OYIA 1SPBP 1M1GA 1GMUA 3EM1A 1TV6A 4UOHA 4CH1A 3RBZA 2UXBF 4FPIA 1JKHB 4KV8B 1TL3A 3HVTA 2OMOA 3UFCX 5KFKA 2V63A 1T7PA 3KNAA 4KFBB 3JTNA 1HBNA 1VJWA 4F50A 5AXMA 2H4WB 3R5JB 1NNDA 3KK2A 2AX1A 4YDDB 4CLSA 4H4MA 3I0RB 1U1QA 2Z2MA 4K5RA 4CLUA 4F0KA 4IQXA 4P6QA 2YNGB 3V81B 3KHLA 4NYZA 1RAHB 3O8WA 2HBRB 3QGGA 3CNQP 3JAMY 3R8YA 4XPCA 4PQUB 1UKUA 3GCWP 2WAQD 5LSRA 1YLXA 3HVAA 2QX0A 3IWLA 2AX0A 3QYYA 2BMBA 3N5FA 4PWDB 3CJ4A 4OJ3A 4DR7F 1LWFB 2W2MP 3M8PB 2CQDA 3HM9A 1RAJA 1RT2B 4ZVTB 4B3MJ 1NK6A 2HQFA 2UV8A 2I6WA 1JLQB 2XSJA 2JVOA 2CJKA 1LWEA 5CD4H 2V9WA 4NZ6A 2MGZA 3BREA 2V4RA 3FSXA 3DLHA 4CLFA 3SQGA 2QSWA 1BQNA 2QMUB 3KDNA 4ILRA 1XMQF 1I94J 3LPEA 4YB1P 2WRMA 4PYAA 3FZBA 4MH8A 2EXUA 3GSIA 1JJ4A 3VAGA 1CVJA 1OIAA 3MM7A 1TKXB 3G87A 2XI2A 3W2VA 2XWXA 4WFYA 2K3IA 4ED2A 1S6PB 3MEGB 3ISNC 4P2FA 4O4GB 1LW0A 2DGTA 2HZVA 4IOCQ 3C15A 4U8YA 3PX0A 2PGCA 5K8NA 4Z37A 1S76D 3MR2A 2BXJA 1YX2A 2B7CB 2CPYA 3MPWA 5DRKA 5CYQA 4HACB 1SH0A 2XMJA 1IQTA 3CCZA 2ASJA 1TK8A 3A8IA 1T11A 2BANA 3MF5A 4C3MA 3O3LA 1XMBA 1RISA 4WXOA 2H54B 2KT3A 3WIVA 4DV5J 3VGSA 1JXVA 3FK4A 4XDDA 5D0GA 4LIRA 1OYEA 4LSNB 2JLGA 2RIJA 1MWZA 2Y1RI 2VONA 1FTCA 1H7XA 2QLFB 2AF6A 2CQCA 1SH3A 4LF8J 1DQ9A 3UDCA 4KBIA 1S10A 2JEJA 1WG5A 2VFUA 3GJRB 3QT5A 2HPUA 1OY6A 2FGOA 3ZNUA 3W9HA 1CJVB 2ZH9A 3WC0A 1VYAA 3NKYA 2WVCA 4QR1A 2IVFB 1S1TA 2W7PA 2XYGB 2VQFJ 2P2CB 2N7YA 2HVZA 1BWVA 2P9GA 5D4OA 3PEJA 3ADAC 4C3LA 1BQXA 1NSAA 3RBDA 4Q44A 1GQEA 4I69A 3PV8A 4ED6A 1HNIA 2MJNA 2CG8A 4ZLLA 2YH0A 1BC6A 3K5NA 3DDIA 1S79A 4NPOA 4QU7A 4ZDNA 2IBOA 3MEDB 3R6GB 3ITHA 3SMZA 1VQMS 2DH9A 2GVZA 3VVTA 3U1MA 3N01A 1BGXT 3CO0P 5JVGQ 4OJ1A 2RH3A 2BJ8A 4ZVEA 3CVKA 1D9FA 3FEZA 3J7YU 4PPDA 2HLTA 4TYBA 1NJIT 4GVBB 2XS5A 4C6AA 3T1HF 4PAAA 2OIHA 3QT8A 3AAWB 2GHPA 2J6UA 3HJVA 