4ERGA

Evidence for a dual role of an active site histidine in alpha-amino-beta-carboxymuconate-epsilon-semialdehyde decarboxylase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
332
structure length
332
Chain Sequence
KPRIDMHSHFFPRISEQEAAKFDANHAPWLQVSAKGDTGSIMMGKNNFRPVYQALWDPAFRIEEMDAQGVDVQVTCATPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKVLAQVPLQDLDLACKEASRAVAAGHLGIQIGNHLGDKDLDDATLEAFLTHCANEDIPILVHPWDMMGGQRMKKWMLPWLVAMPAETQLAILSLILSGAFERIPKSLKICFGYGGGSFAFLLGRVDNAWRHRDIVREDCPRPPSEYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLGEQKIGGLVLSSNLGESAKDKIISGNASKFFNINV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence for a Dual Role of an Active Site Histidine in alpha-Amino-beta-Carboxymuconate-epsilon-Semialdehyde Decarboxylase
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
total genus 117
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4ergA00
4V1XA 4HK5A 2VC7A 1NDVA 2VR2A 2R1LA 4DYKA 3GRIA 2HBVA 3GU2A 3NURA 4QRNA 4C6FA 3CJPA 1M68A 1A5LC 4IFRA 3TN5A 3PANA 4C6BA 1FWEC 1EJTC 4PE8A 2OGJA 4CNSA 2OODA 1FWIC 1FKWA 3OJGA 4PBFA 1ITQA 4XD4A 4XAFA 4P5UA 1J6OA 2HPMA 3FDGA 1EJRC 4BJHA 2EG7A 1YBQB 4J2MA 4F0RA 3ITCA 3N2CA 1A4LA 4GY1A 2QT3A 4DZIA 1A5KC 3E3HA 4J35A 2QPXA 1RAKA 1NDWA 1K6WA 3WZ0E 4LH8A 2D2GA 3K5XA 1RJPA 1V4YA 3LY0A 4DI8A 1PSCA 2GWNA 1ADDA 4IG2B 4DZHA 2FVMA 3DCPA 4LCSA 2VHLA 3NQBA 4HK6A 3WYZA 4DLFA 2D2HA 2QS8A 1HZYA 4E3TA 3LGDA 4TQTA 2EG8A 3RYSA 1K70A 3MJMA 3E0FA 4C60A 4BY3A 3F2BA 4EPEC 4C6IA 1UIOA 2I5GA 3MDWA 2Y1HA 3MVTA 2Z29A 3V7PA 1FKXA 4CQBA 3S4TA 2Z26A 4B90A 2CZVA 4QS5A 2AMXA 3OVGA 4H9UA 1RK6A 3S2LA 3OOQA 1FWDC 1V79A 1XRFA 3A4JA 2ANUA 4ICMA 3S2MA 1V51A 3K4WA 4PBEA 3K2GA 5HMFA 4C5ZA 2FFIA 5A6TC 4MUPA 3JZEA 1E9YB 4WHBA 3QY7A 4DNMA 1EJWC 4KEUA 1NDYA 2R1PA 3OQEA 3TN3A 3LA4A 1QXLA 3LGGA 4LEFA 2UZ9A 2VC5A 2WM1A 4GC3A 1YNYA 3F4CA 3O7UA 3C86A 3GIPA 3TN6A 3URAA 4LAOA 4C6KA 2YB1A 1EZ2A 3UPMA 3FDKA 3GTXA 1BF6A 2G3FA 2FTWA 3PBMA 4HK7A 5LXXA 4IGMA 3PNZA 4V1YA 2Z2BA 2PGFA 2IMRA 4C65A 3QGKC 1A5OC 4LANA 1KCXA 1A4MA 4KETA 4KEZA 1XWYA 4DI9A 1RJQA 3A3WA 2PAJA 4L9XA 4CNTA 3CS2A 3MPGA 1ZZMA 1NDZA 4YIWA 4ZSUA 2Q09A 2E25A 4RDVA 4R88A 3GU9A 2E1WA 4WVXA 1K1DA 1WXYA 3F4DA 1EJVC 3URQA 4H00A 4C6QA 1EJSC 3GIQA 2GOKA 1R9ZA 4R7WA 4OFCA 3URNA 3OODA 2O4QA 4GXWA 4NG3A 3TN4A 4B3ZA 3B0YA 2Z24A 2Z4GA 3TNBA 1EJXC 2Z28A 3MKVA 4GX9A 1UBPC 4DIAA 2EG6A 3QY6A 4XAYA 4IFOA 5AKQA 4ZSTA 4IFKA 1A5NC 4GOAA 2HNHA 3LSBA 3HTWA 3D6NA 1PTAA 4M51A 4C6MA 4GZ7A 1XRTA 2VM8A 4KEVA 3O0FA 3MTWA 1EYWA 3T1GA 3CAKA 2HPIA 2YB4A 2RAGA 3S2NA 4C6CA 1M65A 4IQJA 1FWGC 2OQLA 4WGXA 1EF2A 4LFYA 5FSDC 1J6PA 3BE7A 3NEHA 3F2DA 1KRBC 4F0LA 3MDUA 4XD3A 4GBDA 4CEXC 1ITUA 1WXZA 3GTFA 4GYFA 1XGEA 2YXOA 3IGHX 1RK5A 2KAUC 4LALA 3RHGA 1KRMA 1R9XA 1GKRA 1J79A 4H9YA 1QW7A 4J5NA 4I6KA 4ERGA 4DLMA 2A3LA 3EGJA 3DC8A 4LAMA 2HBXA 1P1MA 1JGMA 3B0XA 4CNUA 3IRSA 2W9MA 4LCRA 4D8LA 3LU2A 4LCQA 1POKA 4ERIA 3ID7A 3IV8A 1RA0A 2VUNA 3RCMA 4ERAA 1FWFC 5G4HC 1KRCC 4IG2A 4QROA 4RDYA 3QGAC 4JOMA 3T8LA 4B91A 2AQOA 1YMYA 4C6DA 1O12A 2AQVA 2DVTA 3GU1A 1YBQA 4HA0A 3EWDA 2Z00A 3T81A 4QS6A 3AUOA 1M7JA 3F2CA 1DPMA 3LNPA 2R1NA 1E9ZB 3UF9A 1IE7C 4RZBA 3LSCA 4EP8C 3GUWA 2Z2AA 3UBPC 2YZ5A 1NFGA 4IGNA 4XAGA 3LS9A 4EPDC 4C5YA 1P6BA 4IH3A 1I0BA 1FWHC 4KF1A 1FWJC 3GG7A 1A5MC 3DUGA 5E5CA 4H9MA 2ICSA 2Q01A 2PUZA 2GWGA 4XAZA 3EWCA 2GSEA 4GK8A 2ADAA 4CEUC 2BGNE 3MVIA 5CH9A 1FWBC 5FSEC 4DO7A 2P50A 4Z42C 1UMLA 3S2JA 4INFA 4LAKA 2Z27A 3SFWA 1VFLA 1FWAC 5HMDA 5HMEA 1YRRA 3IACA 2OB3A 4C6JA 1ONXA 4G2DA 4KIRA 1POJA 2HQAA 3E38A 3WMLA 4EPKA 4UB9A 1GKQA 2GZXA 2I9UA 4XD5A 1UIPA 2DVXA 2PGRA 4UBPC 4G7EB 3FEQA 3UR5A 3IARA 3PAOA 3HPAA 1I0DA 3OU8A 1O5RA 2ZC1A 1PB0A 4PCPA 3HM7A 4C6EA 1ONWA 4KERA 1R9YA 4KQNA 2WJDA 2BB0A 1W1IE 4L6DA 1J5SA 4C6PA 3UR2A 4AC7C 4GY7A 3B40A 4HJWA 1V7AA 3R0DA 3PNUA 2PLMA 3AU6A 2FTYA 3KM8A 4H9ZA 1FWCC 4I6VA 2WJEA 3E0LA 3E74A 2P53A 3G77A 3QY8A 4IF2A 3MSRA 4XD6A 1GKPA 4BKNA 2F6KA 3RN6A 4NI8A 3ISIX 1RA5A 4GY0A 4QSFA 2R1MA 2Z25A 4R85A 3SO7A 1PO9A 4AQLA 2FVKA 4C6OA 2R1KA 1RJRA 3ICJA 1EJUC 4H9VA 2DVUA 1S3TC 2XIOA 3GTIA 3IJ6A 4RDZA 2Z7GA 4NP7A 1P6CA 2D2JA 4EPBC 1V77A 4B92A 2WJFA 4CQDA 4QTGA 4CQCA 4C6LA 4RE0A 4H9XA 4F0SA 3ORWA 1KRAC 4IFKB 3URBA 3AU2A 4H01A 3A3XA 4H9TA 4PCNA 4GX8A 4RDWA 3GTHA 2QVNA 2OOFA 3IPWA 4C6NA 1YIXA 4G7EA 4KESA 2O4MA 3E2VA 2UBPC
chains in the Genus database with same CATH superfamily
