4ERGA

Evidence for a dual role of an active site histidine in alpha-amino-beta-carboxymuconate-epsilon-semialdehyde decarboxylase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
332
structure length
332
Chain Sequence
KPRIDMHSHFFPRISEQEAAKFDANHAPWLQVSAKGDTGSIMMGKNNFRPVYQALWDPAFRIEEMDAQGVDVQVTCATPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKVLAQVPLQDLDLACKEASRAVAAGHLGIQIGNHLGDKDLDDATLEAFLTHCANEDIPILVHPWDMMGGQRMKKWMLPWLVAMPAETQLAILSLILSGAFERIPKSLKICFGYGGGSFAFLLGRVDNAWRHRDIVREDCPRPPSEYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLGEQKIGGLVLSSNLGESAKDKIISGNASKFFNINV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence for a Dual Role of an Active Site Histidine in alpha-Amino-beta-Carboxymuconate-epsilon-Semialdehyde Decarboxylase
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
total genus 117
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4ergA00
3URQA 1EF2A 4C6EA 3QY7A 4ERGA 5HMDA 1GKQA 1EZ2A 1FWGC 4C6NA 4GC3A 4HK6A 3SFWA 4IFKB 3UR5A 1M7JA 3AU6A 5G4HC 4XAZA 1M65A 1KRAC 4GK8A 1O5RA 4DI8A 2UZ9A 2WJFA 1O12A 1XGEA 4RZBA 5E5CA 3F2BA 2ICSA 3RN6A 3URNA 1XWYA 4LAMA 2R1LA 4C6IA 1POKA 3F4DA 4C5ZA 4GX8A 2WJDA 4KERA 4C5YA 3MPGA 4MUPA 3TN4A 1GKPA 1A5NC 3OVGA 1UIOA 1UIPA 2P53A 4CQBA 2P50A 3T81A 3OJGA 3ID7A 4XAYA 2QVNA 3LA4A 2E25A 3EGJA 2PLMA 4QROA 4PE8A 3JZEA 3PAOA 2VC5A 4C6CA 4E3TA 2PAJA 1J6OA 2PGFA 4H00A 3WZ0E 4LAOA 4TQTA 2FVMA 3N2CA 1YIXA 3TN6A 2Y1HA 3B0XA 4RDVA 2GOKA 1A5MC 3URBA 1RJQA 3IARA 3K4WA 4R88A 2AQVA 4GXWA 2ADAA 4IFRA 3ISIX 2EG6A 3LSCA 2DVXA 4B3ZA 3RCMA 2OGJA 2XIOA 4H9MA 3CAKA 3LU2A 2FTWA 4H9VA 1ITUA 1J6PA 3A3WA 4EPEC 3GIPA 3QY8A 4IQJA 1IE7C 1J79A 1QXLA 2Z28A 3LGDA 1R9ZA 1YNYA 4Z42C 3IPWA 4EPKA 4INFA 4C6OA 1HZYA 1A5LC 3HPAA 4CEXC 1EJTC 2D2JA 1KCXA 3BE7A 4ZSUA 2EG8A 4LAKA 4GY7A 4QS6A 2YB4A 4KESA 1J5SA 3GIQA 4F0SA 3B40A 3GUWA 4XD4A 4HJWA 4IF2A 4LANA 4DLFA 3GTXA 4H9UA 2AQOA 2DVTA 4KIRA 4GX9A 1ADDA 1FWIC 2BGNE 3LNPA 4NP7A 4EPDC 4NG3A 4CNUA 3MVIA 1EJSC 1RA0A 3A3XA 4M51A 2FTYA 3K5XA 3UPMA 3OODA 3GU1A 4J5NA 4GZ7A 2Z27A 3TNBA 3F4CA 4IG2A 4BY3A 5A6TC 1ITQA 4B91A 2OB3A 1PSCA 3NQBA 3PBMA 4RDZA 2HBXA 1PO9A 4ERAA 4D8LA 3FEQA 4OFCA 4AC7C 4C6LA 2YXOA 4L6DA 2R1NA 1RJRA 3MKVA 3UBPC 1A5OC 1K70A 4P5UA 2HQAA 1KRCC 1KRMA 3T1GA 1RK6A 3ITCA 2KAUC 4PCPA 4XD6A 2GSEA 3NURA 3QGAC 1XRFA 2EG7A 4QTGA 4IFOA 4KF1A 1YBQA 1FWEC 3F2CA 1M68A 2G3FA 3OQEA 3GRIA 4GBDA 1E9YB 4V1YA 1EJWC 4BJHA 1A4MA 3GTHA 4QSFA 4LCSA 2QS8A 5FSEC 3S2NA 1FWCC 3NEHA 4CQDA 1FWHC 3WMLA 4KQNA 4DZIA 3QGKC 2VR2A 1NDVA 3SO7A 2E1WA 5AKQA 4RDYA 1S3TC 2R1KA 1ZZMA 3V7PA 1NDWA 3DC8A 4CNTA 1RA5A 4CNSA 4HK7A 3AU2A 4G2DA 4IGMA 4LCRA 3GTIA 4XAGA 4LH8A 4L9XA 3EWCA 1FKXA 3ORWA 4DO7A 1A4LA 1P6BA 3LSBA 4YIWA 4C6DA 4QS5A 4DNMA 2DVUA 3T8LA 1ONWA 4PBFA 4J2MA 3RHGA 3E38A 3GTFA 2YB1A 4WGXA 4DI9A 3S2MA 1V7AA 4PCNA 4C6KA 2UBPC 2Q09A 3FDKA 2IMRA 1WXYA 3G77A 1FWAC 3EWDA 1P6CA 4C6JA 4KEUA 3MDWA 3MJMA 1YBQB 1V4YA 3HM7A 5FSDC 1P1MA 3MSRA 2RAGA 2YZ5A 4H01A 4GOAA 3IV8A 4RDWA 1EYWA 3S2JA 1K6WA 1KRBC 1ONXA 2ANUA 2R1MA 1FWBC 3UR2A 4CQCA 2GWNA 3PNZA 4BKNA 4NI8A 3S2LA 3DUGA 4F0RA 2VHLA 3MDUA 4V1XA 4C60A 2VC7A 5HMFA 1UMLA 2GWGA 2R1PA 4C65A 4XD5A 3E3HA 5CH9A 4XD3A 2OQLA 1EJUC 3MTWA 2F6KA 3GU9A 4R7WA 1WXZA 1PTAA 3D6NA 4H9ZA 3DCPA 4JOMA 3GG7A 4AQLA 4R85A 3E0FA 1V79A 4GYFA 3WYZA 3K2GA 4GY1A 2HPMA 2ZC1A 1YMYA 4EPBC 2FFIA 2Q01A 4H9XA 3E2VA 3TN3A 4ICMA 1V77A 3TN5A 