4JI1J 2PMHA 1NB2A 4P2XA 1H2TZ 4M5MA 1F9EB 4OX9F 2ZVSA 1RWVB 1UW4A 2B43A 2A2DA 5KFAA 2DRAA 2BYCA 4FDFA 1S5ZA 4LRFA 4DFKA 5F9NA 4QPXA 5A2QY 1CQMA 2W1BA 1B99A 5I3UB 2X3DA 2IY5B 3VHQA 1B7YB 4KE5A 1YBUA 4GC7A 3BPSP 2BV3A 1JLFB 5HJXA 3BM7A 5E0OA 1SQFA 3UDLA 4M95A 5I3PA 1R0CB 3KLIA 5THWA 1S1XB 3DRSA 3PYDA 2OH2A 3ET6A 4FVMA 4ZJLA 2GAHC 3J80U 2HWHA 1VQ4S 3TYTA 1M5HA 3MECA 3MEEA 3FBEA 4DFMA 4NRTA 4OZNA 1VK8A 3P3DA 1FE4A 1IBCB 2VC0A 3H25A 4ELUA 2XY5A 2HNYB 1IKVB 2KM8B 4KYZA 4C11A 5ITHA 3EDRB 4LRAA 1RTJA 2YKNA 4K4YA 1FDAA 2R7WA 5J2PB 3M4XA 3U7JA 4P7VA 3SCLE 2GW8A 2OP5A 1JLGB 2ACYA 2AHOB 4DV0F 1FVSA 1RT7A 1E6VB 2ZC4A 4LF7F 4FS1A 1X4HA 3TEHB 4F8RA 3LANA 4P73A 4XDCA 3G82B 3IBWA 2HGNA 3KK1B 2XSFA 3JXOA 5ETPA 3MXHP 2AT1B 3ZZRA 5KFUA 4USIA 2V34A 6FDRA 2B5JB 4JOUA 4D3HA 1UFKA 2B6AA 1HQ2A 1TQLA 1NJXA 2MHEA 1CQNA 4FYWB 3N4WA 2BE7D 2BQRA 1G7CB 1ZM4A 1N5VA 5HO4A 3SBMA 1DTTA 2DKOB 4LQ3A 3LAMA 1RT1B 4CO1A 4ZVPB 4FF2A 2EW9A 3L4BC 5ETQA 1G1XA 3CCRS 3NL0A 1HWKA 2R7XA 3NGSA 4C0HA 3C6TA 2GS8A 3CJTA 4QWAA 2D7SA 3M6UA 3DLGA 5ETLA 3AHPA 3C66A 3CDWA 2VIHA 4OYOA 3T6BA 3CD7A 3US5A 2QL9B 3M1VB 1BMQB 4GRSA 4CLLA 1H2VZ 3VR1A 2OD4A 2J6TA 1FHTA 1SB6A 1FKAF 1S7HA 1Q5VA 2FJXA 1TL7B 1RAOA 4W98A 3I56S 1YJ9S 3PJWA 5G0RB 1L3TA 3DN9A 3GV7B 2F1FA 5GAEI 1TKDA 4KGXB 1MSWD 1D8YA 1OWXA 1HQUB 4B3SF 3DOMB 4IH5A 5DGBA 5L1IA 4JV5F 3OTBA 2DR5A 3G6VA 3EDQB 3BR8A 3CIMA 2MZRA 4L74A 2CZ9A 2HYIB 1IQZA 3CO9A 5LSOA 4Y2IA 5DLFA 1AXQA 1W25A 1PYTA 2V2ZA 3M2UB 4NLQA 2QZ8A 5KOWA 2FVRA 2CVIA 5KFIA 2XG8A 1T02A 2LKZA 1KHWA 3I6PA 3THTA 3TR5A 3KFWX 4IRDA 1RAEB 1YJUA 3GWCA 4U9RA 2BM1A 3A4TA 4OHZA 3OTDA 4Q45A 4XAKA 2GA7A 2YWWA 4XPEA 2DH8A 3GCXP 2QMXA 2C2DA 3Q8QB 2CPJA 1APSA 3EE3A 4C4WA 4IOBA 2NSBA 2NPFA 4I4BA 2N3OA 5KT6A 4OL8A 1QUVA 1RT4B 2GAGC 1HW9A 