2FZ9A 3SUSA 3PUOA 4PB5A 1NDVA 1X1OA 4U5KA 3D3FA 2I17A 1XPGA 4AZCA 4QRNA 4AMCA 2WM0A 2ZVIA 1B9BA 3GVGA 4OV4A 1GOIA 3T78A 2CLHA 3WLTA 1V3HA 1J6OA 2QCEA 2HK0A 1JUKA 2PE4A 2QJMA 4GJ1A 5TIMA 1U5VA 4LUSB 3KTCA 1J0JA 5I03A 4GI9A 2FYMA 1EIBA 4HMNA 1AMYA 4GXMA 5JH2A 4A3QA 2NVCA 2V5BA 2GDUA 2E67A 5CPTA 3U7BA 3T40A 3LRKA 3VU2A 1Q6DA 4B5VA 3A4XA 1R7AA 1PPIA 2EPNA 3WYZA 4NU7A 3LLXA 4MKNA 3OHIA 3EDDA 1GQIA 4YTRA 1Q6EA 4QR6A 7REQB 3MYPA 2V3DA 3C52A 5BW6A 3K46A 2FDMA 3L0KA 5H8PA 3USZA 3WLQA 3ARRA 4L1WA 3NQ7A 4OIFA 3WH5A 4NF7A 2ANUA 5C9UA 5M1TA 1TV7A 3LX9A 4ZODA 1EHAA 4IJBA 1Q8AA 1UZHA 3W25A 1TZ7A 2F9RA 2J7HA 4GUFA 1CB7B 2QDGA 5KINA 4XZIA 2D20A 2TAAA 3TN6A 3NQ6A 3ITGA 4UNIA 1EZ2A 3BOLA 4DPQA 1IEVA 3FDKA 3WF4A 3ZR4A 1FDZA 2F2KA 3L5MA 5TBOA 1CXKA 2WO5A 2NZLA 5BXSA 2Z2BA 4PUNA 4HU0A 1RD5A 3ATYA 5B80A 5A6KA 1IQ8A 3TWAA 4DBDA 4E2BA 4CNNA 2XGBA 3MC5A 1QNPA 1ZBVA 1SQ7A 3W0KA 4NZJA 2NQHA 4HBKA 1B4EA 1SSDA 4MY8A 4C6QA 3OP2A 4R7WA 4O12A 3WQ8A 1Z3NA 1Q5MA 1TJ2A 4LU0A 2Q3RA 2Z24A 3CUZA 4KIEA 4Z1DA 4XZLX 1JD7A 3ARSA 4FX8A 4UOQA 2C1GA 4KFOA 3AALA 4GOAA 3ABOA 3DFSA 4LYQA 3NM3A 4G7FA 4ZZ9A 2VM8A 2VZTA 4FK9A 4RL3A 4B4FA 5C2GA 3KS6A 2C91A 2OZTA 4RJEA 3GNDA 3PPGA 4IQJA 4KH2A 2ZRZA 3MMUA 1O95A 3TONA 5FSDC 1T6MA 3DX5A 4XZWA 4JTFA 4HGXA 3WCZA 2WPBA 3AHYA 1KWGA 2ZXQA 3NVDA 3BLOA 1TMLA 5GNZA 3IGHX 1KQYA 3SN1A 1NJJA 2I57A 4AU0A 4Q4KA 1DIDA 5FKYA 4ATWA 2AGTA 4DLMA 3L5AA 1HGWA 3HA1A 4LAUA 4D8LA 2CFFA 4GIEA 3H24A 1CNVA 1UR9A 3B9OA 3HN3A 1R3VA 4PTXA 1TV4A 3BURA 3N6QA 1LUCB 3TMQA 2G41A 5I3KA 2R14A 4UFKA 1EGZA 4MB3A 1O66A 3KEHA 1QNQA 4MMWA 3EWDA 1XGDA 4QS6A 1QHOA 1WB0A 4MWAE 4DAIA 2X30A 2VURA 1AK5A 2NQZA 1UZDA 3FS2A 4FI4A 2QPUA 3LQGA 3S6DA 3PTDA 4IGNA 4ACZB 1EQPA 1C8QA 5SWUA 5HJXA 2DT2A 1XC4A 1TMHA 3W7MA 4JHZA 5BOFA 4JDYA 3RLVA 3WQPA 2CLOA 2YL5A 2PUZA 1UPMB 4XAZA 1KCKA 3F4VA 3H21A 4QEEA 4KBXA 1D8WA 3O9NA 3VK5A 2ZZ1A 3WBAA 3ENLA 4R53A 5B7YA 5CBBA 1LLZA 4F2TA 1UC4A 1F74A 4NY2A 1H0GA 3EMCA 1UR1A 3KBJA 2E09A 3Q2DA 3RM9A 3U48A 1CXEA 1HKVA 1TQXA 3PPCA 3ARZA 1LP6A 5HATA 1VP5A 4Y9OA 3WEMA 3K30A 1QK2A 4B3LA 4PUMA 1W54A 4PCPA 1V0MA 1PS9A 1G1YA 1VS1A 3RXZA 4AYSA 1KV5A 4GZJA 1ZFJA 4BS0A 5RUBA 4GYKA 2XYLA 3PFRA 3WD0A 4IT1A 4ROPA 3WLOA 3KVKA 3RIKA 1ME7A 4E6MA 1JRCA 3L9CA 2OZ0A 1KW1A 4GVHA 4R7JA 4AEFA 2ZFAA 2FGLA 4TOQA 1GKPA 4RNIA 2F6KA 4IMCA 3FJLA 2WWCA 2TYSA 3NL3A 4QSFA 2Z25A 5DRIA 3SO7A 1WV2A 3NIYA 5A3HA 4DELA 3KZSA 2ZQ0A 3H2CA 4PMQA 1S3TC 4RDZA 2E28A 1Q8JA 3NQFA 3UJSA 1J0KA 1G69A 4EAYA 5JQ9A 3OVPA 5FI8A 3UU0A 3KTXA 1OZQA 1TA3B 4E4UA 1Y65A 5DLCA 4IWWA 4PZVA 5LHFA 4MPKA 5AFDA 5I0DA 5JMUA 3IPWA 1GHSA 2G3NA 1JUBA 4PTDA 3E02A 5JH1A 2CXGA 4JL2A 4N9BA 3LK6A 1BPLB 4HA3A 3AZSA 1B4KA 4A8RA 3IIPA 1E71M 5AVHA 3CUHA 1VB9A 1SJDA 3H4WA 3FJNA 1XQKA 3HG2A 2FDSA 3AXIA 3LPGA 2OGJA 4YWIA 4XUYA 6XIAA 1F3EA 4TV6A 5DY2A 5MHBA 1XP3A 3W02A 3PBYA 1W1PA 2HXUA 2NT1A 2OYLA 1U5HA 4LYKA 1RBOB 3OG2A 3HQ1A 1OFQA 3LTSA 4DPPA 1E15A 3W9ZA 2F2HA 5HJYA 3ARPA 2R8WA 1DWHM 4TO8A 3FXGA 3AC0A 3WZ0E 2W0UA 3IUIA 4A8IA 1MZHA 4HHHA 1G67A 4IG2B 1A3WA 3EOSA 4W8LA 2VHLA 1OGBA 4GFSA 3YPIA 4UTFA 5HNNA 4E38A 4RE3A 4E3TA 4Z0JA 1R47A 3VD7A 1QO2A 1BWVA 1W3KA 1TPFA 1W6TA 5LKYA 1W5QA 1XICA 4CQBA 5BRQA 4B90A 4N9EA 3WNMA 4GH3A 3VINA 3JRKA 3LG3A 3S2MA 2Y7EA 3STGA 4BQ3A 4V33A 2WHLA 1L6YA 2JK2A 1EZWA 5A6TC 1HX0A 4HHLA 3PZNA 3BV7A 4UMCA 5A95A 4HMEA 2WM1A 1XIJA 3LZ5A 1YNYA 5JBDA 1LL7A 1QI2A 4JCMA 5LZLA 2G3FA 3A21A 3VIGA 5BRPA 1VYSX 4JIRA 1SFSA 1IWBA 3GR7A 4GUGA 3PN8A 3A3WA 1ICSA 3W37A 5GQBA 1NWSA 2VC9A 3GU9A 4DXVA 3BJSA 1WXYA 3E96A 3NO3A 3LZ3A 3M0LA 1HKIA 3DC0A 4YMZA 4YVVA 3URNA 3W76A 4HZ8A 1FUYA 2YIHA 3NCOA 2UY4A 2A7PA 5A2AA 1W8GA 2DFAA 3OGSA 3GBDA 2HK1A 1TCMA 1TMQA 3JU2A 4IFOA 1S5VA 1M7OA 4V2XA 1H3GA 1JULA 4AX7A 4DYJA 3K13A 3R10A 4HNLA 1DWFM 2QQ6A 1PHQA 3A9BA 4PSRA 2GUYA 3PUDA 2ZIDA 3T1GA 1PKYA 3DFQA 2QJHA 3CO8A 4AD5A 5F7UA 1FWWA 1LQAA 3NZRA 1HF6A 1KFWA 3N19B 2WVSA 4N6FA 1ITUA 1QW8A 3WNNA 2RJGA 1JXJA 3DFYA 4JS3A 3TYDA 4IPNB 4G5DA 3UY8A 1GKRA 2W63A 3GW0A 4Y9PA 2CPUA 4LJ3A 1BYCA 3OBEA 4OZOA 4MNMA 1R86A 1XYBA 3VNKA 4G9PA 1R7OA 5C55A 3E0VA 3ID7A 3WQDA 3R25A 2A7NA 2VNCA 3R8GA 4NILA 2WWDA 3TJXA 2PS2A 1I4NA 4GQ0A 2OKOA 1XL9A 1VYRA 2HRWA 4KRZA 3IVUA 4UNKA 1M7JA 3NQDA 1SZEA 2BWGA 4HCHA 3C2FA 5REQB 1OFBA 2ZRVA 2YZ5A 1E4IA 3R58A 4C5YA 4QG9A 1J0YA 4IXHA 4RNJA 1WYIA 1VCGA 4H9MA 4HSNA 5G2IA 3STFA 2ZUVA 4RV8A 3KLKA 4M1BA 4Q8QA 1Y0EA 2GSEA 4CEUC 3WN6A 1W0MA 2AGKA 2QAFA 1CGTA 1VEPA 3BO9A 3S2JA 4DJDA 3UZYA 1RVKA 4W7WA 4INFA 1C91A 2IQDA 4HYWA 1AD4A 3SY1A 2J7DA 5HMDA 1LLOA 4PTNA 2VZVA 4GIYA 4YJ5A 3A4AA 4AF0B 3IACA 3WQEA 1V3IA 4AXNA 2XN2A 4AW7A 2IXVA 4KEMA 5I02A 3Q94A 4IISA 1BG9A 1SW0A 2WYSA 2Y8UA 1PWMA 4PL2A 1V03A 3HM7A 1EXPA 1XSJA 3N11A 4TVDA 3QV8A 2OLSA 1R9YA 4LT9A 4I3GA 4WKAA 1V6WA 2PC8A 2VQTA 5EA9A 4HJFA 2IPJA 5I79A 4B9YA 4RLIA 1HL8A 5FA5A 1ZNNA 1SFTA 1BYAA 2FTYA 3W72A 1SO5A 3VVGA 4AEOA 1IIHA 4JTAA 4NZ1A 2YJQA 4RW5A 2OWWA 2XN1A 1UBSA 1U33A 2E40A 2BOGX 4HT3A 3CQKA 4HTYA 2D2OA 3GH7A 2DUXA 3UQNA 4KRTA 4BR1A 4Z2LA 2OELA 4OBSA 3BLEA 3KL3A 1TWWA 3M7SA 1Y5XA 3KCJA 2NV2A 2GFTA 3UWYA 3W7JA 1WPCA 3OLEA 2DW7A 1TFVA 1S2TA 3N9RA 4AZGA 1U30A 3V5FA 3H4XA 5ABTA 5C70A 4MJMA 3E0WA 2Y7DA 3LENA 1UA3A 3M0HA 6TAAA 4P8UA 1CDGA 2WZIA 1BSIA 1U5JA 4H6KA 3UZXA 4F0SA 3ORWA 1KRAC 4Y8FA 4ZQRA 1NWRA 4H01A 3NQ8A 4YLWA 3CMGA 1IHIA 5I3JA 3CZGA 4ES4A 9XIAA 2ACRA 3WY1A 3VFCA 3T2QA 2G5WA 2O4MA 1R3SA 3H12A 3RU6A 1PTGA 1JPIA 2VC7A 1W3NA 5DCBA 1LQ2A 3ZVHA 1WAWA 5FJTA 3W1TA 1HN1A 3GRIA 3RITA 3V0UA 3W01A 5AHMA 1CX9A 2G96A 7CGTA 2V0TA 1W5NA 1FWIC 2OO6A 1E43A 4L4OA 2YOCA 4P5UA 1EDQA 5J04A 1RCOB 1A4LA 5IFPA 3E2QA 1LOSA 3LHZA 5AN7A 4Q22A 4PUWA 4AAJA 3MUXA 1OADA 1PKMA 1OK4A 3BSGA 1OWQA 5JXQA 1XLDA 1E55A 2FZDA 1RALA 3CWOX 4Z2JA 4OQVA 1O1HA 3LY0A 1UZ1A 5HOSA 4GKLA 1YEYA 2NVDA 4B3KA 3DCPA 4WRHA 4Q4RA 