1EJRC 3KM8A 4LEFA 2FVKA 1RJPA 2O4MA 3R0DA 2O4QA 1FWFC 2WJEA 4C6BA 1E9ZB 1V51A 1RK5A 3E74A 1A5KC 4C6QA 3CJPA 1RAKA 5LXXA 2Z2BA 2GZXA 3LY0A 3CS2A 1POJA 2PUZA 1NDYA 1NFGA 2Z4GA 3HTWA 4C6PA 2Z2AA 1EJVC 4G7EA 4KEVA 3S4TA 4LALA 2PGRA 2Z29A 4H9YA 2W9MA 1FWDC 3URAA 3C86A 1I0BA 3GU2A 1K1DA 3O7UA 3O0FA 3RYSA 2I9UA 4WVXA 1W1IE 4IH3A 4HA0A 4UB9A 1QW7A 3OU8A 2D2HA 3LS9A 1PB0A 4F0LA 4G7EB 4DLMA 1R9XA 4IFKA 2HPIA 4HK5A 4B92A 4XAFA 3QY6A 1JGMA 2VUNA 4CEUC 4J35A 1BF6A 3IRSA 4DZHA 1NDZA 2QPXA 2Z26A 4IGNA 2VM8A 2D2GA 5HMEA 3IJ6A 4H9TA 1I0DA 2QT3A 3PANA 4DIAA 3IACA 1R9YA 3AUOA 4B90A 3IGHX 1FKWA 1XRTA 4KETA 3UF9A 3LGGA 4GY0A 2A3LA 3E0LA 4I6KA 2Z24A 1UBPC 4LCQA 3B0YA 3ICJA 4C6FA 2HBVA 2HNHA 1DPMA 2OOFA 2Z00A 2Z7GA 3PNUA 4PBEA 4WHBA 2BB0A 2OODA 4DYKA 1FWJC 3FDGA 4KEZA 3MVTA 2WM1A 4LFYA 1YRRA 2Z25A 3OOQA 4I6VA 3A4JA 4ERIA 2CZVA 1EJXC 4EP8C 4C6MA 3F2DA 2AMXA 4RE0A 1VFLA 4QRNA 4ZSTA 4IG2B 2I5GA 4UBPC 1GKRA
chains in the Genus database with same CATH superfamily
4Z1BA 2WZMA 5DFAA 2WNNA 1JYNA 4C6EA 3QY7A 1VYPX 2Y89A 1ODZA 2WSQA 4FO4A 3W82A 1RQHA 1RXOB 1HJXA 1LRTA 2Y8KA 5AZ1A 3EOEA 2XINA 4GJ1A 2GVYA 2W6RA 2RDXA 3VKKA 1UR4A 1XLCA 3LZ3A 1DXIA 1A5SA 1BGAA 1W17A 1J0ZA 3IWPA 1SM9A 4CQBA 4P8XA 4MJ2A 3SSZA 1UJPA 4O4VA 3G22A 2CWXA 1I2RA 3PAOA 4DM2A 2R8WA 4Q8UA 3CAWA 3UA3A 1CT5A 1OFOA 4PUJA 4TQTA 1OG0A 4WUIA 3MUAA 1ISXA 2CLFA 4RDVA 1W3LA 3DBNA 4RPQA 4CD4A 1A49A 4GXWA 2O9PA 4YU1A 2VX5A 4NIRA 3LQGA 1I1WA 4DJFC 1PWMA 2V68A 1Z48A 2R6OA 2PTZA 4Q6JA 4MPKA 5EY5A 4JYFA 1RLCL 4BF5A 3VNDA 3KP0A 4LUSA 1OG6A 3CHEA 1JZ4A 2Z28A 4FXRA 1OFAA 1VFHA 4MOZA 2BOFX 3H4GA 2X16A 4HPJA 2BVYA 1FA2A 1VB9A 2DW7A 1F6KA 2VFIA 3BUVA 4QS6A 1J5SA 1QI2A 5BROA 3GUWA 3PN8A 5EMLA 4HZ6A 4DLFA 4O1EA 3VIJA 1BGGA 1E0WA 2YXXA 1UD4A 4CNUA 1AQHA 2CBUA 3AJXA 1BKHA 5HJLA 4D9PA 3ZWTA 3SUVA 1RY0A 3U9IA 5GNZA 1JZ6A 3FXGA 5A6TC 2QNEA 1E6RA 2G8ZA 3FHAA 2QJGA 4ZQOA 2DGAA 3CIWA 3NQBA 1YDOA 3C8FA 3DENA 1BXCA 2YXOA 2CITA 2E6YA 4QJ1A 2YGYA 3UBPC 1ENUA 4Z2KA 3GYCA 4TR9A 2BY2A 4F0KA 5BRQA 1EQPA 3L0NA 1ZTVA 4IPLA 2EG7A 1UD3A 3W2NA 3GC5A 3OBKA 5G1TA 5FJOA 3S1VA 2Y61A 1OF8A 4XBJA 5AYYA 3SDOA 4HU3A 2DUZA 4QE1A 4FALA 2OFJA 4X3ZA 4N02A 5FEXA 1PVNA 4RZ4A 1GONA 3QGKC 3W2MA 4B4HA 4CD6A 5SWUA 3T0DA 4WF7A 1S5VA 1UQYA 2RDUA 3IIOA 1RA5A 3WF3A 1JDEA 2OQYA 2ZIDA 5BWFA 2DZWA 3LHUA 5EBUA 3T40A 5AHLA 3W7JA 4MWAC 2I14A 3T8QA 1WBHA 2PTWA 4PUKA 4US5A 1V6VA 3Q67A 5CPLA 2YFNA 1T6MA 1FWNA 4DBUA 4YCOA 4WGXA 1IR2A 2DSZA 3GHSA 3V0SA 4F4RA 1XLGA 3M6YA 3P74A 3LB0A 3GR7A 1I9CB 2PC8A 3BV4A 4IIFA 4AISA 3EWDA 4HMDA 4KEUA 5DRCA 3WMBA 1GTEA 4H1ZA 3INPA 2EKCA 3CT2A 1KR1A 4Q4QA 5IOBA 1EYWA 4GYKA 1KV5A 4HT3A 2DT1A 3ITLA 3S2LA 1CNVA 1XSKA 2E6DA 5DX7A 2QUMA 2ZA2A 1UMLA 5I00A 1XX1A 4W88A 4GWEA 3CL7A 5BNKA 2VI0A 1T8XA 3IIZA 1PKLA 2GQ9A 1MVYA 3R25A 4XKYB 4I5RA 4JHZA 1K9DA 4AIOA 1R7OA 1AL8A 1XIJA 3CMGA 4EPBC 4DB7A 2F2HA 4QCFA 1I60A 2PP3A 3ZVHB 3N13A 3TN5A 2VWTA 2NVCA 3PUGA 5JVLA 2FVKA 5M03A 4PTVA 1TR9A 2VDHA 4DO4A 5JU6A 1JNDA 1I2OA 1ZL1A 5HJXA 3OTRA 5DMMA 4MM1A 1POJA 1B31A 1SFJA 4I3GA 3CK5A 2OMAA 4FF7A 4C91A 4AZCB 3SAZA 3MKKA 1GVOA 1KXVA 1C7TA 1XYAA 2GYIA 1E6NA 5LNSA 3IJ7A 3VMNA 4HIBA 3GW0A 1TPFA 2GSHA 1SR0A 1TV5A 4JS3A 4LUYA 4ZO8A 3T07A 3GZAA 1XBXA 4O13A 1QVBA 3MSGA 3ZT6A 4L6HA 2DZAA 3M0ZA 3B8UA 3WNPA 1MRQA 4LGXA 3EXSA 2AGKA 3LZ5A 1YADA 1BF6A 4UQCA 1GNXA 4A2SA 3QLDA 4J3WA 4G6CA 1XUZA 5C9WA 4O14A 4WXYA 1OADA 1EWDA 3AFBA 4GCXA 