1NPRA 5DQHA 4UY85 5C42B 4I6YA 4R5PB 2VA2A 7AT1B 3Q8YA 2UVVA 2OSQA 4DX6A 3AB4B 2UXCF 1HD0A 2G0JA 4DN9A 3PYEA 1RQ0A 3M9OB 3NGKA 1WHWA 3SSSA 1RU1A 4DEZA 2EFOA 1SXLA 2XCPA 2BQUA 5KFXA 2OAUA 1FK9A 1D3WA 2DIVA 4J9MA 1JQGA 3EXYA 4S0MA 3J7Z5 5KG6A 3W9JA 4I0WA 2I2YA 2EKNA 5A8KB 4NCBA 4F4XA 1U26A 2LVWA 1RWWB 1FWKA 3V6HA 2J9DA 2XZTB 4KR0B 3DOKB 3CJSA 5B0AA 2XMAA 5L8RC 1AB8A 1EJ7L 3HDSA 3DRRA 5B08A 2ZD1B 3PCOB 3DOLB 4OZ0A 3AOAA 3VAFA 1KWMA 1T3OA 4DQRA 1U6BA 1AUSL 4X4VA 3DLBA 4EWTA 1R6VA 2KI2A 1F3FA 2YX4A 2DEIA 1VQSA 2RQCA 5DS7A 4M5HA 4UUWA 3S01A 2E5JA 3QRPA 4RUAA 3LH2S 3W2WB 1OJ4A 2ASLA 3LTOA 3JYTA 3SI8A 3D0IE 2KT5A 5KFRA 4CO0A 4LBPA 1TL1A 4ZVUB 2HHQA 1RTHA 2EK1A 4A48A 3QIDA 4ZKAA 2DHHA 2R2UA 1S6OA 4QZVB 1FE0A 1N5YA 1SJFA 3W9IA 4K4XA 3H4DA 4NX9A 4DPXA 2C3YA 3AQPA 4N41A 3MMBA 3R7SB 4KHPF 1EKRA 4LF6F 1FD8A 2CNKB 3R6LB 2RVJA 2OEMA 5J1EA 3A8EA 2K7KA 1U8SA 4OV6A 4JI7F 2MKJA 1VGYA 5DO2A 1WF2A 3BQ0A 3D0GE 1U1RA 4ILLA 3FEYB 1D9AA 3JSYA 4NEZA 3QAUA 4GO7X 4O44B 1FDDA 3U02A 1KTVA 3HSJA 4ZPWR 3GB0A 2IFXA 5F3TA 1FX2A 1QTNB 2GQ2A 1KVKA 4X4PA 3VGUA 2NXCA 3HX9A 3NS5A 4QBUA 4DV6F 3P5BP 3PJXA 2LU1A 5B0EA 1BE4A 4TXSA 1Y4ZB 2YY3A 3HI9A 4U67Q 4NLXA 2L41A 5KTQA 3NXZA 3OJSA 2VJVA 3V4IA 5E3PA 3C6UA 2XMMA 2WZ1A 2RAQA 1REVA 2AIRB 2CQ0A 3M30B 4JI6J 4LF9F 4BBYA 4AL6A 1OQ3A 4FNIA 4WYWA 4LF5F 4F4AA 4EO6A 1GMWA 3KJVA 3JTOA 1C1BB 4QIVA 4DV7J 3WDOA 5H9FJ 5C24B 3PM9A 2MLXA 2P6SA 4PG6A 1ZTTA 3OW2R 4H4MB 4OYWA 3CT9A 1KNZA 3MR3A 1NH8A 2RSQA 3MUVP 1FKPA 3KHGA 2KO1A 2G4BA 4Y6IA 4JV2A 2L9NA 1RU2A 2GO9A 3RW7A 4J7CA 4HHJA 2N4CA 2KYXA 4NXMJ 1RT5B 3GYGA 2OUGA 2I5JA 2R2RA 1DJ0A 4M5NA 1W2IA 1TKZA 3PKYA 2KVQE 2E1CA 3NS7B 2V9KA 4GKKF 1R7IA 4O3SA 4MKYA 2ZZTA 1MROB 2W01A 1Y5IB 2C3UA 2GQQA 3HPOA 4DUYF 1RAFB 4YHHF 2VFSA 4KTQA 2FVQA 2MZ1A 