4MWAB 3D3AA 4DLFA 2RDXA 1OT2A 3F7JA 2EO7A 4ECLA 6CGTA 4QISA 1PAMA 2PDJA 3O05A 3MJMA 1P43A 2J9ZA 4IZGA 3F2BA 3N6HA 3P84A 1V0KA 3TDFA 3EKZA 1YW1A 2G3JA 4KKXA 4TU1A 3B9AA 3UPWA 3ZWTA 1BRLB 1DJQA 5IDZA 3LI1A 5AECA 5F1VA 1FY6A 3R11A 3MS8A 1VQTA 2IQTA 3OBKA 1OZMA 3K2GA 1PXGA 2H8XA 2VVNA 1M04A 3S3GA 2ZCGA 3SCQA 4ILSA 4GVGA 3APGA 4XKMA 5CC6A 4W7UA 3WD4A 2J77A 5GPRA 4DWSA 1XRVA 4GRSA 3RK8A 2A5HA 2EJ1A 3ITLA 5BWFA 3T0BA 1P0NA 2JGQA 4IGMA 1VBRA 3A64A 1X96A 2IMRA 1V02A 1AMKA 3CUFA 1UWTA 1YXYA 3C0SA 3W70A 2Q8XA 3N1AA 1OABA 3VNLA 4UTTC 1EP3A 3BMXA 4Y8EA 3AMGA 4ZSUA 5DELA 3RCYA 1MVYA 1H41A 1N8IA 3OQ8A 3ITXA 1QNSA 3RDKA 3DFHA 2VC6A 3URQA 2YKKA 3H6OA 3UP8A 1R9ZA 4XKYB 2O4QA 1DP0A 5E6YA 2Y8KA 4LYRA 3TFCA 3S83A 3SIZA 4EX4A 1E9LA 1W2VA 2QMKA 3IJ7A 1XCXA 2WZEA 2ZBTA 3GY1A 3RJYA 4H41A 8RUCA 5M2FX 3VCNA 5A94A 4H04A 4KEVA 4M80A 3WMBA 3MA8A 4XVDA 3BG3A 3CAKA 3NDYA 3I7QA 1OC7A 2WC4A 4C6CA 4Q7BA 1E6PA 5T9BG 3BPWA 3NXFA 4GBDA 1DXEA 4GYFA 4FXRA 3TZFA 4LUJA 4ZQMA 2Z1BA 1KRMA 2YGYA 4G56A 1WDRA 4MJZA 2QZRA 1ZALA 2VZUA 3FJ4A 2JIEA 3LB0A 1YPIA 2J66A 3EEGA 4CU7A 1VJSA 5EMJA 1A80A 2EHHA 3KCLA 2WMKA 3W2UA 4EXQA 2GGJA 2OEMA 5IDIA 1NVMA 3W1RA 4KWWA 2PTDA 1O12A 3DYOA 4PFMA 3NG3A 3C0QA 2Z00A 3WO8A 3EDKA 3PK7A 4QCEA 3SJ3A 4FNRA 1NU5A 1GVIA 1IE7C 3N04A 1W9VA 5D4YA 3W4RA 3MUCA 2X2GA 1XYMA 1TRDA 4IICA 3MHGA 1KM0A 4H19A 1XKJA 3ZM8A 1GPWA 2Y88A 2ICSA 2E68A 5XINA 2YDAA 3W6LA 2R24A 3VGDA 3H7VA 3HGSA 4GK8A 4PC8A 4WJ8A 4DBWA 1ECQA 3SR7A 5BMWA 3VMPA 1IEXA 1FWBC 4ZFMA 4GVFA 3O63A 3GZAA 3VKKA 3VX1A 2WZHA 4GVIA 1CGVA 3S1VA 2PFHA 1VH7A 2PDLA 5HWNA 1AW1A 2CLIA 3BWWA 5FJJA 4JIPA 5LA0A 1RVGA 3FAWA 2FJKA 3E38A 3L21A 2GZXA 3T08A 3WBXA 1J0HA 4JFWA 4Q8TA 1REQB 1UIPA 2D22A 4PMYA 1PIGA 2IKJA 3GDRA 4IX0A 1XIHA 3BMVA 4W86A 4JICA 2DORA 1AZ1A 3CUIA 3TP4A 2YCJA 3LLDA 3GG1A 1DQUA 1XCWA 3DYPA 1QPNA 3WJXA 1U83A 4XZMX 4PR4A 4WY0A 1G5AA 4UTWC 3A24A 1B3WA 4AFYA 1BTCA 2PPGA 2Z1KA 3VCCA 2OLHA 3QW3A 3N9SA 4U4MA 3MI2A 3VFLA 3PVFA 2O55A 2YBVA 3W2JA 4WOQA 1W1VA 3PS7A 3B97A 3AS3A 3BAYA 4RZ6A 3BXWA 5FF0A 1GGOA 2PF8A 1EOMA 1LWIA 2YCKX 2VI0A 1N7KA 3MJYA 3VAVA 1UKPA 2EAWA 5C7VA 4S3FA 1XH2A 5GJMA 3IJ6A 3A23A 3WENA 4MAZA 4DWSD 2WJFA 1Z9AA 3ARUA 1RV8A 1AQFA 3KWSA 2E3ZA 2PLKA 4NZ5A 4PMRA 1DIEA 2PWUA 3AMLA 4PULA 4UUIA 1C8VA 4IMAA 3L68A 4JTKA 3AS1A 2J7EA 7XIMA 1H7PA 3DHPA 2P8BA 4P7LA 1OINA 4MGGA 3AIBA 1SPQA 2C16A 4Q4OA 1Q7ZA 1US0A 3M5VA 4NX0A 3H7RA 3U4AA 3I7SA 3QHMA 3IAPA 4P7QA 4PE8A 4CNSA 4A3HA 4MADA 3KRBA 5AYXA 4WZHA 1YPFA 3P7YA 1KFEA 5BRBA 2HPMA 1EJRC 3SCTA 2OKTA 1LOLA 3LTYA 2Z1XA 1Z69A 1RBAA 1OCNA 2OSYA 3G3DA 3WFZA 5EMUA 2PDNA 3D0CA 2BASA 7A3HA 1RAKA 3NZGA 1NDWA 2H9AA 5D2VA 2XDFA 3ZO9A 2Z1VA 5J8LA 1FP9A 2AQWA 3TQVA 1IZJA 4AD0A 4I5XA 4N02A 2QJGA 3BQ5A 1CGYA 1TZZA 3TOPA 4OU1A 1XFBA 1XC6A 3S9IA 4MZYA 3HBLA 2WMHA 2QULA 2H6RA 2V38A 3BUVA 2D2HA 4HD5A 4UCGA 4UFHA 3O6CA 1XW8A 1XLCA 1PX4A 1EHNA 3KWXA 5LSMA 5I7GA 4ZEPA 2PI6A 3NPUA 3O6YX 4EPEC 4DX3A 1AZ2A 3C2YA 3SRDA 2I5GA 5CXPA 4OTKA 4ZB2A 5L9FA 1FKXA 3M16A 4BI6A 4U10A 3AS0A 3BARA 3ZWSA 4PCFA 4H8VA 2YPIA 3PBGA 3DFPA 4XBSA 1AJ2A 4XBJA 4D9PA 3S2LA 1PEZA 5FEXA 8TIMA 3W38A 4HMCA 5CG0A 5M5DA 5T8GA 3KHJA 4MUPA 1PHWA 4E8DA 5MKGA 1F8IA 2Z1SA 4L56A 3LGGA 2PRHA 3C2VA 1NP2A 3Q4DA 4UMAA 3H70A 1LOQA 1DJYA 3CBWA 5G4EA 2V81A 4CUCA 1Q6GA 3M43A 9CGTA 4C1LA 3DKJA 3LQLA 5K9XA 3PNZA 3AJXA 1EDTA 1G4SA 5EYWA 3HB9A 4F48A 5FL0A 3FHAA 1XWYA 5F1UA 4DWDA 3IV3A 5CEWA 1HFBA 1MW2A 3NPXA 5CLTA 4H7ZA 1HP5A 2NUXA 2XUCA 4S2CA 3AROA 4S3GA 1RSCA 1GOXA 1JJKA 3IJLA 1A5CA 1WCGA 2Q8ZA 1C8YA 1FRBA 3VABA 1G6CA 3OA3A 5D9OA 1E6ZA 1W9DM 2BXVA 2YW4A 4XAYA 3T4CA 2V63A 3KHDA 1VHCA 4ZQPA 6XIMA 4FOUA 4IQEA 1GOOA 4M19A 3PJUA 3CZ8A 4IOTA 1JNEA 2W66A 4WGXA 5TNVA 1WBJA 4J3ZA 1AJZA 1P5BA 4R5EA 1G01A 5DQPA 2GQ3A 4CEXC 4PMVA 3DXIA 2D23A 1S2VA 4ASTA 3B8IA 1LORA 3NDZA 1OCQA 1JF5A 4S1FA 2JE8A 5JBEA 3MCMA 1QATA 3GXTA 2WCSA 3DDMA 3GBEA 4Z2IA 3RLUA 1V6TA 2DY3A 2HBXA 2VGBA 2ZVRA 4BF7A 4AWTA 4GIRA 1GZ1A 2DIEA 4FO4A 3C61A 2NSXA 2V2CA 2VCAA 2PDCA 4D1JA 1FWFC 4MTVA 4UR9A 2AQOA 2Y2WA 4R33A 3T44A 3VCRA 2RHGA 3S0CA 1TR9A 1V6XA 1US3A 1TX2A 3COTA 5AC7A 1DL3A 1OFAA 3MY9A 5LHEA 3M44A 4REQB 1C9DA 4O17A 4B16A 4H6QA 1XIDA 4GE8A 4CQAA 3A22A 4EPDC 3CM4A 4IH3A 1OSEA 1R6WA 3BW4A 3BLDA 3UJ2A 3AHVA 5D38A 1XXXA 5A69A 1UWQA 3FVDA 3TEVA 2J6VA 2EKCA 1H1YA 2DIKA 2ZZ5A 3E0IA 3CT7A 3VIFA 1F05A 3POHA 1RLDA 1JDCA 2BHZA 3FYYA 3MVIA 1EXBA 1H51A 1HJQA 3ZLFA 1TPH1 1SO6A 1OBAA 3WH8A 4LAKA 1VFLA 1W17A 1EBGA 1RPXA 2Y8VA 4KCWA 2QDHA 1VD6A 5FACA 5KZMA 3G1HA 1J96A 3GXMA 5U4NA 3ZLHA 3B0UX 3U2ZA 4X2PA 4K36A 4EPKA 1I60A 3QV6A 5HDRA 4W5UA 1UKTA 1RQEA 2C3ZA 5H8MA 5I5RA 4HYVA 2QYGA 3C8FA 4GQBA 4L6DA 1ODUA 3CAVA 4D8AA 4GY7A 4MWAC 2XZ7A 3DI0A 4GISA 1JCTA 3IGXA 1RLCL 4QDWA 1S5NA 1NH6A 3THAA 1RH9A 3BCDA 1V8EA 5BWAA 5XIMA 3LUTA 1UR0A 2TPSA 1U22A 4WK9A 2P0IA 2YYUA 1DJIA 1ICQA 3VOHA 1GVYA 1MSSA 2WMFA 2XIMA 1VCFA 5HWJA 4JTQA 3U3HA 2PGEA 3KVLA 3E5PA 1TTIA 3WDQA 3G0UA 4FF5A 4R9XA 4C1KA 1TV3A 2GJXA 2F38A 2XIOA 3GS6A 3LXCA 3RFAA 5D2WA 1ML1A 3IK2A 3SGGA 3WLJA 2ALRA 3WDIA 1W9XA 4P8VA 4B92A 4E5TA 3HO8A 2C1IA 2ZZ7A 1DIOA 3ZXWA 2G37A 2BGQA 