3MWCA 3PG8A 7XIMA 1AH0A 3SY8A 3IVSA 3E0LA 3APYA 1QBBA 3EOSA 3WNMA 4I6KA 4H8NA 3H70A 2W0UA 3R1ZA 1PYMA 4YPJA 5BXSA 2OOFA 2ACSA 1UUMA 4PBEA 2WKJA 2CKSA 2BFGA 3LM7A 1EC9A 4O1DA 2OWXA 3W27A 3H2EA 4E2OA 3KWSA 2ZCGA 3KTSA 3QZEA 1SSGA 3TYZA 5D37A 4PMDA 4OU1A 1IWBA 2DUXA 2NT0A 3BMXA 1KLYA 1WKYA 3UNTA 3RJXA 4WJ8A 1HKJA 3KHJA 4B5NA 2ZRUA 3SFWA 2OWCA 4NAEB 1XLLA 1NWRA 1IIHA 3QYSA 3NQEA 3MMUA 4LV4A 4HHHA 3VE7A 2YW4A 3VD7A 1LBMA 4BEUA 2VZUA 3VGGA 1LF1A 3LV5A 3F4DA 4GLEA 4E38A 3FGCB 3ZVHA 2J25A 1M7XA 3T81A 5I3HA 3P67A 4DXKA 2FZBA 2YYUA 4OIFA 2FDSA 3ENLA 4Y8FA 2QMKA 5FF4A 1VPQA 2IUZA 3VIHA 1D9EA 1F05A 1PDYA 2PDJA 1HX0A 3DG6A 3M47A 1CXHA 1B1YA 4R33A 3VD5A 1DJYA 3A4WA 3E2RA 4AY8A 1PWLA 1V3HA 2VZOA 1UASA 3WH9A 2IQTA 4GO8A 3N4AA 1P1XA 5EMUA 1W9PA 1PIGA 1H09A 3CASA 2C1GA 1ZU8A 2GJLA 3A3WA 4P2VA 3M5VA 1EQCA 2FJKA 1V7YA 3W53A 1CDGA 3AALA 3CH0A 3S47A 3MP5A 3WF0A 3W7MA 3BE7A 4XUYA 1MZHA 4LAKA 4GY7A 4YHGA 1KFBA 2X42A 3ARVA 3LYEA 2INEA 2I57A 5HQEA 3H24A 2Q02A 2E9LA 3CUHA 2AQOA 4ATLA 3AMKA 4LYRA 1BSIA 4KIRA 3V5OA 4AZGA 1ZLPA 2BGNE 1O5QA 3TEVA 2JIEA 4NP7A 3S5ZA 1K77A 4GBUA 2Y7EA 4IUOA 2V69A 2PWFA 2Y85A 3G1AA 1LT7A 1WOBA 3UXDA 4GZ7A 3GH4A 5A94A 4Z2JA 1Z7AA 2REQB 2TRSA 4LAUA 2J8TA 1Z3NA 4AC7C 1WZLA 3PJTA 3AHZA 3MKVA 4PSRA 1FWRA 3ZR6A 1TVNA 5T9BG 3IRDA 3PC0A 2KAUC 3NURA 4IFOA 4O0ZA 2VR4A 1FWEC 4UOJA 1FDYA 2C19A 3VOGA 1EB3A 5E6ZA 4WKHA 3P82A 3GM8A 3DHPA 1OFRA 5AC7A 4Q3MA 3FV9A 4E2VA 3DFTA 4DJEA 4CQDA 3EWBX 4ZL1A 2O7QA 1FP8A 3F5KA 1NJJA 1EF3A 3H4XA 2WMIA 3ES8A 1E43A 2YXGA 4DYJA 3LG3A 1VHNA 3QW4B 1UH3A 3Q4DA 4PUWA 4CNSA 2X1UA 1EX1A 4L64A 3LHVA 4LH8A 4UCFA 4GQBA 2P8BA 4K1WA 2JQXA 4NASA 4QS5A 1ZBWA 2ISSA 4DWSB 3IVTA 3R5EA 2ZX5A 1F61A 3ITXA 4DHGA 4RW3A 1MW1A 3TWBA 3AC0A 3SY1A 4UCGA 2QUTA 1YX1A 4E8CA 3W71A 3FDKA 4L65A 1V3JA 4ACZA 3NPVA 4RZ6A 1JPHA 2H90A 4PEKA 1XLEA 2WZHA 5FSDC 1KLZA 1XC6A 2C91A 3I10A 1IT7A 4Z0SA 3QKEA 2P0IA 4BQ5A 3EOLA 3VE9A 1DXEA 3MI3A 4FEZA 3TTOA 4GG9A 4ZQNA 3TSBA 3WJWA 4N2YA 2R1PA 4XD5A 4FNRA 3VDGA 1G01A 1H7WA 3THDA 3WH5A 2ISDA 3KVKA 3IGXA 3H2OA 3MTWA 2WJZA 2XM1A 4TX9A 2VC9A 2VCCA 1QT1A 9XIAA 2XVPA 2IS7A 4HN4A 4GY1A 1E71M 4UFJA 3PULA 3GXIA 3PWAA 4H9XA 3VD4A 1P5BA 3N34A 1GTHA 2YSWA 3WEMA 1Q6EA 4MB3A 3T2QA 6REQA 3WD1A 4Q7BA 3AIRA 1UWAA 1DL3A 2AAAA 4N6EA 4GFSA 5A69A 5LXXA 3U5UA 3N4EA 1LYXA 1XRVA 1JCLA 3PFRA 2QGYA 1K3UA 3WH8A 5REQA 1IV8A 1EO5A 1Q7MA 1NOWA 4J9JA 4FB7A 1KNWA 2OSYA 3VOJA 2OZ0A 1X39A 3NAVA 3RGTA 4AAJA 2RGLA 4WCJA 1A5CA 4MZ8A 3N15A 1O4UA 4LB4A 1ADSA 3N6QA 4W8AA 4FIQA 3QQWA 1BPLB 1XYMA 2FZMA 1XIHA 1JVNA 5CGQA 1OFQA 1VJZA 2FDMA 3P60A 4L1XA 4QQUA 1DJQA 4GIEA 3RX4A 4TVDA 2XN2A 4IPIA 4JX6A 1S5MA 2V5LA 3DZ1A 1CBGA 3I4EA 3IJIA 1A50A 2Z1KA 4CD5A 2JE8A 1MW3A 1XYBA 4EIVA 1KFLA 1WBJA 3IGHX 2Z1SA 2Q6ZA 4JKLA 2A3LA 2F7FA 1OFBA 4RLIA 3ZLHA 3PNUA 5H8PA 3SUTA 1P4CA 3RLVA 3L21A 5AC5A 4EK7A 3DESA 3WK0A 4RW5A 4JD4A 4HP5A 3NO5A 3LBMA 2ZX8A 5K7JA 3NL6A 3TJIA 1GVQA 5BMWA 3EKZA 2GPTA 1PL9A 4UFLA 3W29A 1KM1A 4PRRA 4ZB5A 1EX5A 4IFKB 3WD2A 1W9VA 2NQHA 4MLJA 3URNA 5L9FA 1XQLA 4E3VA 4M56A 4A8NA 1MI3A 2E1DA 1BQCA 1LROA 3EDJA 2YA1A 3FIGA 2P53A 4X2RA 1F3TA 5TAOA 3U7VA 3WQVA 3Q58A 1JZ2A 4C6CA 1W1ZA 3B9OA 3LEPA 3N2XA 4O19A 3IJDA 4LV9A 1UWTA 3WLIA 1Q6GA 2OZTA 1Q65A 3TONA 4JN8A 5EB8A 2I7GA 5A8PA 1U30A 1QOXA 2J77A 4JICA 4H9MA 3KTCA 4I9AA 2FPVA 2WC7A 2QCDA 4WQ6A 4AZCA 4LUTA 5LXEA 1GW1A 2AL2A 1IE7C 1VBGA 1C90A 1YE6A 3O63A 4M82A 3RNDA 4INFA 