4L3KA 3QRQA 1LWEB 5EX0A 2ZBRA 4MK9A 4RW9B 2V4JA 2FVCA 1WD6A 1RT6A 4IDKA 4OHXA 1JJCB 2CUYA 4RL1A 1U24A 4WFBQ 4IOAQ 2GGPA 2DNPA 1OPZA 4B9TA 1RACB 2F5GA 1N5QA 3HSZA 2CYYA 3MM7B 1WNEA 4Y0FA 2GNKA 4A8XA 5FLXY 4F25A 3MEKA 4HLBA 1WC4A 4LRBA 1RKIA 4RZRA 1Q8IA 3AJ2A 3IGVA 1Z4UA 2QL5B 5F8LA 2HGMA 5KFQA 3D1HA 1NDLA 1VQNS 2Y0BB 1RE1B 3CCSS 5CA5A 2HRTA 4JI5J 2J0XA 2MLYA 5K8PA 4NWBA 3OXLA 2KN4A 2KFZA 1XJWB 3K59A 2H5JB 2BJ3A 2HS0A 4G1QB 2KU7A 4IH7A 4X65J 3T5HA 3EVMA 1NKEA 3CCUS 1EIYB 3MOZA 4J9NA 5J2MB 3K7RA 1A7GE 1V5VA 1KLNA 2P5VA 2VQEJ 4LSLB 4DMZA 3SDEB 5KT5A 3CB4A 1SQGA 1Q5YA 5LM7E 4ZA1A 1S48A 4UOCA 4ZVGA 4USHA 3OLBA 3BKTA 4I6AA 4J9PA 4LF2A 4JI0F 2IC3A 4MYUA 1JLEB 3T9NA 3MUTP 4NXNF 1UFWA 2J7WA 3JSMA 1MN7A 4RNHA 3HP6A 1S0MA 1FX4A 1F9HA 1S1TB 3RAQA 2BE2A 4DR6J 3UDEA 1K9MT 3QLHA 4Q2LA 3EX7B 3FBFA 2E1MC 4DR5F 5KG0A 4HVZA 2MZQA 1EQMA 2KXFA 2IVMA 4Z7YA 2W9AA 3DU6A 2CQ4A 2A0FB 2IM1A 2M4MA 1U2CA 4TKTA 3M8ZA 1X9SA 1N48A 4G3IA 3QJPA 2AW0A 2E29A 4MIBA 5F8IA 2F40A 2ZNYA 1XMOJ 3LP0B 3MMAB 4DUZJ 1ACMB 2H1YA 4N76A 1KP6A 4LFBF 2C2MB 2ZNZA 2OPSA 1FRLA 3ITHB 2OGUA 2B0GA 1P1TA 1YSJA 2GVZB 4BWJA 2F4VJ 1TK0A 2HHXA 2EK6A 1RWOB 2HHHJ 3DMJB 2HLUA 5KFMA 3W3SA 3R7BB 4DSEA 1PAEX 1GT8A 5LL6d 4ETXA 1NK7A 1U45A 1VJQA 1G6BA 2M52A 1MMNA 2WSFC 1RWXB 1N0UA 4OI1A 1HHTP 2QEXS 3FRYA 2VPZB 3H42A 2LDYA 1N34F 5IM0B 2CWXA 3GR0A 3R1HA 2Y9HA 1C0TB 5I4MA 2QA4G 1DBDA 2CXEA 2V8HA 4C48A 4PUOB 4RPFA 1Q16B 3D2WA 1XNRF 2KXHA 5C2CA 1X4EA 1VIOA 5ETOA 4ZPCA 1U1LA 1H38A 1JIHA 3PFOA 4C8LA 3DLKB 2YNIA 3QMQA 5KT7A 3IO1A 1S0NA 1LWCA 2APOA 1URNA 4LFCJ 2E66A 1FJGJ 1CJUA 3Q24A 3CC2S 1VLYA 5AXLA 2JLFA 2OPQB 4Q0BA 3VGTA 2HQ3A 1KS2A 1MN9A 3HVRA 3GIRA 3T1YF 3DRSB 1E6YA 1RSCA 5GAHI 1WOSA 2VZ9A 1FD2A 4ZVHA 4ZPBA 3UVJB 5RUBA 2QLXA 4MIAA 3N0VA 3WZ0A 1SC6A 