3AU2A 1VR6A 3ZT5A 4ZBCA 2OYMA 3POCA 1D7KA 2BBFA 3TLQA 3B8DA 4J9JA 1XJBA 1NWTA 1ZBKA 2PTYA 1ZBWA 1XBYA 1XLKA 4XZHA 4FNUA 2Y6ZA 3QGVA 1OFRA 3HGJA 4LC8A 2OSWA 1ENUA 3DESA 1MQQA 3A4WA 2DUAA 5AB3A 3SUVA 1SFLA 4W84A 2OODA 2J9XA 4JBRA 1XLMA 4YHEA 4CKQA 2ATSA 4EKJA 3GDKA 4NJGA 3TNOA 2ZWZA 4J2MA 1QPOA 4LS2A 2X2YA 1QU4A 1JQVA 1A5KC 1BKHA 3NQGA 1O60A 1MFUA 3R6IA 1PX8A 2D2GA 4O50A 3R13A 3EWUA 4CN6A 4CVUA 4OUEA 1SZNA 4ML9A 1QMLA 1C92A 1HO1A 1PSCA 4WF7A 4H8NA 3DFTA 1VPYA 3B4YA 3T8QA 1DYSA 5EU9A 3TW9A 4ZMGA 3EMQA 4CD5A 1HVXA 2SFPA 2OJPA 3IUDA 1CGUA 4NJKA 4X9YA 5E9AA 4C6IA 2DSVA 3MVTA 2PLCA 1KFKA 3KP1A 4MFEA 5B7ZA 5C5YA 3WQ6A 2ODOA 1W1ZA 1A5SA 1LTDA 4DJEA 3R1ZA 3OOQA 1IZCA 1FWDC 3AYTA 2C19A 4J3WA 3W87A 5HMFA 2RKXA 4DYEA 4LUTA 2GJNA 3I6TA 4GJJA 1DJWA 3LBCA 4JEJA 2OSXA 4RCXA 1X6LA 3I4KA 3NYDA 2DZVA 2FVLA 2VVSA 4LV4A 2YLAA 4AZBA 2X0SA 3M0JA 4AIEA 2FTWA 5LXXA 3TTEA 2PP1A 2YDQA 4GIAA 3U6WA 2DV0A 3L7RA 4ORMA 4R9OA 5D05A 1UASA 3GAKA 5T9CE 5E70A 3B8TA 3IGUA 1A4MA 3GNRA 4ZOBA 2X05A 1AFSA 3OO2A 2Q09A 4D6GA 5HUOA 2QUMA 3B9EA 3W1PA 3CUXA 1LWHA 1EO7A 3DFNA 1EJSC 2RFGA 3GIQA 1K03A 4E8CA 2QMJA 3TN4A 3TOYA 1OCBA 3MUIA 4FAMA 3FEMA 4FX6M 5EL1A 1QHZA 3L4VA 3SCUA 3MMDA 2PWFA 1MRAA 1VBGA 1VCVA 3MTWA 3BSMA 2CYGA 3FXYA 5A5WA 5MF5A 2V5LA 1QHPA 1DWAM 1Z41A 1FWGC 1BVWA 4ZTYA 3VIPA 4IPLA 4F0LA 3ONBA 2ISFA 3EAUA 2NUWA 1E3ZA 3BTNA 4OE7A 3LD5A 1TRIA 4JYDA 3THQA 2C18A 1I1WA 4NVTA 3GX9A 5C54A 1W9UA 3W1NA 4LXFA 4I8YA 3VDAA 3SADA 3NPWA 4GNVA 1MXDA 1J79A 1QR7A 3B05A 4NXKA 3ZT6A 3M5ZA 3PF3A 2PWVA 3T0CA 4FZIA 1R5YA 3CL8A 4UR7A 4LCRA 3XIMA 4CD7A 5HR7A 2WJZA 3V35A 4Z1CA 3T2OA 1RA0A 2FGBA 3V0SA 3SAZA 4ATDA 2PGWA 3W83A 3WLSA 1ICPA 1BEUA 2YL9A 4HA0A 2GGIA 4A2SA 1N2VA 3B06A 4OECA 5CZKA 3WJYA 1K9EA 3SQSA 1DPMA 4L9ZA 2QLYA 3IJ9A 4LVDA 3K1GA 3GUWA 1OEPA 1KXHA 4KT2A 4D1IA 3EPOA 4CCEA 3W7HA 4Q6JA 1R85A 4YTSA 2VEGA 1B9ZA 2XIJA 4JN7A 4KF1A 1FWJC 3FHQA 3PUEA 2PWDA 1QTWA 3BG5A 5E9XA 3VD5A 5A2BA 1J5TA 5G1TA 2RDTA 1JCXA 3QJAA 2BGNE 2VEIA 1P7TB 4XIMA 1M9HA 3V1HA 4NL1A 4DO7A 4J3VA 2OOGA 2Z27A 2OG9A 3ZR6A 3R2GA 4B2DD 4C7FA 3FA4A 1QW9A 3BANA 4RXGA 2DDXA 5E6ZA 4FNPA 2ZTJA 3ARQA 3PWAA 1XIFA 2WVVB 3H2OA 3WNPA 5IFTA 5FEWA 1TYGA 4LB3A 4BWLA 3IARA 4O4WA 1XIMA 3D5HA 2GK1A 1XG3A 1D9EA 3TYZA 2B4GA 4DBEA 3TYCA 1UKQA 5JIWA 2VWSA 1F61A 4IIDA 3O06A 4X60A 4QSHA 1T40A 2ZA3A 1GQKA 1CXFA 3RPDA 3P82A 5IBXC 4L4LA 4NJJA 3QV9A 4I9AA 4NNCA 5CQ1A 1L6SA 5D04C 4XD6A 4OUIA 3G18A 4BKNA 2B81A 1GYNA 2PEVA 1YNQA 5HQMA 4MY1A 1W3HA 4FB7A 4KMQA 3QW4B 1QOPA 1XF0A 3DH7A 2FFCA 1QI0A 2X1TA 1KCLA 2GGEA 3GWQA 3QLDA 3P62A 3AJ7A 4C6OA 2DQWA 1LRTA 3BLKA 2POTA 2XTKA 3OW1A 3W88A 2X1RA 2O0TA 2INEA 4JKLA 2VX5A 4Q6XA 3G0SA 5CZSA 1EL3A 5DEZA 1F6KA 2OX1A 3UXAA 3PWGA 3WD3A 3BV4A 4NXSA 1GZJA 3G1DA 4IGHA 4AWUA 5LNSA 2XIQA 3WLKX 4W87A 1ONRA 3NVTA 3MP5A 5L6UA 2BX7A 4HK5A 2E8ZA 5DRCA 3B3DA 3W7PA 5LGXA 3LPPA 1QK0A 2FB2A 4ONVA 1M53A 4MKSA 5AZ0A 2JKPA 3GE7A 4C6BA 2AOSA 2V5DA 2I1OA 3VMOA 1Z42A 2F7FA 1SO3A 4AHQA 2D0FA 3GXDA 5HPOA 3FDGA 3MI3A 4L1GA 3R4IA 4OBTA 2JALA 1KBKA 4K68A 1LBLA 1QUMA 4P61A 3ANVA 4DO5A 4US5A 1K6WA 3PJTA 2QDEA 4P7OA 2PDGA 4O13A 3RRXA 2A7RA 4N2YA 1RHCA 4UOZA 4IQDA 2DH2A 2XIBA 1JFXA 5D2YA 4H1ZA 2DP3A 1OGSA 5CSYA 4H3DA 4DZHA 3GTNA 2D24A 3OZMA 3M0KA 3W2KA 4PUDA 2FZBA 1GW9A 1DHPA 4HK6A 1K9TA 3LCFA 3LGDA 4PUEA 3NQCA 3RM4A 2FH6A 5CAHA 3E0FA 1BGAA 5U7SA 1ZHAA 2O7QA 2NLYA 1QOQA 2WMGA 2BOFX 4PEKA 2DQXA 3GC5A 2OVLA 3LXAA 1MO0A 5FAJA 3QSRA 5M3WA 4QS5A 4QLKA 3PB0A 3VIHA 4CD8A 3OYZA 1VBHA 5A1AA 3TTOA 1SMAA 4O4VA 3APTA 2PMQA 3AIRA 4XIAA 3O2LA 5K9DA 3OYXA 3WNKA 2BXYA 3JZEA 1GVQA 2Q6ZA 1RCQA 3CZLA 3DHUA 3OTRA 4P2VA 2JEPA 4Q8NA 4RE4A 1Q3NA 1SW3A 2X0HA 4N9DA 2P1FA 1RQBA 3DG7A 1PV8A 2DSKA 4W8AA 3TA6A 3TK7A 1GW1A 3E9AA 4QE5A 1A5OC 1CENA 4DI9A 2JF7A 4IPJA 4CNTA 3QQWA 1MEIA 1BXNA 5LA1A 3MUY1 5LNUA 1B30A 1F2JA 4DUOA 2E1WA 2V30A 2ZWYA 2ZZ4A 4QJ5B 3GR4A 1ZS2A 1QBBA 2I7GA 3T05A 2ZXBA 1LCOA 2PTXA 4NG3A 3J7HA 4J7RA 1C90A 1CTNA 4B3ZA 2FHBA 3I3EA 3WX7A 1VBJA 1KTCA 4GX9A 3D46A 1K7FA 4XG1A 3W85A 2ACQA 1H09A 5AY7A 2CESA 4QJ3B 3UG8A 2WXDM 1V7YA 1BYBA 4E3VA 3GXFA 2HPIA 3CQHA 4JX5A 3U7VA 3DEQA 1ZQ5A 2E9BA 2V69A 3E49A 5CC3A 2UV8G 2Z6IA 2HS6A 1L9WA 2EPOA 4S23A 3E2RA 3W23A 3IIOA 4ZA0A 3IS4A 3ARTA 2FMNA 1GORA 1ZY9A 2FPTA 2XGIA 3WUBA 2ZYFA 4HNNA 4YS1A 2B31A 3KAOA 3CIXA 3W73A 3OVRA 1RY0A 3QYSA 4QG6A 4NRSA 3PZUA 1JCLA 2XH2A 4PTMA 4ZQCA 4ZOCA 3AHTA 4JL1A 3R8HA 3GYEA 2ZICA 3KE0A 4AVOA 1RY8A 2VCCA 2QUNA 1O94A 5HINA 3CQJA 1GUVA 4ERAA 1HXJA 4IG2A 3SY8A 4JOMA 4B91A 3T8LA 4AEEA 1I8JA 1MI3A 2WCAA 2JQXA 4UTUA 1OM0A 1V3MA 2YYTA 1TTJA 2D3LA 1TE1A 1FXPA 3B04A 4HOWA 2ONEA 5CBIA 4DXKA 3UJFA 1TE6A 4PMOA 3LS9A 1E0TA 4TTUA 4N0RA 2YXXA 2CHNA 1XRSA 3UXIA 1IV8A 1JPDX 3A5VA 4JR5A 4O1EA 3RGTA 1S39A 2GWGA 3QTPA 1H7NA 1XCFA 2NWSA 3LDVA 3M7WA 1A0DA 3AOFA 3H7UA 1K7EA 3FKKA 2ZZ3A 5A6SA 1IGWA 3G1SA 4DJFD 8XIAA 1YHTA 2ZUWA 4WD0A 2X7WA 1F3TA 4GYJA 3TJ4A 5CLWA 2V3FA 4G2DA 4DJDC 3NQAA 1W56A 3KLLA 1RUSA 4G7EB 3FEQA 3UR5A 4HNCA 3OU8A 3F5JA 4YVXA 1E1FA 3DOPA 3ZR5A 1YDNA 2NQLA 2ZOXA 3TJIA 2PLJA 1A3XA 3SJNA 4JTEA 2ZXDA 5DMNA 2EPKX 4AC7C 1MUMA 4IP7A 5D02A 1P0DA 