5AHFA 4PODA 2V3FA 2Q3RA 2Y5EA 1XGDA 1N2VA 1HGWA 4CCEA 4N9CA 5K4ZA 4DWSC 1PKYA 1JR1A 4CU6A 5E9XA 4Z2IA 2EXOA 3CHDA 5A6KA 2WVSA 4AIEA 1RVGA 5JH2A 4JCLA 2J13A 1QI0A 5A6JA 4FLOA 4AWTA 3H6OA 3BCDA 3NIYA 4GZEA 3WY1A 2QPUA 3RK8A 2E5BA 3C61A 1HT6A 4HU0A 3WQ6A 1PSCA 3EWUA 4J3VA 3W00A 1E0XA 1OB0A 2FMOA 4PYSA 1US3A 1XS2A 3W1XA 1A5OC 1VJSA 3MA8A 3HZ3A 3BOLA 3GH5A 4P5UA 1LQAA 2HMCA 5EGRA 3ARZA 4J3SA 3AYVA 3RAOA 1XM3A 4PCPA 2BVWA 2QF7A 1BG9A 2PDMA 2F61A 1A53A 1IGWA 3ERPA 2G3FA 1J0JA 1TYGA 1AW5A 1IXOA 3NVTA 3BAYA 1JI1A 1HJVA 3FYPA 5FEWA 1FX6A 3UVAA 3W28A 3E1F1 4HOZA 4LCSA 3PTDA 5FSEC 1MUWA 4Q32A 3NEHA 2EPMX 4KRUA 4MVAA 1A5UA 1W6TA 3PZTA 3DI0A 1S46A 3VIMA 4AVFA 3QRHA 4NQ1A 3PZGA 4M19A 4IMGA 1ML1A 1R47A 1B3XA 2VEIA 3DC8A 1A5AA 1HNYA 2YL5A 3IGUA 1DE5A 3H8AA 4MJMA 3U4FA 3VOIA 3E96A 3B8TA 3CZJA 4FNQA 4S3DA 1P6BA 3LSBA 3NNTA 4UOQA 1SZRA 1ESWA 4YL2A 2XH4A 3U2OA 5I09A 3FEMA 3NZPA 4J2MA 3EA1A 3K8LA 4EXBA 2RJGA 2GVGA 4LTSA 2FQIA 1ZGDA 5LIYX 4KWWA 2VFEA 1OCNA 4M8UA 5GNYA 4EF8A 1FWAC 2YCLA 3ZJ8A 3R0KA 4AD1A 4JBRA 2A79A 5C9RA 3WIJA 3F5LA 2YZ5A 1XIGA 1CWYA 1U5JA 2XIJA 1QNOA 4H2CA 3TAOA 1GYMA 4N9EA 3PNZA 2CLLA 3DUGA 4MFEA 4FZIA 4IPNB 4DUOA 3W75A 4QJ4B 4NXKA 3W22A 4FHAA 4AF0A 3ZJ6A 5GNXA 1W9XA 1XKYA 2BLEA 2V2HA 3KVJA 1SZNA 3IK4A 3W2LA 4ICNA 1HL8A 2XHYA 3MT1A 2EPKX 4JTAA 2VQTA 4PTXA 1FHLA 4ZFCA 4DJED 2WMKA 2HPMA 2WMJA 3MY9A 4QG6A 3WBAA 2XGBA 1XYCA 5CSSA 2P10A 2XIMA 1KD0A 1FFRA 4RNJA 4F3HA 2FFCA 2DT2A 4GIAA 2NLYA 5HJYA 2B81A 4NILA 2QXWA 3DXIA 4IMAA 2NSXA 3BJFA 1Y65A 1XIFA 1RAKA 3OBAA 4W7VA 4M3PA 3B0UX 3PS7A 3P14A 1IZCA 2QCLA 4M0XA 1H7OA 4LYQA 3GXDA 3UJEA 4JTRA 4REQB 1PUDA 3AZTA 3PWIA 1KWKA 4FR1A 3GU2A 2PB1A 3VKJA 1E9LA 1K9TA 5BOFA 5CPQA 3ZSTA 2ZC8A 4U3CA 4GYJA 4YN5A 1D7FA 3AXMA 4DF0A 3TW9A 1GVFA 4JIHA 3JVAA 4HK5A 4QG9A 1MO0A 7ENLA 4XKYA 3Q94A 2QAFA 3M5YA 4XSMA 2FJUB 1XINA 4Q8WA 4HGXA 4DAIA 4L7ZA 1W56A 3KVMA 3SCPA 4ADTA 2V38A 3OBEA 3BZJA 1WDPA 5HK4A 1B4KA 1RBLA 1KBBA 4PUNA 3PP7A 4M6UA 2NUXA 3VIKA 3DH7A 3AUOA 4O54A 2VVNA 4B90A 2QV5A 4ATWA 1K8YA 3IK2A 3UF9A 3AHVA 3NYZA 4FOUA 3KZPA 4GUFA 3V16A 1DVJA 3OZOA 1ZJBA 3SFKA 1SR9A 1KM2A 4IIEA 3WQEA 1HL2A 1E6PA 3H21A 1GZ1A 1FWJC 1S2VA 1ZJIA 1EEXA 3MVTA 4LAZA 1JI2A 2XZ7A 2BG5A 1UD8A 4GKTA 1J9YA 1YRRA 3A4JA 1CGXA 3W3OA 1I2NA 1UZ1A 1EJXC 1JFXA 1XCFA 3SCQA 2QAPA 4RE0A 3TC6A 1CENA 4F8XA 4QRNA 1JL8A 1IWAA 3NZ1A 3CQKA 1E56A 1EF2A 4UTHA 2IQ0A 4FMVA 3QR0A 5CJMA 1AQFA 3NO3A 1EZ2A 1Q6CA 1FWGC 4HK6A 3A4AA 5A3HA 1NY1A 1MEWA 1D8WA 4WDWA 3W74A 4MY9A 3VCNA 3QM3A 2DDXA 3W70A 2VWSA 4HMEA 3R8GA 3MPGA 1L8PA 1QHPA 4BHYA 3SIZA 4XQ6A 2V81A 4X0NA 1R2TA 3WQGA 3NTYA 3GNNA 3WLTA 1YDYA 2VC5A 1EGMA 2OCZA 3B8WA 3AIVA 2ALDA 1HVXA 1W5OA 3BPWA 1TRDA 3BAJA 2WMGA 3PTMA 2EG6A 2JGQA 1GVIA 1MYRA 4QCEA 5CZSA 4EWJA 3AS3A 4A2RA 3UWEA 3MCMA 3ARRA 3LRKA 4RKAA 4GUJA 1J79A 2HRWA 3WNNA 2I5QA 3GHTA 3IPWA 2UY3A 1V0MA 4S38A 4J4KA 3T42A 3RPTA 1CEOA 3SI9A 1X7IA 2VOTA 3UZWA 4H9UA 4E4FA 5XIAA 1R8LA 3L4YA 1IZKA 1FWIC 3GR8A 2XIIA 1W5MA 1VC4A 1W3JA 1ME8A 1ALDA 1QNVA 4GHRA 2ZE0A 3R7MA 1TPUA 1UOKA 3M0YA 1XLBA 1UP0A 3VGDA 1NEYA 1HP4A 3IAQA 3LX9A 1V8EA 4IMDA 3FJ6A 5AHIA 4FA3A 2HJPA 1T5AA 3QYQA 5FEZA 2FZ9A 2PC4A 1S2AA 3WQWA 1DIOA 3N2BA 3P7YA 1DWGM 3C0SA 4GI6A 1VJIA 2AOSA 4N4PA 2V8ZA 1GVSA 2Y0FA 3R0UA 2PI6A 2ZE3A 4AYGA 3VAVA 1ZENA 3CYJA 3OZMA 4FNSA 4B5XA 4IZGA 3EPNA 3QHNA 3PUEA 3PJUA 1JNEA 1HTIA 4JCMA 3LCHA 4YWIA 3GC2A 3WFLA 3TV8A 3OYXA 4KQNA 