1T03B 2GC8A 1HWJA 4CT8A 5I42A 1Q1KA 1IBLF 4ILMA 3AA9A 1ZA2B 3DM2A 2H51B 3BGLA 2DHXA 3FCHA 3I96A 3NBPB 2GMLA 2XZDB 2VL1A 1OSDA 1CBKA 2LXUA 2QJ3A 3MAQA 1WSRA 2DR9A 3MMJA 2PSZA 2Y8YA 2YWGA 1IXKA 2MZSA 3SFUA 5A0YA 4I2PA 5L1LA 2K2PA 1CULB 2C2NA 3RZAA 2NR0A 1S72S 2RT3A 3L7PA 2VG5B 4EFAC 2ZITA 3KKFA 3ONQA 2OELA 5BXIA 2C2RA 3VAMA 5HMZA 3MPDA 1S49A 3N9UC 2PE8A 2KL8A 2EC2A 2VBZA 2W2PP 4X62J 2KRRA 4UT4A 2YQ3A 3OHAA 2YNHA 1U48A 1DTTB 4R8UA 4DL7A 3MWBA 1HR0F 1TU0B 3ZZOA 3MPYA 3NOGA 1SC3B 3LP2B 3ENQA 5B0DA 3VTIA 5AE1A 2NXNA 5M2UA
chains in the Genus database with same CATH topology
4LFAF 2XC9A 4DF4A 2WONA 2MSTA 1AUDA 3HKWA 2DISA 5DG9A 4GKJF 4OLOA 2PFFB 5IXUA 3PW5A 3K0JA 3CJKB 1IN0A 4B9UA 1UVNA 5F0UA 1S6QB 4OHVA 4F67A 5F3ZA 2C22A 4O44A 4A47A 3MMCA 1IBMF 2FHJD 4PG5A 2NS1B 4K4UA 4ECYA 4NLRA 4H4KA 5F8JA 1IM4A 4IFYB 2ZOFA 2AV5A 1FRMA 2HHSA 1ZBTA 2WHOA 2M70A 1I1GA 5B0CA 2XY7A 1UA1A 3NBPA 5U47A 2F9JA 5L9NA 2L3MA 3DLEB 4HDGA 3KG0A 4R0JA 1Z1ZA 2QFJA 3B78A 3X3UA 2R7QA 1NJWA 1R0AA 2ABYA 3MI7X 1MW7A 4OI6A 1FEHA 2D9OA 5HLFB 1VQLS 5HBMA 1S1VA 3K58A 3ZFVA 2QV6A 1EETA 4ZHRB 1TZ0A 1JLBA 1YBAA 5IWAF 3DFEA 1P9QC 1S1WA 2CPZA 3FMWA 4RW7B 2ZH2A 1VC0A 2HVIA 2G0CA 4DSJA 5HP1B 2AYGA 2ZZNA 3NG8A 5CYJA 2E1RA 1K73T 4AQYF 1NO8A 1BQMA 1YJTA 3BQ2A 3MAHA 1HBMA 2PO4A 3M8SA 3PACA 3NGDA 3FEXB 5A8RA 1TV6A 2ZH1A 3CJ0A 5KFFA 1N33F 2VG5A 4OZLA 3WBZA 4CH1A 3NAHA 3N5BA 4ELVA 2CPDA 5D6GA 5E41A 3B4MA 1WHYA 2VC1A 2UXBF 3OXFA 3H59A 3R1LA 1JKHB 2NLWA 4C8YA 1AFIA 2XSJB 2ZH5A 4KV8B 2O5DA 1HQEA 4OQJA 2FTRA 3UR3C 4EU0A 1TL3A 3HVTA 2OMOA 2KJVA 3UFCX 1LKZA 5AXNA 1JX4A 2HG4A 3CD0A 3IRXA 5IQQA 3CCVS 2LMIA 3QAEA 2JX2A 5KFKA 4FBTA 1T7PA 3KNAA 2MGZB 2Z2LA 2IVYA 4KFBB 3J7A1 2W9CB 1VQYA 3JTNA 3PRBA 3SQGB 3T5JA 2UVUA 1HBNA 2N3LA 3NS6A 2PA8D 1QJHA 2PD1A 