3B40A 3JW7A 1LYXA 1MYRA 4WSHA 3QF0A 2IKGA 2OO0A 1Z8AA 5H91A 4PFHA 1X97A 1R3WA 2E0PA 1DXIA 2C14A 2HS8A 2NV9A 3TFXA 3QY8A 2PDPA 3FSTA 1ONEA 4RNHA 1FH8A 3PPHA 4JPGA 1KM3A 3VD9A 2R94A 3SRKA 4MNJA 2H90A 3AXKA 2WNQA 2FVKA 3OHMB 2XPKA 3GXIA 4EF9A 5EY5A 3WL1A 1KNWA 3ZZ1A 2EJAA 4NP7A 1A5AA 2D2JA 3W1MA 4F9DA 3LHYA 2QCHA 4GD0A 4LUIA 3W2NA 1DQXA 4H9XA 1P1XA 1OX6A 2ALDA 4X0VA 5I23A 1A47A 3LHVA 3E12A 1TREA 4C1NA 1GNXA 1JQXA 2J8TA 3FK4A 4KCTA 3KRSA 1OF6A 4NAEB 1WE5A 3HGRA 3NJ3A 2B7NA 4A05A 2QCLA 1WDDA 3F4WA 2GK1B 1TPVA 1NOUA 4KWUA 3ALGA 1CXLA 3F5KA 3D47A 1PYMA 5CC7A 3CIWA 4DXXA 5AC5A 2WCGA 1HO4A 3WMCA 1TR1A 1E9IA 1PJ9A 3NYZA 1Q4WA 4A3UA 1BTMA 5TQLA 1R8LA 1P4CA 2J88A 4AD3A 2Y62A 5H6HA 5D30A 1P0EA 1QNVA 2EXOA 3W7DA 5EGRA 1QPKA 2NVAA 2PRMA 5D9PA 3DG3A 4JYEA 4DI8A 2GWNA 1AL8A 2FVMA 3KBWA 2RH9A 4AVNA 1TV2A 5D2XA 4GYPA 1BQCA 4FIQA 2Z1WA 4IPIA 1RQHA 4FXJA 2PDQA 1K4HA 2DJLA 4MJ2A 1M5WA 4C60A 2A79A 3GXNA 2O9PA 2VR5A 4AX6A 3W6MA 1AODA 2VO5A 1UD2A 4RZ5A 4Q8OA 1XUZA 1TWDA 4D6EA 3DHFA 2GYIA 5I3GA 4X0NA 3MYOA 3RRAA 1QCWA 6REQB 3P0XA 1OYBA 1Q6QA 3LHUA 3R8RA 1XDJA 1GYLA 4I7VA 1V51A 3FGCA 5K2ZA 4B5SA 1XD1A 2XISA 2E77A 3V75A 4JN6A 4LOCA 1EWEA 1Y8BA 3MHUA 2E6YA 4IQLA 1E9YB 3MMTA 2CKRA 1EJWC 4MG4A 3LA4A 4W4QA 4LEFA 5AYBA 3AICA 2ZX8A 4PGLA 4S3BA 3SIMA 3M6YA 3C86A 4CN1A 1OC5A 2RUSA 1DTNA 4JQ3A 4YU1A 3FVMA 1HG3A 2X41A 3TZNA 2CWNA 4O1AA 3TCSA 1YPXA 1D3HA 4NZ3A 4O52A 1T7LA 4X2RA 4QJ4B 3LRLA 3VI2A 4JX6A 4BQ5A 4L9XA 3EDJA 1NDZA 4YIWA 4AH7A 1A3HA 1G4PA 1XDLA 4K8EA 3VKBA 2E25A 4JIEA 2XFWA 2PP3A 2Y70A 5AZ1A 4HHMA 3A13A 4D6JA 3RPTA 4HN4A 3KP0A 1BKSA 4OFCA 4GXWA 1XLGA 1M7PA 4LBUA 4LRTA 1UBPC 4HA1A 2EG6A 3EOUA 4K2SA 4MF4A 5D33A 4MVAA 1JAEA 3DECA 1NWUA 3N13A 1UROA 2WMIA 3N2OA 4LV9A 3WUGA 1ODZA 1XRTA 4M56A 1F5ZA 1EYWA 3VNZA 1RR2A 3B8WA 1NEYA 4LPCA 4M6PA 2WZMA 2CBVA 3S2NA 2J8GA 2OLAA 4W8BA 4LNYA 3BE7A 1N8WA 3TX9A 1HL9A 1KD0A 3N2MA 4Q33A 4ORIA 1UG6A 3S1WA 4B15A 2ZZ6A 3WF1A 3HG4A 1JNDA 5DCEA 6PTDA 1SZRA 2E4TA 1RK5A 3SCPA 3CLWA 5A6BD 1E1EA 5DXXA 1GOQA 3AIUA 5DO8A 4H9YA 1VJZA 3SSZA 4JQAA 1FXQA 1M7XA 2UY2A 1JF6A 1P1MA 1TCDA 1N82A 1EF3A 1UKOA 3B9DA 1POKA 3M0MA 4ZQNA 3WDHA 4QROA 3RUBL 3QGAC 2F6XA 4G1NA 2P3ZA 1R30A 2NXIA 3H2NA 4DJFC 4IIBA 1YBQA 1SJCA 2V67A 4HSHA 4JHMA 1PUDA 2GLKA 2QAPA 4LEQA 3CH0A 1VLWA 2PWHA 3OBAA 3WK2A 3PP7A 4EP8C 1KWKA 4P8XA 3BH4A 1HJXA 3UBPC 4NSBA 1VF8A 3KZPA 3KXQA 3HU7A 4NJIA 4LTSA 1A5MC 4K6AA 1NARA 3V0TA 3LEPA 2AAAA 3FAXA 3EWCA 2EPMX 3KBSA 4TR9A 3TYAA 3FSUA 5I3IA 2DZTA 2D73A 3S47A 4WDXA 3NXLA 3W1UA 4JFSA 4GGHA 4ICCX 2VMFA 4ZOAA 5ABGA 1ZCOA 1ZAHA 4O1DA 1S2WA 3I7RA 3EEZA 1WNOA 5ABFA 3WLIA 3RO6A 4WDTA 2PGRA 4UQAA 4CCDA 5HPCA 3HPAA 2V2DA 1X98A 1A50A 1JZ3A 7ODCA 5HA7A 4EWJA 3FA3A 2GQAA 1ONWA 2OZ8A 4UOJA 3V5OA 2WNNA 3G22A 4EE9A 1XDMA 4QP0A 5F2LA 4JFTA 2NSOA 2DU2A 4JXCA 3DENA 2WJEA 3E74A 1M3UA 1X39A 3ZJ8A 3IEBA 2PRLA 4O1BA 3RN6A 3WK3A 3ISIX 1EBHA 2BODX 3BAIA 2R1MA 4CCZA 1OK6A 1Q7MA 4AQLA 2G97A 3T9PA 3KRZA 1KM5A 1O68A 1H7XA 2VFFA 4X22A 1LWJA 3CNYA 5EFDA 4M1RA 5HULA 4Q8WA 3EDFA 1W2PA 2J25A 2J9YA 3FV9A 4IFKB 5FEZA 3SGZA 5JBFA 3TLLA 3DZ1A 7ENLA 5KZEA 3GTHA 1Z32X 3U5UA 1V5XA 1AQMA 5DMYA 2YCEA 3B0PA 4C6NA 4ADSA 1M03A 4UZSA 4ADTA 2YA1A 1ADSA 2BS9A 2CEQA 4LGXA 4D71A 4XTDA 4A29A 4DYKA 3L2IA 5F2IA 3EWXA 1H5YA 4EXBA 3U57A 3VX0A 4AB4A 1B31A 4DBUA 4AZ5A 2HVMA 1UD8A 2QR6A 3PC0A 2QT3A 2V9DA 3SI9A 3WK0A 3USBA 4J35A 5BU9A 3DN5A 3I6RA 4XO7A 4E2OA 3K5XA 2XFRA 2BLEA 4HYRA 1GVRA 1FWSA 3STPA 3WUFA 3UWWA 3R43A 3GKAA 1IF2A 4K8HA 2GQ8A 4O15A 3UCDA 4Y90A 1VRDA 4QEHA 1J11A 1DHKA 3VIJA 1FDYA 1VC4A 2HE8A 3GIYA 4BY3A 2Y1HA 1DKWA 1HTIA 2BG5A 5REQA 2IXUA 4PCTA 4JTJA 2CWXA 4HPJA 1UJPA 3MO7A 2XH0A 5H2ZA 4DNHA 3HMJG 5FF3A 1Q6RA 2FPYA 4XZNX 5HNRA 4H7CA 4MYAA 2XWEA 1REQA 1MEHA 1YQ2A 2GVEA 1M6JA 2ZRWA 1V02E 3O8AA 3ZLGA 5K9CA 2WOQA 3GNPA 4DNMA 1MUWA 5FAGA 1MRQA 1WOAA 2BDQA 3F4CA 3CHDA 3SDOA 4V15A 4TV5A 4LAOA 2XH7A 1CT5A 4UZUA 3ABZA 1BF6A 3RU8X 3FA5A 2I5QA 1Z44A 4REQA 1X1NA 4C65A 4UFJA 4JX4A 3W00A 1DVJA 1FFQA 5ABHA 3UA3A 3W27A 3EX6A 1LT7A 3AI0A 2G8ZA 3AIVA 3P8IA 3W84A 3MBDA 4ZO8A 5I78A 1XLIA 1I2PA 1AW2A 5CG7A 4WKFA 3BAXA 2ZUUA 4O57A 2WQPA 1I1XA 1UQZA 3FCPA 3NR0A 1Q6LA 3P6LA 4HPXA 1V3LA 4DHGA 2XVPA 2P88A 3N6JA 2VDGA 1H62A 3MZ2A 5F4XA 4ZCWA 1KQZA 1FHUA 4ZO9A 4M24A 2PDFA 2QV4A 5CPNA 3RX3A 4IIEA 3N4EA 3THCA 3IWPA 2OU4A 4Y96A 2O7SA 3BZJA 3MCNA 2DZPA 1UH3A 2IS7A 1EH9A 1GPFA 5A6BA 1EF2A 3EZ4A 3VOCA 4A21A 5C9RA 4XD3A 1EA0A 2ACSA 4OOUA 3PY2A 3C4UA 3P3BA 5IM51 3KOFA 2YXOA 1Y7VA 1CXIA 1CLKA 3QFEA 2ISVA 1XS2A 4UTHA 3PTMA 4NAEA 1QWGA 4I6KA 3LV6A 2JIWA 4JQ4A 3L2LA 2A3LA 1QRQA 3TA9A 4D6IA 1QAPA 2ZA2A 5C7HA 3B0XA 4ZE4A 2CZEA 1CEOA 4O28A 5HBFA 4LCQA 4UTJA 1NOWA 2VP8A 3BAJA 3XINA 1XGZA 1H1NA 8A3HA 2VEFA 3BVJA 1VEOA 3B0VC 4CNOA 2CW6A 1ZAJA 1IEWA 3VTRA 3CZEA 1GCYA 3OLGA 2Z2AA 4UFLA 1AA1B 4E4PA 4UCFA 1UYQA 4KS0A 4ZVJA 4JGDA 3VE9A 5A6MA 1E0VA 1QFEA 1I0BA 5FJPA 1S38A 3AUJA 4ACYA 4QDPA 1KFJA 2VZOA 2X16A 4GI6A 4QBXA 1E5NA 2MNRA 3C6CA 1G9HA 3WFAA 1L6FA 3KRUA 3T55A 3QR0A 9RUBA 2OT0A 4ZQOA 4BQ2A 1W91A 1OB0A 3ARVA 4KCVA 4FNSA 4PB3A 2FJUB 2O9OA 3NQ2A 1W9PA 4C6JA 4J4KA 2QDDA 1L8NA 