1GEQA 1UH2A 1E3XA 2VR2A 4BA0A 1Q7QA 4EX4A 4Q4RA 2VYOA 3BMVA 1PBGA 3NM1A 3KOWA 4LBUA 3DFPA 2FZ8A 2Y7FA 1H11A 5D33A 5AHMA 1OX4B 3RRAA 3N25A 1DKWA 2A3EA 2WCAA 3J7HA 2WO5A 3B8IA 3L2LA 1H0IA 3V75A 3GXMA 4JFVA 2JEQA 5BOEA 1IYXA 2YB1A 1OC7A 3R12A 3W1UA 1RR2A 4FIRA 2ZWYA 4K36A 1GOKA 1Y8BA 5TBOA 3UGVA 1WXYA 2WZIA 4PRTA 3KFTA 3TCEA 1OD0A 1P6CA 3MDWA 1YBQB 3DU0A 4MMWA 4R34A 3M07A 2VEPA 4H01A 3S5SA 3ARXA 3IV8A 4JTCA 1OT2A 3UR2A 3GVWA 2CFFA 2CHOA 2NQ9A 1CTNA 3MMTA 3WELA 4F0RA 4IISA 3EDEA 1AVAA 1R3VA 1DXFA 1LWJA 3PUOA 5K4XA 3W1NA 2V67A 4HTBA 3WLOA 1H1YA 1RD6A 1HXJA 2QCCA 1VFFA 2CHNA 2QJMA 1W0MA 4WDXA 1FHVA 3T4WA 4NYYA 1WAWA 3AMDA 4GYFA 1KTNA 3PF3A 1Y0EA 3I68A 3PBVA 4GI9A 1JPMA 1TJ1A 1UC5A 1X1OA 4P8WA 3BSHA 5I07A 2RUSA 4UFIA 3G6MA 3WK2A 1BYDA 1E6QM 1JFHA 4TV6A 4NU7A 3F7JA 3L9CA 1LOLA 4IM4A 4W4QA 1VEPA 5AZ0A 2GZXA 1H5YA 3GZ3A 4HJFA 3BW3A 3WFAA 1AJ2A 4QHRA 2Z4GA 1NOFA 4QLKA 4IJBA 2Z2AA 1HUVA 3S4TA 5DCDA 3UY7A 3K30A 3VIFA 3UJFA 3TNOA 3VIGA 4NNBA 5M1TA 3POCA 2RDWA 4PB5A 5HPCA 1QJWA 5A8MA 4WVXA 1QW7A 1CXIA 1H51A 3C52A 4GIYA 1VRDA 1XXXA 3MUCA 3U4AA 5JBEA 4GZIA 3R94A 1DTUA 2HPIA 2QYGA 1SO3A 3GXPA 5MKGA 3ABZA 5GVJA 4H6KA 5FJIA 4WD0A 4K6AA 1U1JA 1P0BA 1VENA 2AKZA 2XIQA 2J7HA 3OIHA 4IGNA 3I3BA 3BAXA 3TWAA 2BGQA 3L66A 1K4HA 1TMQA 2CZDA 1WCGA 5I79A 4JTFA 1DJXA 3UEQA 1O94A 4J2PA 1YDNA 5DY2A 4YS1A 3R2GA 3IJLA 3TZNA 5HDRA 1Q7ZA 1JPIA 3UXLA 1QPOA 1S2TA 1WZKA 3ABOA 3AAMA 3BLEA 2CWNA 4PN2A 3F4WA 3N73A 1KCZA 5E93A 1FFQA 3QMSA 3PB0A 1PZ2A 4NKCA 1OGSA 4OGZA 2HCVA 4ZSTA 5I3DA 5LYRA 3L0KA 3W0KA 4Q8MA 4I7UA 3VFCA 2GGIA 3RX3A 2EPNA 1CXKA 2PLJA 3SW6A 3HG4A 3TROA 1QW8A 2KZHA 2PLCA 1EWEA 2ZZ4A 2W63A 3L2MA 1Z44A 1W8GA 4AU0A 3BXWA 3LTSA 1HVQA 1G4EA 5AVHA 5FJPA 3CIVA 2PBGA 4F2UA 4C5ZA 3WD4A 4EWND 3G1XA 2I5IA 5E9AA 4HCDA 4D6GA 3F4VA 3P81A 3OVGA 1UIOA 2E0PA 3Q2DA 3LXBA 5FKYA 2XN1A 5GJNA 4ONVA 4AEFA 4PTNA 2X1TA 2X2GA 3IVUA 3FSUA 4IUGA 3G24A 1ZCCA 3EXRA 3TOYA 4Q22A 3XIMA 1RD5A 2G4JA 1I6NA 2J7BA 4US5D 5FEPA 1HKIA 3CTLA 3BGAA 4E8GA 3P8JA 1J18A 5CLTA 1IEVA 2AQVA 3ZT7A 1EGVA 1A3WA 3CYVA 1XIIA 4OV9A 2J9YA 3GBDA 3FXYA 2ASHA 1EL3A 3M9YA 4ALDA 3LU2A 1BSLA 4JTIA 3NQGA 1TQXA 3A21A 4AVOA 5KZMA 4UQEA 4XUGA 2VGIA 3RMEA 1TPDA 4DBWA 3HPAA 3KZSA 4O8AA 5D2TA 4M24A 2POZA 5XINA 4UMAA 3SCWA 2E9BA 3K46A 3VTRA 3P0WA 4LOCA 5I78A 1W5QA 1OIMA 4UIOA 4GX9A 1ICSA 1ADDA 4MB5A 4Q33A 2E5DA 1W1TA 3T0CA 3FJNA 1QR7A 1B2YA 2GDQA 2VZTA 3E0VA 4MAVA 1OSEA 3CZEA 2WNQA 3ATZA 1IEWA 3CV6A 4G9PA 4Y9PA 8A3HA 2VFHA 3CPUA 3EEGA 3UCQA 3JUGA 1PDZA 1I8JA 3T1GA 2INZA 1M3UA 3ITCA 1HJSA 1XLFA 2J9XA 3WUEA 3FLUA 4KF1A 1M68A 3WK1A 4Q4MA 4GBDA 4AHPA 4ZENA 1F3WA 3EX4A 4DF1A 2D73A 5HBFA 3WF4A 5D2WA 4F0HA 4YVXA 1TFVA 3WMLA 1BWLA 2D23A 4AIUA 3UP8A 3A12A 2BHUA 3A5VA 4F40A 1NDWA 2DW6A 1OX6A 3AU2A 3BZGA 3AWOA 4EAYA 3V1PA 3L4ZA 2EBNA 2WSKA 3W7IA 1B57A 1CGTA 3KE0A 4DUVA 5ECUA 4PBFA 4Z2GA 3FA3A 1GQIA 1J4EA 2A6LA 4Z2HA 4O12A 5LNUA 3VCRA 2A21A 2IPWA 3CQIA 3O05A 1S1PA 3C0QA 1SFTA 5IDIA 2VGFA 3WJYA 2FPYA 2DZXA 4WSHA 3DHUA 2NVDA 5JIPA 1L2QA 2PDWA 4F9JA 3LPOA 4Y9AA 3VNZA 3V18A 4S23A 4RDWA 1VBRA 2I16A 1TJPA 4Z08A 3S2JA 1XP3A 4W8LA 5DO8A 4BKNA 2YDRA 4FXJA 4U10A 3TW6A 3ARSA 2GL5A 4GNKB 1HO4A 5MHBA 3TYAA 4ZZ9A 5HNTA 2OT1A 3MJYA 4FAMA 1G6CA 1QPQA 3ONCA 1SZGA 5D38A 3GU9A 1BFNA 1OF6A 3W2UA 1WXZA 2XZ9A 1JQXA 1GUVA 3CO4A 4S3BA 4QG8A 1VFTA 3SEPA 1PE1A 1C3FA 4HCHA 4Y9MA 4XX6A 4LW7A 3T0AA 1YPFA 4P7RA 1TPVA 1V51A 4IIDA 3E74A 