3Q22A 1VJWA 4F50A 1BQNB 2Y1JA 5AXMA 4ECUA 4NLYA 3ZZYA 2R9LA 4C8MA 2HW3A 1QE1A 2W9BB 4DR2F 1NNDA 4ZCIA 3OVSA 3M9NB 3KK2A 4C0OC 1U4BA 3MM8B 1SL0A 3LP2A 2AX1A 4B3MF 1WHXA 4YDDB 1HBOB 4PQAA 3K5MA 1QY7A 4KT0C 4H4MA 4MAKA 5B0BA 3I0RB 5IS2A 1U1QA 4MTPA 2Z2MA 2IAJA 4K5RA 2MQOA 3MD3A 2O66A 2UP1A 4IQXA 4P6QA 2DHGA 2JVRA 2YNGB 3V81B 3KHLA 3W2VB 1J5EF 4NYZA 4FZVA 2RQMA 3V6KA 4X84A 2MKKA 3CDBA 1VFJA 1VRUA 3IR6B 3O8WA 3K5LA 4FN5A 3CJKA 1F5AA 1S6QA 3D1OA 2IRUA 3QGGA 4DSLA 1J2VA 1LW2B 2J9DE 3JAMY 5J2QB 2EFPA 3CTRA 4HDHA 1LW0B 1LK7A 2ZE2A 1GTHA 5D3GB 4CIOA 1RT3B 4XPCA 3DLEA 4PQUB 1UKUA 3NWGA 3HFKA 2WAQD 5LSRA 3HVAA 2XO7A 5HLFA 3E51A 3IWLA 4LVOP 4Q2MA 4TLRA 1CSJA 2AX0A 1UVMA 4TN2A 1IKWB 3QYYA 2IRXA 2RD5C 2D3OR 4ZHRA 3N5FA 3DDKA 4DBQA 1UEVA 1UL3A 3V6JA 4PWDB 3CJ4A 3LP1A 4ECSA 4RW7A 4W90B 4OJ3A 2ZH8A 2XS7A 5HP1A 4DR7F 2HNDB 3DNCA 2YWEA 1LWFB 2EKYA 2C42A 4RWWA 5CYQB 1SQEA 3M8PB 2HFNA 3ZZUA 2CQDA 5L1JA 3THVA 3HM9A 1RAJA 1RT2B 4CO2A 3QZ7A 5CCMA 4DFPA 4GMKA 2JFDA 1GX5A 2COLA 3OTCA 2YVSA 1FNOA 3H5UA 4Y65A 4TU8A 5KG1A 1ZAWA 4BHQA 2XNRA 1NK6A 3AH6A 5HL7Q 5DDQC 3GSDA 3MCSA 4Y2KA 1X9MA 2BANB 3IAS9 2Y1IA 1R8PA 2HZCA 4HI1A 5FDLB 4O3PA 3GYXB 5F8GA 2UV8A 1IR0A 4ZPDA 5LXRA 3BDEA 2ZUGA 4QR2A 1QLNA 1JLQB 2XSJA 4KV8A 2CZ4A 2JVOA 3I5AA 2MY8A 3PNIA 5F8MA 2CJKA 1CPZA 4RU2A 5C25A 1LWEA 5HN0A 2FVPA 4HEA9 5CD4H 1WEYA 3EGWB 2V9WA 4C8OA 3FJ2A 2VOPA 1FK9B 4NZ6A 2MGZA 1BD6A 3BREA 2MHNA 4U7CA 4KFBA 2V4RA 3PW2A 3FSXA 1DHMA 3M2VB 3DLHA 3MTJA 2W9CA 1R8AA 3SQGA 4CTAB 3KOAA 2ZH3A 1FRIA 1JLCA 2VG7B 2QSWA 1BQNA 3CCLS 2ZDPA 2G9OA 2KHDA 4A8FA 4ILRA 2ZBCA 4D3GA 3CULA 1XMQF 2W9BA 2DITA 2DNHA 4KQZA 4NLDA 2XULA 4O3NA 3G9CA 3MM8A 1LXJA 4YB1P 4KO0B 3PR5B 3IAM9 1SV5B 2EG2A 2WRMA 1HBOA 3G8QA 3P49B 2OFGX 2EI5A 3F41A 3H2LA 3I0RA 1U2RA 3FZBA 