1PWLA 4GGBA 4UQCA 4XD5A 3HF3A 3QQ1A 4XSMA 4ZENA 3VM5A 4JNMA 5HAOA 5FJUA 3KOZA 2VX4A 2FGZA 1XLLA 1BAGA 1I45A 2Z0IA 1YDYA 2BY3A 1JVNA 4U3CA 3GG0A 1W1IE 4PH6A 2BVTA 1L8PA 4DWSB 2W4XA 3VD4A 2VELA 4DRSA 2EBNA 2QNEA 2VRKA 1JZ6A 2PLMA 4W85A 3AU6A 2X09A 3O6AA 5BXTA 4LQ1A 5LGZA 3GLCA 3BOFA 5A6JA 3PBUA 1Q6OA 1BF2A 3GVQA 3W07A 3C0JA 3P93A 1MNZA 1S3HA 2OWXA 4R85A 1UP0A 3CPRA 3EKLA 4MB4A 2VGFA 3OZPA 2PZ0A 2ZX7A 4B2DA 1RJRA 4XKYA 1J9YA 3CH9A 3GTIA 1BYDA 1JXKA 2BZNA 3S5ZA 4W5ZA 2J78A 3S2CA 4Q7IA 3PFMA 3URBA 1XIIA 1UW9A 4XX6A 3NPVA 3A3XA 2XINA 3GFZA 2WKGA 3G1AA 3WQGA 4KESA 1WQ5A 4HCDA 4WJXA 2MUCA 1ZCCA 1DWGM 4V1XA 2D1ZA 1TPC1 4QITA 2DSZA 4BFAA 4FX7A 1YLVA 4U3AA 2HBVA 3GU2A 3MMWA 4AIOA 1A5LC 2WHMA 5G5IA 2W62A 4MLRA 5GVJA 1SZGA 4F0MA 2FHFA 2I9EA 1UA7A 3L4TA 3LM3A 4H4IA 1QOXA 3H2FA 3PZMA 1EX5A 1RPKA 3AIEA 1X8CA 1ZB5A 4KFNA 4GCAA 2A2IA 1A49A 1WDPA 1A5BA 4DZIA 1BFNA 1JAKA 2F6UA 2GSHA 2CU0A 2OPJA 2FTPA 3RAOA 5ABEA 1BXCA 4Z1YA 3FIGA 4RV3A 1YYAA 2YDSA 3CYVA 1FOBA 4NZCA 1V3KA 4YTTA 2X0YA 3UWUA 3VZZA 1P48A 1HZYA 1FHVA 2ZUSA 2RGLA 4IUOA 2E8YA 2A6NA 1FWTA 2XGZA 2HEJA 4CD6A 1TA3A 2C1HA 5TD4A 3TIMA 2XM2A 2Z29A 5DBUA 2C6QA 3FX4A 3S4TA 1CGXA 3R79A 1EUNA 3KW3A 4ZO6A 1M41A 4H9UA 3AFBA 3A5FA 5BROA 3UZZA 4PYSA 1X1ZA 2Y61A 5I77A 1K7XA 3R5EA 4LYPA 3VNJA 2PTZA 1J8VA 3W29A 5I3DA 4AWEA 2VQUA 2BVWA 2FHCA 1DBTA 2GDQA 4GC3A 2DZXA 4MJ4A 3CEPA 3HIJA 4KW2A 1CXHA 4AZ6A 1GQNA 1XSKA 3UPMA 5I3FA 5C9XA 4H7VA 4L6OA 3CHEA 1ZUAX 1DWJM 4EACA 4PL1A 4DY1A 1NY1A 1KV8A 4XWUA 3PJWA 3PSWA 1GG1A 3IAQA 3MPGA 2PZNA 4O16A 4QG8A 3UY7A 2WSRA 3BJTA 1J2WA 1GVFA 1X38A 1KGUA 1B3XA 4N4QA 5HXMA 3AO0A 2BV9A 5D37A 2HV5A 2NWRA 3RO8A 4UQBA 5A8QA 2E6FA 4RXFA 1JYNA 4KGLA 4D8ZA 3STEA 4L7ZA 5D2TA 5DF0A 5FF7A 3VO0A 3EB3A 3OLDA 1H11A 3F03K 1NFBA 1XLHA 4YL2A 3W1LA 2PDUA 3P14A 3LSBA 4QE1A 2XG9A 4DF2A 3CT2A 1PZ2A 4MY9A 4GABA 3W2MA 1GJWA 3KTSA 3G0XA 4IMDA 1LF1A 4GBUA 2XFFA 1GVSA 3PJXA 1UWAA 4IXXA 3TYEA 1YDOA 3RNDA 2YCLA 3WK1A 3AIQA 3VDCA 4UTIA 4IGSA 1W3TA 4OWGA 3E6EA 3RJXA 1OG0A 1FQ0A 2A0NA 3S5OA 3AQUA 1EFZA 3THUA 1JGMA 4CNUA 4UWMA 4S39A 3AWOA 4TIMA 2BTMA 4A6GA 1QDSA 4JKKA 1ZL1A 2A85A 4DBSA 3UCCA 1EUAA 1YMYA 4UFMA 3W7GA 1MWOA 2AQVA 2WC7A 2DVTA 3RR4A 1B54A 1U2YA 4S3JA 3A6OA 1DQWA 1ISYA 1BD0A 4IHCA 3ATZA 3LMZA 3UF9A 2AL1A 3S46A 1GQJA 1GVOA 4YHGA 3SN4A 3G8RA 4OV9A 4US6A 5EFFA 3VILA 3WIJA 1VBUA 3HG3A 3B8UA 1P6BA 1ZSXA 3EOLA 3NFUA 1FDJA 1EYEA 2QVHA 3RM8A 3ZJ6A 4FMVA 1TVNA 3LBOA 4LW7A 4HVXA 3ANUA 3I68A 3BLLA 4TXEA 5CH9A 1KA9F 4AZ7A 1O7AA 1YNPA 3FNDA 2NQ9A 1E73M 2IPWA 1JZ5A 3QBUA 2ZC8A 2OFJA 3RPMA 2VYOA 4K39A 2AL2A 4PUKA 4X9SA 5LIKX 6ALDA 1POJA 3GH4A 3WMLA 2DSUA 1F4HA 1AH0A 2VRQA 4QQ3A 3CHVA 2ASHA 1W3JA 2ZC1A 2QF8A 3GHRA 1XM3A 4Y2WA 4N6EA 3IANA 2WJDA 1C8XA 1JYWA 1G4EA 2P10A 3R7MA 4HJWA 4J27A 1X6NA 4X61A 3AHZA 2QCDA 4Q3MA 3ITTA 1VFHA 1TPB1 3UT0A 1UWRA 5KETA 1RP9A 1LDCA 1LJYA 2P53A 2B7PA 1TUFA 4K7VA 5DMLA 4MUZA 2YL6A 3KL0A 3UYIA 2DJXA 2Y24A 3T6CA 1DE6A 4CLMA 1C93A 4P7NA 1O5KA 4YTQA 3KOYA 1WKFA 3A47A 3L66A 4DJFA 1WX0A 1X7FA 3NUKA 1GJUA 3RF9A 4F4RA 1J12A 2YBUA 4CQCA 3N12A 4RE0A 1OC6A 2VFDA 2V5JA 3HGOA 3FJ6A 3VYLA 3SCSA 4K7YA 4GX8A 4DZAA 2PCEA 3MSGA 1TJ1A 1VEMA 3M0IA 1VZWA 1SR9A 2J62A 4FEZA 3MWCA 1ZU8A 2ZUNA 1QVBA 4RZ4A 3ABQA 4L4MA 2G50A 3LCLA 3W1QA 3IJIA 4S3EA 4M6QA 1EJTC 3W7QA 1UUOA 4FLRA 2G0WA 1J01A 1FKWA 2ZDRA 1WP6A 4GA8A 3NTYA 4QJ1A 5ENLA 5C0QA 4YVPA 4BJHA 5ABFB 3U2OA 1H60A 3UZJA 3GDLA 1RBLA 1IR1A 4AD1A 3T0TA 2W27A 2YL8A 5DY3A 4HQVA 3LYEA 3WJSA 3KOWA 2HJPA 3BGAA 3GVVA 4IUGA 1LRNA 4JQ2A 3K4AA 4GQRA 2IKIA 3QH2A 2GGGA 1JDEA 2XH4A 1R2TA 3H8AA 1AH3A 2A3HA 1H2JA 1QPRA 2Y0FA 2GUUA 1KLYA 3A3HA 5C9ZA 3LTPA 4I7WA 2CBUA 1G0CA 3QRHA 3BW2A 1BVZA 3SY5A 3WDJA 1DEDA 4Y9MA 2Y4SA 3Q37A 1RXOB 1Q6FA 3WNOA 3DYMA 1C29A 4IIGA 1PKLA 1ZJHA 2DEPA 2ZUTA 4G1KA 1F9CA 2OQYA 3Q65A 4IX2A 3A4JA 2WMIB 3EB2A 3UZWA 4ICMA 1R3YA 3N3TA 4PBEA 1KBLA 1YADA 4ICNA 1L6GA 3AMDA 3SCRA 2J79A 1E1CA 4GNKB 4MDOA 5A2CA 3IJDA 3G24A 3P74A 1IEIA 3QY7A 5FESA 1QXLA 3IIVA 1NQKA 1W37A 1HKJA 4O54A 4ZOEA 3UA4A 5HJLA 1FX6A 2OX4A 2UWFA 2YB1A 4FXFA 4HKPA 1JD9A 4Y6GA 3RX4A 1UUQA 1AQ0A 3CUJA 3VGBA 1EIXA 1UR2A 4DAFA 1XBZA 3IJQA 1KCXA 1H5VA 4KETA 5BXRA 4ZGYA 1Q2SA 1I2OA 2HTMA 1F8MA 4PRWA 1K9FA 2WLZA 2V8ZA 1JYVA 1S1PA 2RDWA 4HIBA 2ZTKA 2PTWA 4GYPC 2PP0A 4O14A 4H00A 1TVLA 1T8QA 4NT0A 3TCEA 3MKKA 2Z28A 3GHTA 3PZQA 4KRUA 1UCWA 1D8CA 2HVNA 1SFJA 2NLIA 1CIUA 2BP1A 2QCNA 2NW0A 2HNHA 1LT8A 2XVNA 3GC2A 5CZTA 2VEMA 4JTHA 1BWKA 4HN8A 3LXBA 1E3XA 3K8MA 1E6XM 3NEHA 2XN0A 3FFSA 1KRBC 3W28A 1YTDA 4O0QA 4A2RA 1DV7A 4M0XA 2RJHA 1K8ZA 1A53A 3VGGA 1UHVA 3NWRA 4JTCA 1VYPX 1N55A 1O5XA 4J5NA 3JR2A 1R2RA 4XV0A 1R3QA 3LOTA 2I16A 2G95A 5FIPA 1MFVA 5I06A 1E5JA 2G3IA 3EBVA 4JTDA 2TMDA 3OLIA 3SSJA 4POCA 1OY0A 2WKJA 1KLZA 4R27A 3MZNA 3GDMA 1VAHA 4I7UA 1AW5A 3T81A 3UWZA 4AC1X 4DJDD 3U9IA 2R1NA 4C90A 1KO0A 4YCPA 2GVLA 4LUSA 3V4BA 1OD8A 4TX9A 1FWHC 2RGMA 5AC8A 3GG7A 1NP0A 2WNZA 5LIXX 1NF0A 1XI3A 2Q01A 3V1PA 5AYYA 2A3AA 2YXGA 3OIHA 2YX0A 3UEQA 5EMLA 2CITA 2VCBA 2P50A 3EOOA 2YCLB 4NRRA 1CLXA 2X1UA 1R38A 3CTTA 1NOFA 1VPXA 3GQYA 4J3XA 3CL7A 1GTEA 1FVPA 2OB3A 4UXDA 