4JTKA 4XO6A 4I8DA 1TTIA 3M0MA 3B8DA 3FX4A 4LVAA 1XH0A 3E0IA 2WSPA 2A3HA 3VNMA 3QTPA 2PDBA 3RM8A 3CHFA 4PFMA 4XWUA 2VEFA 4DWSD 1K6AA 1RP9A 4OVXA 4HTYA 1C8XA 4O50A 3WUBA 4FXFA 1ZY9A 1W91A 4HNVA 2BNJA 5JBFA 3WL1A 3GDLA 3SB0A 1PB0A 4NAFB 1NOUA 3P3BA 1O5XA 3N9KA 5D32A 4G56A 3LHWA 1KGXA 3W25A 4M6PA 5EMMA 3GG1A 3HG2A 1VAHA 3ZWSA 2ZICA 3WBEA 1V02A 3MQTA 4AX7A 2ZUVA 2VRKA 1QW9A 1HP5A 3P84A 4V33A 1KFCA 1E1FA 5HMEA 2W62A 3NOEA 3IJ6A 1VBUA 3NR0A 4H9TA 5LNWA 1L9WA 4ZCWA 4ZB2A 3PBYA 1F5ZA 4ZEPA 4AZ7A 3EBVA 4KGJA 3G1FA 3NPUA 3PM6A 1SVDA 2D3LA 4WIWA 5ECVA 3S3GA 4Z1YA 2PWHA 4A3QA 1XIEA 4WOQA 2ISWA 3SGGA 3SN0A 4P7QA 1XYZA 4L4OA 4AD4A 4IX2A 1HIZA 3WQDA 4C6MA 2AKMA 2AMXA 4O0QA 3WQFA 3ZSSA 1VQTA 4A8IA 3O6DA 5LA0A 2FHBA 1LRQA 4DJFD 1UKPA 1GQNA 3WG6A 1S5NA 4JIRA 4XAZA 5CPTA 4HN8A 2WJFA 2I56A 3BURA 1M9HA 1R3RA 1ONEA 3N29A 2IPJA 3F2BA 3NZRA 3PHAA 3TE9A 2ACRA 1LZOA 1JUBA 2HNEA 2QW5A 1FY6A 1H61A 4FP1A 4QITA 1R85A 5FL1A 3MUIA 4ZOCA 5J8LA 4KT2A 1TPEA 4XAYA 2H3DA 1E0TA 1D3GA 5K9CA 1FHUA 2J4GA 1L6FA 4OBSA 4DM1A 5D9MA 1V3MA 1U1UA 3G1SA 3N2CA 2C71A 1YIXA 4QP0A 4E8DA 2VCAA 1TZ7A 1Y5VA 1OK6A 3KBMA 1TX0A 4B3ZA 3CPRA 4GPNA 4IQLA 2WMFA 3TYCA 1DWHM 1RY8A 1VR6A 3ITYA 2Z1WA 4H8HA 5AVNA 1J6PA 1LLWA 3C2YA 3DYPA 3IANA 1QXLA 2XSAA 1W2PA 3TVAA 4MTVA 4Y6GA 1Q8AA 3WD0A 3LCXA 3EPMA 1HZYA 4JN7A 2JKPA 2H9AA 4NT0A 4ZE4A 4XO7A 4F0SA 4QEEA 3G1HA 4UQDA 2UY4A 4E0CA 1AZ1A 4H3DA 4UXDA 1E72M 1XCXA 3BCFA 4H4IA 1L6GA 3DFYA 3Q45A 3VZZA 3EMCA 2GSJA 3GYEA 3DHDA 2BTMA 1ITQA 4S2CA 1ZSXA 1X6UA 3TXVA 5I23A 4IOTA 3C56A 5BOOA 4O10A 1TCMA 3OYZA 1UC4A 4B3KA 1P43A 3OZPA 4B5UA 5A6LA 1UG6A 4IMEA 2VFGA 1UBSA 2BHYA 2X1IA 4WOZA 2BMBA 4XD6A 3QGAC 1GGOA 1YQ2A 2CBVA 4O53A 3GWQA 5JQ9A 4JPGA 2PTDA 1YNQA 2BVTA 4GH3A 3PPGA 4UTLA 2WVVB 2DIEA 3KAOA 4MWAD 1AD1A 1IXNA 4QDWA 3SJ3A 3DIPA 4IQEA 1CI1A 4QGCA 3SSJA 4XVDA 4L1GA 2CC0A 4PTDA 3CV1A 5CJNA 1PX4A 4ECLA 2PBOA 3GDBA 2PCQA 2VD8A 2XFRA 4HK7A 5I03A 1E6ZA 5CZ0A 5U4NA 2D3NA 3GNPA 4HNUA 2PRLA 1GVRA 5C7HA 4WDTA 2TSYA 2VKZG 4ZB0A 2NUYA 5F1UA 4L4MA 4QBXA 3DG3A 4KRTA 2WVVA 4ROQA 4UTJA 2QCNA 2EPHA 3H2MA 2VRQA 2WZEA 4GO9A 2I1OA 3C3UA 2XFFA 4AD5A 2WAGA 1M7PA 3FOKA 1MSSA 3EB3A 2R1MA 4NRRA 3VGHA 2WLZA 1C8VA 2J7CA 2DSWA 2DSUA 5KTLA 1XBZA 4B9ZA 3T0BA 1CLKA 2IXVA 3FCPA 4FI4A 1CB2A 4MWAB 4OUEA 2PDYA 1FHDA 4HA4A 4C65A 4W5UA 4MNKA 3LERA 4LNYA 1FWSA 1XI3A 4XZHA 4LEQA 1RH9A 3D6NA 4JHOA 3GFZA 3PZOA 3CGTA 2L5HA 3WDJA 4PH6A 5EMJA 3UNDA 1CXFA 2FHCA 1VF8A 4S3CA 4ML9A 5ABGA 1G4TA 1ISVA 3NPXA 4H8UA 1KFEA 1XF0A 4QAWA 2A2IA 8CGTA 3CLMA 3K4AA 4Q8QA 1RJPA 5EU9A 4BQ3A 1XGZA 1SW7A 3DDMA 5F4WA 2YJQA 5C2GA 1PX8A 3NXFA 4UNIA 4PL2A 2Z2BA 4L61A 1HJUA 1QUMA 3S6OA 3ABQA 1NFGA 1PJ9A 1WXJA 1I75A 1LDCA 3TSDA 2Z1BA 1PAMA 4A4AA 3EDDA 5EL1A 4AXKA 5I24A 2B7QA 2CBJA 2BGSA 2BOGX 3N9RA 2DZUA 1ZCOA 5BZAA 1W1VA 4B5TA 5M5DA 3AMLA 4PB4A 2PWEA 3PZ9A 1QNPA 5HUPA 4HHMA 4F0LA 5DN1A 2ZVRA 1JIBA 2JBMA 4M5PA 5HANA 3WF2A 1T96A 5AN7A 1HW6A 1NWUA 2XVGA 4FNPA 2ZTKA 3HA1A 2QCEA 5A6MA 1P6WA 1S38A 1GJUA 1S1RA 1EP3A 4JTDA 1NF7A 3RPMA 2R91A 3EYPA 1XCWA 4GY0A 3DECA 4H6EA 3NQ8A 3PBWA 3O8AA 4TTGA 2V5BA 2Z7GA 1G4SA 2OR2A 4FOKA 2QGHA 5D2YA 2BB0A 2OODA 4H7CA 4FS9A 2O9OA 4NJHA 3GX9A 1KV8A 1E1CA 3MYOA 3AHYA 4ERIA 3GVQA 1KO0A 2VELA 1HN1A 5E09A 1W3TA 3W7NA 1QATA 3WQ8A 3B9NA 2VZSA 3UZ5A 3UR8A 4P8VA 4QX4A 3FVDA 1GEHA 1J2BA 2ATSA 4PRWA 1W3NA 3EWYA 1Z69A 2GGGA 1DIEA 6PTDA 5FJTA 2ICSA 3K13A 2PDXA 4D72A 2ZX6A 3GQYA 