4N8OA 4MH8A 3UQSA 3DLLQ 1J5OA 2ASYA 3QJLA 3FQLA 1JJ4A 4NL5A 1WF0A 4DL0C 3VAGA 1CVJA 1OIAA 3MM7A 1TKXB 2YNGA 5AJ3F 1DLOA 5E33A 3V81A 2XI2A 3HHNB 2B4VA 3W2VA 2XWXA 4EO8A 4WFYA 3V6DA 2K3IA 3FQKA 5DG8A 4ED2A 5CXTA 3U1LA 4WKYA 1S6PB 4DLGA 1XR5A 2XWYA 4A8KA 3PO5A 3DRRB 2FVSA 1FNMA 3ISNC 3MEGB 5K9FA 1NJZA 3X1LB 1LW2A 5J2QA 4ED3A 4O4GB 1JB0C 4V19X 3TVZA 1LW0A 4ZP8A 2DGTA 5MAOA 2A3JA 2WK4A 2KVIA 4IOCQ 3M6WA 3AQOA 1QSLA 3O5TB 3TVKA 2MKIA 2DNLA 1VHFA 4PQUA 3RRGA 4RW6B 4YFUA 3B4DA 2LA6A 2FC9A 3PX0A 2YX7A 2O1PA 2PGCA 4DL5A 1X8DA 2NUUG 1N5TA 2PMZD 2XB2D 1G3OA 5K8NA 4DQQA 1IKWA 1DURA 1LK5A 4Z37A 1S76D 3MR2A 1ZOTA 3H40A 1TFYA 4F4WA 1HNIB 4PWDA 3N6NA 2BXJA 2HNDA 1URRA 2CPYA 1LWFA 2B7CB 3MPWA 5DRKA 5CZVA 1HI0P 5CYQA 2IBKA 2NPIA 1SH0A 1UP1A 2XMJA 1O5JA 5GMKa 1KTQA 1RT2A 1S6UA 1IQTA 3CCZA 3IA0A 3SSRA 2VASA 1MMDA 4WFNQ 3OV7A 7FD1A 3RBEA 2ASJA 3GIKA 1B0VA 1TK8A 3M32B 2FJDB 2OPPB 5HMXA 3TUIC 3VCDA 3Q2SC 3KMQA 2BANA 3MF5A 4PWUA 5EWGA 4C3MA 5FDLA 6FD1A 3O3LA 5KFJA 2W25A 2VD3A 2MYFA 3CCWA 1XMBA 2CJAA 2HRYA 3BDPA 1RISA 4WXOA 3PEHA 1JLQA 1FO1A 4RW8B 2ROGA 2KT3A 5KFYA 1U6FA 4OX8A 1IJEB 1V3SA 4XDDA 1RJJA 4LIRA 3GV5B 5BYRA 4K4TA 4Y2AA 4LSNB 2JLGA 2RIJA 4YEAA 1JWWA 2XI3A 1MWZA 2Y1RI 1WEXA 1VRTA 3HT3A 3KK3B 3M2VA 2VONA 4B9VA 4Z2XA 2WSCC 4CTAA 4FYDA 2RRBA 1FTCA 1H7XA 2LQBA 2BBEA 2FD2A 2VG7A 5A6PA 3MOJB 1YTYA 1T94A 1C1CB 3O6QA 2GHWA 1TKTA 2Y0SD 2AF6A 4J9KA 2CQCA 1RGVA 3CCQS 2D41A 1Z2ZA 1QM9A 2DPJA 4KO0A 3UW1A 1QAYA 1ZETA 2EWHA 1LXNA 1SH3A 1ZPVA 2VG6A 3E01B 2UUWA 1M5SA 1DQ9A 1WI6A 3UDCA 4KBIA 2ADCA 2IA6A 1S10A 2JEJA 1WG5A 3GR1A 3D54A 2JWNA 1WG4A 2RF2A 2VFUA 2VUGA 3DGPA 1VIXA 1TKXA 4NA2A 2HPUA 2CJQA 2FGOA 2FHKA 2VPYB 3CDUA 3H8YA 4HL9A 4DSKA 1QVFR 2V4QA 2RB7A 2ZH9A 3DDNA 1S6PA 3WC0A 4WIIA 2KH9A 3UPFA 3MEGA 4LMZA