4KIRA 4XSLA 3S1XA 3I65A 3KCOA 2XFYA 4LUTB 3T0AA 2YLLA 2HCVA 4J3UA 1JPKA 3VNDA 3WBYA 3QC3A 3NQEA 3M0XA 1FA2A 3U2CA 4S3KA 4C6PA 3NZ1A 4NNBA 4WY0F 1B2YA 5EKYA 3GFXA 4B5WA 3R0DA 2PU0A 3RILA 1BWLA 4HU3A 2QJJA 3W81A 3BAWA 4QDMA 4OKDA 4LY4A 4JN8A 1G7VA 3BGJA 4G6CA 4CNPA 1O4UA 3AMCA 4X3ZA 3WH9A 2GVJA 4K1WA 4QCFA 3HQNA 4B5UA 3HZ3A 3MBFA 4XZBA 2A3EA 1J4EA 1RA5A 1SYTA 1SMDA 3VGFA 1PVNA 2BSLA 1KFLA 5CZ0A 3LV5A 1UP3A 4DM2A 1E56A 2W5FA 3LLFA 2Y7FA 2Z7GA 3I6EA 3R94A 2XWDA 4PCSA 1K8YA 1PL9A 2V3EA 4I5UA 4E8GA 4GFIA 3BJFA 1SO4A 4BHYA 1FFRA 1JIBA 4J40A 4H9TA 4E0CA 2NQJA 4UNLA 4RDWA 1NSJA 1DJNA 2DGAA 3WH7A 1YIXA 1TX0A 1IT0A 2BXZA 4BZYA 4MPQA 2VFHA 2H3DA 4M8UA 1H7RA 3BZGA 2E7FA 3CPGA 4NNAA 3W7CA 1V0NA 3S5NA 3LPOA 1XIGA 3GFYA 3BC9A 3TN5A 1CLVA 3GXPA 1EC7A 3PBVA 4O0ZA 1H61A 5FF2A 4PBFA 1UWSA 2VT0A 5M17A 2EG7A 1WZAA 2PA6A 2ZUMA 1HVQA 3E3HA 4L4PA 1BQGA 4MSSA 1J93A 1RJPA 1EO5A 2VGGA 1G7UA 3N2TA 3G1RA 1FHDA 2FQIA 3BICA 1TG7A 1UOZA 2WLYA 2P3EA 4GG9A 3G1YA 1OFOA 3JUGA 3ZJKA 2CXEA 4BWLC 1XR2A 1S2AA 2EG8A 2GSJA 2Z6JA 4IM4A 2VD8A 3B8VA 2CHOA 3MT1A 3ABXA 5F2MA 3ANYA 4UMBA 1KM6A 1Q6CA 2W91A 3INPA 2TSYA 1UOKA 1D3GA 2WW5A 2XVLA 1UR4A 4PMNA 2J75A 1FCUA 2I14A 5G1YA 5D09A 5LA2A 3I3DA 3ABRA 3SUTA 3WQ5A 5CGMA 1LG1A 2G4JA 3LGEA 3RR1A 4Z08A 4YWSA 3N29A 1SW7A 4JFUA 3SURA 2DUZA 3GHSA 3OQEA 3G2GA 4XAPA 2QGYA 1P7TA 2UZ9A 2VC5A 4LBSA 2QV5A 2CLEA 2FZ8A 4L65A 5XIAA 2FKPA 1KR0A 4Q32A 3ZIZA 5EB8A 3UXKA 2E9LA 5A6AA 1HIZA 1KCZA 2OT1A 3UWVA 4HA4A 5GNYA 4Q7NA 1RJQA 4LVFA 2FH8A 3TTYA 3G1VA 4GWEA 3DGBA 2HSAA 1C3FA 1NELA 3BQ6A 1K1DA 1XG4A 4XK2A 3FOKA 1QI5A 4Q4QA 1OQFA 5LIUX 3OODA 1HT6A 4HNOA 4GH1A 2D0HA 3WLMA 2WHKA 3VKDA 3CAQA 3G3MA 1TJRA 4ZXLA 1ELSA 2YA0A 3TAKA 4WLCA 2ZRUA 4DIAA 3C3NA 4WUIA 3OB8A 4O18A 3PPFA 1A5NC 1V0LA 2WMJA 4FLQA 2G3MA 3M46A 3EA1A 5DMMA 1K8CA 2PF0A 3IK4A 2EPLX 3O0FA 1Z6KA 5FJOA 2OR2A 3TU9A 2ATMA 4AZCB 1EGMA 4FS9A 5MKGB 3HV9A 3NEVA 1SSGA 1KXVA 3PWIA 1WUEA 1XIEA 1OJXA 3C56A 3EDEA 1JDAA 1MXGA 3P80A 1VFOA 3UPBA 2VGIA 1M01A 1R9XA 1ITXA 4XB3A 3L23A 2PSNA 4D6FA 3C3UA 4HU4A 2QCDB 1WDSA 1QW7A 5BNKA 1ZTVA 3S5SA 1JZ4A 2GUBA 4F0KA 1FWNA 3IRSA 3MUZ1 3OA5A 1S5WA 5CPMA 3WF2A 3LHWA 3OPSA 4WSKA 1B3VA 1PKNA 4ERIA 3CU2A 4ZE5A 3W26A 3TYBA 1F4AA 3ARYA 4FLOA 1GWJA 3BL3A 3W7KA 2XHYA 4A8NA 4AUBA 3AWNA 3RMEA 4OGZA 5E1QA 3EA3A 4I5RA 4C6DA 3W82A 3FLUA 3APYA 3OZOA 2IQ0A 4W88A 4IIHA 5D32A 1KBJA 3TQKA 5D9NA 4EXAA 4MB5A 5BXPA 3TSDA 1S5TA 2O9RA 4DN1A 1WO2A 1TV5A 3M0YA 1CCWB 3S42A 1XV8A 2X7VA 3W71A 3DUGA 5E5CA 4BI5A 2PU1A 3PG8A 2C13A 4XBKA 1F76A 5KSWA 3AYRA 2VD9A 1JDFA 2J7GA 2QUTA 3NDOA 3EX3A 1NM9A 1XISA 3GVWA 1LBMA 3WF0A 3FW6A 3N18A 1QWKA 2X1SA 4WKHA 3MW7A 4UR8A 2W79A 5LIYX 3B9NA 3N34A 1Q63A 4J2PA 4O8RA 1F73A 5JU6A 3QZEA 3C2EA 5A8OA 2AMGA 5D8WA 3N9KA 3MQTA 2J27A 1Q65A 3UXDA 2H3BA 3IGSA 1OGGA 3PAOA 3W7IA 3UD6A 4FHAA 4BF5A 4D72A 3RLHA 3ZJ7A 2QIWA 1KM2A 5GNXA 5KZ6A 5E0CA 3Q45A 4MKVA 3PSVA 3AYSA 3G8EA 5F4WA 3HURA 3PNUA 2QCMA 1M1BA 2A4AA 4H2CA 3CB8A 3GM8A 4HNTA 1AD1A 1K9DA 3UFYA 2EF9A 2WSKA 5G2WA 4WR3A 1FCQA 1CPUA 1F7BA 1VFMA 1YDVA 2A6LA 2QXWA 3U5YA 1V93A 1WUFA 4GO9A 1OIFA 4YNGA 5KEZA 4PTVA 3QM3A 4IL2A 4YPJA 3WBWA 3PBWA 1PDZA 1U1UA 3PUGA 3CAWA 4HP5A 3SB0A 3PZOA 2GJPA 1OFPA 4QAWA 3SN0A 3N17A 2KZHA 3A12A 5C2XA 4RUBA 2WAGA 2GOUA 5A8NA 3ES7A 2VWTA 4J3TA 3XISA 1NAL1 3UNDA 2QVNA 1GT8A 1WDWA 4G8TA 2ISWA 5CPOA 3NZPA 4JDBA 2XSAA 2AKMA 2V3GA 1MDLA 2PBGA 4M29A 4NIRA 3WD2A 1MEWA 2OEJA 1TO3A 1DE5A 2DZUA 4MHBA 4NZ4A 2R1LA 2VKZG 1LUCA 2EKGA 1HGYA 2HZGA 3TXZA 1EKOA 3CJPA 3K4DA 5KITA 2VTFA 4YCOA 1GQLA 4S3DA 1FWEC 3WQCA 5IXEA 3MV11 4D6CA 2C79A 4XD4A 4XAFA 5IHSA 2BOEX 3KFTA 4F0RA 2P76A 2XVKA 3H22A 1H50A 2YFOA 1SJAA 3L4XA 3KBVA 3UNTA 5EMYA 2R6OA 1CBGA 2BVDA 4K3ZA 3GNOA 6A3HA 4B9ZA 1XFCA 2O9TA 1ADDA 5C71A 4JNZA 4R34A 3BCFA 1K77A 1V6YA 3HG5A 2PDKA 4HB7A 5CJMA 2XIIA 2JGYA 1F6YA 1YXDA 1K8XA 3RMJA 3SGUA 4TQTA 1Z48A 3HJZA 3TROA 4FP1A 4KPLA 3RYSA 2HMCA 2PDYA 1XLEA 2MANA 2GVGA 4RX0A 3ARWA 3QQ0A 4OOZA 2E9MA 1XYCA 5CSRA 1LZOA 2D69A 4M6VA 3U0HA 4BCEA 1RK6A 2QJIA 3QLLA 2ZRYA 3N4FA 1JYXA 4JKMA 4S3CA 3QYQA 3PZ9A 1LRQA 3LBMA 1A5UA 4U28A 3KBMA 2QPSA 3A9IA 1BSLA 3EKGA 4GI4A 1LLWA 3FYPA 4BQ4A 4WHBA 3W7LA 4H6EA 3VPLA 3S9YA 4MZ1A 1RP8A 5IOBA 4M82A 1TPDA 1R3RA 4XQ6A 3M6DA 3UW6A 4IJRA 3GTXA 4JY9A 3NNTA 2CZ5A 2W3ZA 2DIJA 4TMBA 2PGFA 4ZL1A 4MYXA 2ZXAA 1SGJA 4FALA 3UXLA 1FTXA 4Q4SA 3HPSA 1UD4A 3UR8A 1GVEA 1ZJBA 4EF8A 5TF0A 3WQFA 3H54A 2WBGA 1B90A 3LCWA 3NQMA 4FF7A 1IIGA 4R7OA 3WNLA 2ACUA 5CPSA 1IYXA 3ALFA 4F8XA 1MZRA 4L5ZA 4IPPA 3UCQA 3H4GA 4L9YA 1OD0A 3S1UA 3EXTA 1CB2A 3WELA 3QN3A 1KGXA 3TH6A 2G4FA 2X1IA 4JY8A 1XLJA 3VD3A 4B4HA 4IFKA 1JZ2A 3AXMA 4Q4PA 3B4UA 1B3YA 1AUSL 1H4PA 3W7OA 3P60A 1D3CA 2BVYA 3QOKA 3EMZA 3UR7A 4LVGA 2J6XA 3NGJA 3WEOA 1J6PA 4QX4A 1UJQA 1EPVA 3KVJA 1PX3A 1WXJA 2VJXA 1TSIA 4DJEC 3AAMA 2DT3A 3N4AA 3ZSSA 1A0CA 4I9MA 2JBMA 3NAVA 1AG1O 3RHGA 2C71A 3LERA 2E5BA 4O0KA 2ISDA 1MQRA 4BEQA 2HNEA 3MHFA 3G6LA 2OYKA 1EB3A 4IP4A 3M9YA 1XKYA 4ERGA 1XBXA 4QE4A 1NFPA 3EGJA 4PUJA 3EA2A 3UJRA 4I90A 4O1FA 3SCWA 1QPQA 3O6DA 5HNTA 5F4SA 3AZRA 3KBNA 1IXOA 2A21A 2QUUA 3ZVHB 2VR4A 1ISXA 2OCZA 5G4HC 