5GJMA 1X96A 5CAHA 3W1MA 5K9XA 4RUBA 4GNVA 3O07A 1GT8A 4NHVA 4QLJA 3LA4A 4PE8A 3CU2A 3L67A 3QV6A 1W32A 3WZ0E 1RHCA 3SQLA 5BXTA 4AD0A 3VKBA 3DFSA 4LT9A 2OT0A 3PG9A 4S3GA 3BANA 4DZAA 1GVYA 2EAWA 2YZRA 3W9ZA 3LPGA 2CZ5A 2GUYA 3W7RA 4BQ2A 3MCOA 1I2PA 4RXFA 3VKDA 1BVNP 1N8WA 3LQLA 4GI8A 2WLYA 1W54A 3BO9A 6A3HA 1I2QA 2YDAA 1KA9F 4H9VA 2A6NA 3BLKA 4NZ4A 3R79A 7ODCA 4IQJA 3ELFA 4Y8EA 3VMPA 3LGDA 2XFYA 2WV8A 4Z42C 4NJGA 3NFUA 1MDLA 1Q6RA 1KM5A 2OSWA 3W7OA 1OYCA 1DWJM 1EBGA 2QCFA 1KM0A 1LLZA 2EG8A 1FCUA 4N0RA 3FJ4A 4DBEA 3ARUA 3GLCA 3HPSA 1EOMA 4DWSA 1F9CA 4MYAA 1D3HA 3N3MA 4W89A 3MSYA 2VUYA 4MJ4A 4QJ5B 1SMDA 1LQ2A 1QK0A 3U7BA 3ABXA 4UR7A 3BG5A 4HYRA 4QNEA 5I7GA 3TNBA 1DBTA 4IG2A 4HCLA 2GLKA 1KBJA 3VM5A 3QFEA 1PO9A 3KRBA 3T2PA 4AEOA 5EPDA 4QE5A 3WDRA 9RUBA 1KFKA 1WUFA 1X8CA 1W1YA 3NSMA 1DP0A 3STGA 2PDKA 4ICCX 2DZSA 2MNRA 1B0IA 4G8TA 4QTGA 4U28A 1V03A 3I7RA 3H4WA 3FAXA 1JDDA 4E2BA 1Q45A 3TLLA 3O2LA 3M0IA 3TUUA 1SMAA 3BOFA 3GTHA 1S39A 4KWVA 4MADA 1OC6A 1DJGA 4CVWA 4X9SA 2D1ZA 3FN9A 3WKZA 4OT7A 3RF9A 3SO7A 3M44A 3NEVA 3T2OA 3L5AA 2WCGA 4JDBA 1MDRA 3POHA 1ZAJA 5CQ1A 3V7PA 3E12A 2OYKA 4CNTA 2CLHA 3TTYA 5DXYA 2ZZ3A 3SCNA 4Z2LA 4JKKA 1TWIA 2QZRA 2V3EA 5F4XA 4PCFA 3UG3A 3CQ0A 4BK9A 4FLSA 2PRHA 2XH0A 3TAKA 3AOFA 3NDZA 1FUYA 5CPNA 4ZO7A 4JNMA 3P93A 1D2KA 1ONRA 1P0KA 2YDQA 4ILSA 4I7VA 4GVIA 3WF1A 4F2BA 3EX3A 3OA3A 4XTDA 2V2DA 3H12A 1K6WA 2ANUA 4MY8A 2GWNA 4AZBA 2PODA 2J7FA 1XJBA 3THCA 2H8ZA 4UTWC 4ES4A 2GWGA 3RLHA 3E3HA 1R2RA 3RJYA 3N9SA 2ZRXA 3P6LA 3M0XA 2FB3A 3MANA 4BR1A 5LIXX 2P8CA 5I3JA 4P7LA 1WAUA 1V79A 4QE4A 3QGVA 2ZC1A 1YMYA 4JY9A 4N9BA 5E1QA 3DFQA 4H8VA 2BOEX 1O68A 1BVWA 1JCTA 1KWGA 3V36A 4O15A 3HMCA 2VVSA 3CO8A 3GDMA 4TX8A 4HA3A 1QAPA 5AC6A 2O4QA 1F3XA 3MUXA 3LY0A 2ODOA 5HATA 2X8RA 4I7WA 1VFUA 1TG7A 4H6RA 3HTWA 4AYSA 1UZ4A 4KEVA 2IPGA 4YYCA 1LBLA 4PR4A 3KTXA 1ZUAX 2W9MA 1PHQA 4DY1A 1V6UA 3S6TA 4WZHA 3O7UA 3O0FA 1AFSA 2XPKA 2CNCA 2UY2A 2IKHA 4UB9A 3T09A 1E15A 1TO3A 4DLMA 1XD0A 1MRAA 3QC3A 1V3IA 3D5HA 3QY6A 2XUCA 1XHGA 4KFPA 3UG4A 3KEHA 1R7AA 4CCZA 5FJRA 1R2SA 3BK0A 4MNJA 4RR4A 3G0SA 4BFAA 4ADSA 4AZ6A 4BI6A 3USBA 3NQFA 1M41A 4DIAA 1YLVA 1R9YA 8XIMA 4OQVA 4LC6A 1KQZA 1XIBA 2NQZA 2AL1A 2V82A 4KETA 3UWWA 2YPIA 1S2WA 1XH2A 4RV3A 1QHZA 3N3TA 3C6CA 2OXNA 4J3UA 3NDOA 3WX7A 1TJ2A 4QJ3B 1XYLA 1JXKA 3SQMA 4NYUA 2VT0A 1UWRA 1KCKA 3ONBA 3Q65A 1AMYA 2CZVA 2QIIA 5G2HA 1A3HA 2YKKA 4XV0A 4DJDC 1TJ0A 4K8EA 5ABFB 1R86A 2FKPA 4W5ZA 4M81A 3TJ4A 1SFSA 1M7JA 3XISA 5I3KA 3VDAA 1QFEA 2HDJA 4DI8A 1XW8A 3KHDA 5FACA 2ZUNA 1XGEA 1OYBA 1ZPTA 1AQ0A 4LAMA 4GABA 2VJXA 5FAGA 1CZ1A 1DWAM 2GVLA 3N12A 3WH7A 4L5ZA 5BXRA 2QJNA 4HPXA 1MW0A 1TELA 3CLWA 5D05A 4JQ1A 3IJ8A 1QO5A 5A1AA 3V0UA 2IKGA 4JTSA 2P0OA 4JX5A 4H41A 3TR9A 3WL0A 1J96A 4JQ3A 1X6NA 1OGBA 1XPGA 3DN5A 4LUJA 5T9CE 4TO8A 1J0YA 4UTFA 1EOKA 4XK2A 4AY7A 3WBYA 1BRLA 3W81A 2R24A 3CEUA 4GVGA 1VBHA 5LHFA 5CEWA 3ZMRA 4AMCA 3WLKX 3WNLA 2PDGA 5DCBA 3HN3A 1H1NA 2ABAA 3W7CA 1A47A 5H8UA 2AGTA 4ZSUA 4CNOA 3VGBA 4X0VA 3V4BA 4M29A 1Y5WA 1KW1A 4LANA 9CGTA 4XB3A 3U48A 4W93A 1MQQA 3BQ5A 4JNZA 3TLQA 3LNPA 5C55A 3SQSA 3HIJA 4HNCA 1OIFA 3OO2A 3WNOA 1UQZA 4NSBA 1TMLA 4BS0A 4IL0A 2FGBA 1RVKA 3T78A 4MNMA 3BMWA 2X1RA 2A1YA 1U1HA 4IGSA 3U8GA 3QVQA 4RDZA 2I17A 2YCKX 3RO8A 4DJDD 4D8LA 4JIQA 4TX6A 4C6LA 3A24A 3LLDA 1MW2A 1VFOA 1VYSX 1KRMA 1RV8A 3P2VA 3GUGA 2HVMA 4OE7A 2CEQA 1XRFA 1Q2RA 4RNFA 3O06A 2C14A 4G1NA 4RJEA 