3PAJA 4CU6A 1VFUA 2B0MA 4OHQA 3EX1A 2NT0A 3SCOA 4NQ1A 1H7WA 2CZFA 4PMJA 4F2BA 5K4XA 4QNWA 1P0BA 4HZ6A 3ITOA 5AHLA 3LSCA 1YTKA 2OWCA 3U8GA 1T0OA 4XAGA 4CVWA 4X63A 1W5PA 3NO1A 1OVDA 1XX1A 4Y7EA 2FIQA 4AD4A 1S5MA 4GXPA 4FR1A 3HQPA 3PTQA 2DPEA 1R46A 5DANA 1DXFA 4FPSA 4MWAA 5HQEA 1XSIA 1W1YA 1B57A 1UMLA 3TR2A 4QHRA 2R91A 2J8FA 3P67A 1E51A 5J5DA 3N14A 4GINA 1VIWA 1OHLA 2CZDA 4US5D 3SQMA 5LIWX 3W2LA 5I00A 4F3HA 1F6PA 3VOGA 4PMUA 3FGCB 1WAUA 3REQB 1BHGA 5EMMA 5I3HA 1TPWA 4NYYA 2WSYA 3LNMA 1PCKA 1Z7AA 1OX4A 3MKCA 1W3IA 2PWEA 4W7VA 1XIBA 4NX5A 3QOMA 3TSMA 2Q71A 1VFTA 1I75A 1KGWA 2WSQA 2A3CA 1W1B1 4C7GA 3HPZA 4I6VA 3VKAA 3E0LA 4JNYA 3OG3A 3G5EA 4Y9NA 2JF6A 3HV8A 3QKEA 2VFIA 1OCJA 3GZ3A 4LVBA 2INFA 4ZB5A 1EC8A 2V68A 3HFYA 4HNUA 3BG9A 4NKCA 3CMJA 4UQEA 3THDA 4UTTA 2QKFA 3KUMA 5HUPA 3BLPX 4H9VA 4RKAA 2DVUA 1MXSA 1JCNA 1UZ4A 3AIWA 4Z1AA 1VPQA 3OVQA 4NI3A 1OYAA 3WL0A 4CQDA 4F0HA 1IXPA 3NSNA 2R9RA 3CHCA 2O56A 1E70M 1HJVA 4DEFA 3WBEA 1IT8A 2POZA 2X40A 1VIZA 1WKDA 2JKEA 4QAIA 1TELA 3QEZA 3T07A 4MIMA 3QPEA 1Q45A 4ZR8A 1GTHA 5A6LA 4KWSA 1OIMA 2VR2A 4FLSA 1WA3A 1M68A 5GJNA 1V3JA 1W8SA 5LNWA 4LAZA 4NZFA 5HWMA 2OEKA 4QNEA 2XU2A 5HK4A 2ABBA 1AH4A 3N2CA 1R0MA 4GY1A 3PULA 3VKJA 2C8NA 4HOXA 3CMFA 4LSBA 3ZQ9A 1OFDA 9XIMA 3EPMA 4F9JA 1JG9A 1ZPTA 4UTWA 4AXKA 2NX1A 5I09A 4JEQA 2L5HA 2IUZA 1R87A 4O1CA 2B7OA 4CQ8A 4WJEA 2IW0A 1IXQA 1LG2A 2HE5A 2BFGA 4AISA 5I07A 3MSDA 3ITVA 3MDWA 3ZSTA 5H8UA 3SECA 2ON3A 2CLPA 2VRJA 3WEZA 4GUHA 2CZVA 5CGTA 1CI1A 2FZNA 3ERPA 4MM1A 4V28A 4W89A 5AC4A 1MW0A 1V79A 3L4ZA 5I2UA 2GJXB 3UZ5A 3LN3A 2BY1A 1ZAIA 3M64A 3ECQA 1E72M 1GZGA 2ZX9A 3V16A 3TN3A 1JCJA 3TUUA 3AHXA 2DT1A 2TODA 4I8DA 1EEXA 1EQCA 1JR1A 1IR2A 2A3BA 2Y5JA 3URAA 4AMAA 4DO6A 3I4EA 1T96A 5DBTA 2QCGA 3W7NA 4V1YA 1TTPA 4UC5A 3F1QA 2EPHA 3DIPA 3NSMA 3WLRA 3VC6A 5TAOA 1UPPA 1ZZMA 3BMWA 4QIUA 2DW6A 1PIFA 3DU0A 3N15A 4AHPA 2IPGA 1P0KA 1CZ1A 1ESWA 2XSXA 2GOKA 5FEPA 3GW3A 3VDHA 3N2XA 4HMDA 4LS0A 2WVUA 2QF7A 2W92A 3EOEA 4D6DA 3SCVA 3CQ0A 3VOIA 3N73A 2J7BA 1IWAA 4L80A 3KOXA 3MV01 1HJSA 3TC7A 3D6NA 2AL2B 1OT1A 3VNYA 2V5CA 3FY1A 4QFUA 2WC3A 1UD5A 3GUGA 1E6RA 3PZIA 1GK8A 3JS3A 2WVVA 2YB4A 1E1CB 3HMCA 1TUXA 3L2MA 3S6OA 4E4FA 2XVGA 7REQA 3BLIA 4JTLA 3WMSA 4PBGA 3LCXA 3GTFA 2GDVA 1JZ7A 4O10A 2QCCA 2PD5A 4O11A 1YE6A 2FZMA 2KAUC 3K8LA 1YTEA 4GUIA 4JCLA 4DQWA 4ATLA 2Y89A 1QBAA 4UTLA 1JPMA 4JYFA 1W1A1 1F07A 3VXGA 2OGYA 2VEKA 2LLEA 1AJ0A 2V5KA 1KFCA 1CYGA 1FWRA 1T5AA 5BCAA 4LX4A 4J3SA 4WXYA 4P7RA 3OGVA 1XUUA 1IZKA 2VUNA 5CJ5A 3RCMA 4MDPA 5CZJA 1DWIM 1MQPA 1BG4A 4P8WA 4RDYA 1FBAA 2C0HA 3UYCA 4RE2A 3JZUA 4UQDA 1HJWA 2DZSA 2WV8A 1BLIA 5A8PA 1E4MM 3N3MA 2REQB 2ABAA 3UESA 2QGHA 1XH0A 4EIVA 2CETA 1FCVA 2XM1A 3CHFA 1JI1A 2YZRA 3H23A 1DJXA 3TKFA 4JHOA 4HHPA 4MWAD 3LCGA 2CLFA 5FD0A 3ABSA 4NAFA 3VM7A 1ISZA 4IMEA 3BK0A 4ROQA 2CERA 2Y63A 1TWIA 3ZYZA 2AAMA 1VLIA 3DERA 4QQUA 5D9MA 5JIPA 3VNMA 1ZENA 1ZJAA 3Q67A 3TWBA 3I3BA 1YKWA 3UG4A 1UB3A 2GVYA 4GO8A 3NL6A 3R12A 4Z42C 5AYZA 3II1A 5D8ZA 1RD6A 4H6RA 5HMEA 3QXBA 1GEHA 3PZGA 3CYJA 2EEXA 3TV8A 2Q02A 3T4WA 4I9JA 1EJ7L 2FLIA 3GH5A 1HUVA 4UB9A 2BHYA 4ADUA 3M0VA 3NSXA 4UBPC 4H8UA 2PURA 3WKZA 4UQ9A 1NQ6A 1O5RA 2QJNA 3EXRA 2GGHA 5K7JA 1KB3A 2HXTA 1QNOA 2ZDSA 4OBRA 3QZ6A 2BB0A 5BU6A 1HNYA 4ZTXA 5PTDA 2BMBA 3S8HA 3WLNA 2GQ9A 1V7AA 5EBUA 5LNRA 1YE4A 1GYMA 2ZRXA 4UFIA 3NOYA 4K38A 1VRXA 3UWEA 3O1NA 4ZB0A 1EP2A 1JUEA 3QR3A 4H9ZA 4A8LA 3O15A 5J5RA 2FB3A 3G77A 1KM4A 2F84A 3L5LA 3DKLA 4IF2A 4TTGA 4JTIA 1UH2A 4JTTA 1ME8A 5AHEA 4LF2A 3CO4A 4ZFCA 3QPYA 1HL2A 1O1ZA 1ITCA 3QPZA 1PO9A 1C9WA 2WHJA 5FL1A 1GEQA 2WZTA 2R1KA 3OGRA 1TTQA 1WZKA 3CC1A 2HISA 3UVIA 1I2QA 3H26A 3GDTA 1XYAA 2VOTA 4Z2KA 2EQDA 4U2YA 4DO4A 3KS5A 4C6LA 3DAQA 1S2CA 4YXGA 5ECVA 1B3ZA 2X42A 4AD2A 4IMGA 2WKLA 4G7EA 1J2BA 3IVSA 3G1FA 3QHNA 4DB7A 1DTUA 3DHDA 3WUEA 4CU8A 3UGRA 1OX4B 3WLLA 3NGFA 2AKZA 4CQ9A 1PCWA 2QHAA 4CN4A 2NXHA 4RPPA 4IFRA 3PANA 4RR4A 1XINA 2BHUA 2PB1A 4HPNA 4MOZA 3CQIA 4FOKA 5T26A 3CV2A 4Q4MA 1Q7QA 1BXBA 4JTGA 5K3VA 3EX2A 1C7TA 1G4TA 5DX7A 4Z0SA 2PCQA 4CD4A 4Q8UA 1PTDA 4WQ6A 4D6HA 1U1JA 3C5QA 3MUAA 3EWWA 5CSUA 3T42A 4IJCA 4S38A 2PDIA 1DJGA 1D7FA 4GACA 3UG5A 4NHVA 3W53A 1E40A 4HSOA 3MU7A 1TWZA 4MFDA 3NQBA 4E2VA 1ME9A 2DH3A 2BY0A 2QS8A 4NUWA 3HQOA 2E5CA 1JGIA 2YA2A 4L1XA 5HR6A 1DJHA 3GVRA 4O19A 1KXQA 1UIOA 2VX6A 2CC0A 3V7PA 2ZZ2A 4B5NA 3M1ZA 3P8JA 4LC6A 4BK9A 1HW6A 1US2A 1PZ3A 1VFSA 4KCUA 3VIOA 4BF9A 3IIZA 4CCCA 4R3UA 3P2VA 3SM0A 1V6VA 3LCIA 5JVLA 3Q58A 2FFIA 4QGCA 3V36A 3MP4A 2R1PA 4WY0B 3LMYA 3U2EA 4U5IA 3E2SA 4FXSA 5G4WA 2YDRA 3O7UA 1NF7A 4O53A 3SCNA 1TKKA 1SJBA 2ZE3A 1E6NA 4DF1A 2V2HA 3ZFHA 3GC4A 4BA0A 4RK8A 4JTRA 3W86A 3CWHA 3T09A 3CS2A 3WFLA 4TUFA 1HKKA 3WJZA 5T91A 4R88A 5E09A 3R0KA 3HPXA 4PMZA 3W7RA 4WVXA 4PA8A 3F4DA 1UP2A 3W74A 1EOKA 5AVNA 4Q8MA 2D3NA 4XTIA 4XISA 1RZMA 3JVAA 2JFEX 4EVZA 3B0YA 2Z4GA 1ISVA 4AVFA 2PWGA 2NX3A 3QY6A 4WGHA 4UTKA 1YXCA 4ZSTA 3SZ8A 1WKEA 4GKTA 1CGWA 4S2BA 2WVTA 3M5YA 2CBIA 3KDNA 2I56A 1W3LA 1L2QA 3REQA 1JL8A 7PTDA 5AOUA 1M65A 1XPYA 2OQLA 2RDUA 4W9TA 3IRDA 3MDUA 3NQVA 1SUXA 2VDHA 4HOZA 1K3UA 2CBJA 2VZSA 2NV1A 4XZ9A