4AH7A 4CQAA 3MHUA 2PZNA 4DX3A 5DT5A 2RKXA 2OKTA 4MLRA 4ZODA 3II1A 1W1B1 4DNHA 4HYWA 3DAQA 4D2JA 4I8YA 4YMZA 1FWCC 2ZXQA 1YE4A 1JRBA 3PZIA 2OLSA 1TPB1 5CC3A 3IEBA 3AZRA 1V93A 4MYXA 3WQ4A 4XZBA 3PZUA 3BC9A 4HMNA 4IPPA 4OHQA 1ZBVA 4Q8PA 1A4LA 5CZKA 3C2RA 2NXHA 4CNNA 4CUCA 3CMFA 2G3JA 5GQBA 1JAKA 3F4NA 4J40A 1KGUA 1XSIA 2FH8A 4XG1A 5DBTA 3CHCA 1Q6QA 4C6KA 2Q09A 2V5DA 1UPPA 3LTPA 3BW4A 4LF2A 4U2YA 3U2CA 3C0LA 1P1MA 3KRUA 3TKFA 3AXHA 1KCLA 1QU4A 3VK5A 3M0HA 1K03A 4PGLA 2ACQA 1TWSA 1H7XA 2O7SA 2HVNA 1FH9A 3AS2A 1EC7A 2JEPA 4AZIA 3CHVA 1X1NA 2HZGA 3BTNA 2O92A 2CXEA 3TYEA 1XSJA 1B90A 4R85A 5DT7A 4MZ1A 5D4YA 3WYZA 1Q63A 4NUWA 3GAYA 4KIEA 3TTEA 4N9DA 3BLPX 3W1TA 1E73M 1TJRA 3E2VA 3H7RA 1XUUA 4EACA 5I2UA 4N7QA 4UZUA 1T99A 3YPIA 1A80A 4ZQPA 1TRIA 1IEXA 5H91A 2FZNA 1VIWA 3R8HA 3W87A 4KGLA 3MC5A 3RM4A 3QW3A 3HB9A 1E0VA 2XG9A 1WX0A 3EAUA 4KWSA 5IBXC 3PY2A 1NVMA 4C6PA 4G7EA 3ZXWA 3UZZA 3GNOA 2GJXB 3GC4A 1EUNA 1WUEA 3VC5A 1T0OA 4Y96A 5D8WA 3BAKA 5G5IA 3K4DA 4JQ2A 1ZNNA 4XTIA 2VD9A 5LNRA 1SJBA 4KBXA 2XN0A 4PA8A 4NRSA 1W1IE 2YX0A 3RUBL 1HO1A 1PEZA 3LCFA 1QK2A 1YXDA 1HF6A 1M53A 1G7UA 3QR3A 2EEXA 1UD5A 3L5MA 1NIUA 1JYXA 1GYLA 3V3WA 5F2LA 2JF6A 2NVAA 2NQ5A 4Z1CA 4MNLA 2TPSA 3OLEA 3FSTA 3UG8A 3TJLA 1KTBA 3CUJA 4UFKA 1E4MM 5AC8A 1JCJA 5G1YA 1WA3A 2ZOXA 1EBHA 3IUDA 2AQWA 2F9RA 3ALGA 5B7ZA 1HL9A 3A4XA 4PMOA 2EGZA 2YL6A 1LCOA 2G3MA 1UA3A 3EA3A 5EMYA 3EB2A 3DGBA 4C1NA 1F4HA 1Q85A 3LK6A 2ZA3A 1EHAA 5EKYA 3N2MA 1LM1A 2XGIA 2ZDSA 1XLJA 3S2CA 4OBRA 8XIAA 4OUIA 1JD7A 3KW3A 1QWGA 3BLDA 1R46A 3W6MA 5LSMA 1XLKA 3N2OA 1U22A 3NPWA 1GKQA 5LA1A 4PB3A 4GC3A 2J9ZA 3LGEA 3I7QA 4GGHA 4C7DA 3HBLA 2OJPA 3CTTA 5E5CA 1E3ZA 5A8GA 4RK8A 1OFEA 5FIPA 5JBDA 2VQUA 1H7PA 2WJDA 4CN1A 3W7PA 2DU2A 1NH6A 2BHZA 1RCOB 3G6LA 3I4KA 3NZGA 4PCSA 3TN4A 4CNPA 4ZGYA 5HQLA 4UFMA 2A7RA 1TPH1 3M46A 2HWGA 5AHNA 3ID7A 4LVBA 4UOZA 4TV5A 3UWUA 2VEKA 3R11A 4QSHA 4H00A 4NY2A 3VYLA 4L6OA 4NX5A 1HG3A 4UQBA 4AWUA 3MUY1 1C93A 4MB4A 1AK5A 2OVLA 3HPFA 4Q4OA 3NL3A 1HKKA 3K4WA 4P7NA 5CKSA 2ADAA 1JUKA 3ISIX 4Q8TA 1L6SA 3IAPA 3HQ1A 2DQXA 3VNIA 2P3EA 3JU2A 1TTPA 3WQOA 2ZXBA 3QY8A 3BARA 4UFHA 2V30A 1WKDA 2BXZA 4Q8OA 2XGZA 4C1LA 1YHTA 4CEXC 1YW1A 4W9TA 1ZFJA 4Y7EA 2GOUA 1Q3NA 1PX3A 4WY0A 3WNKA 1W9DM 2ZTJA 3FY1A 3WLMA 2DVTA 2Y63A 2OELA 1TIWA 5LIKX 3GS6A 2XTKA 4HVXA 1EA9C 3ZIZA 1PV8A 4QAIA 2P3ZA 2Y5SA 3AJ7A 1WYIA 4JNYA 5IRPA 2ISFA 4DWDA 3RXZA 1ZS2A 2CLKA 2Z27A 4U2ZA 4MDPA 3SRKA 3G5EA 1KFWA 3W7KA 1VFSA 4CVUA 2JKAA 5AYXA 3ARYA 2BY3A 4BZYA 1YEYA 3AXXA 3S5YA 1FXQA 2NX9A 1HKWA 3PSWA 4WY0B 3SY5A 2PU0A 2W92A 5U7SA 1EH9A 1EDQA 4URIA 2OOGA 3LD5A 5LIUX 3OVRA 1NP0A 4XZMX 2VEGA 2J47A 2H6RA 2QHAA 1R3TA 3WO8A 3ITOA 1TQJA 2W61A 3M16A 1R3QA 3NQAA 4PMZA 4KCWA 1IHIA 4JTUA 3SGUA 1W3IA 4O1BA 2QJJA 4TUFA 4BJHA 3W26A 3UJ2A 3N17A 4X63A 1BXBA 4QSFA 3NQ2A 1F76A 3RR1A 4KFOA 1CCWB 1UCWA 2GJNA 2NZLA 5IM51 3G1DA 4JHMA 2GDVA 3NYDA 2E6FA 1GQJA 5KZDA 4V2XA 2X7VA 4JAWA 1UHVA 3M64A 4F0MA 3W6LA 4IXXA 1ZZMA 1ZAHA 4PC8A 2ZXAA 3IUHA 4RE2A 3UXAA 3V35A 3MKCA 2RH9A 1V6YA 1JZ5A 5DMYA 1ONWA 4N4QA 5HINA 3E38A 4WJEA 1AMKA 2J7GA 2UBPC 4CQ9A 2IMRA 4MGGA 3P61A 2X0SA 1MMFA 4X61A 5H2ZA 3KS6A 1OYAA 3TSMA 1B3OA 3VOHA 2PURA 2RAGA 5DQPA 3MP3A 4O1AA 5BCAA 4JTQA 1VLIA 1N7KA 3RPDA 2JK2A 3S1UA 5FF0A 3QZAA 3EA2A 3W23A 2QMJA 3MDUA 3UGRA 2VC7A 4X60A 3E5BA 3ZYZA 3KBWA 4FXSA 1W1A1 5KMYA 2OQLA 1EJUC 5AHEA 4YHEA 5EBAA 4UTIA 3B04A 1GOXA 2ZZ7A 4JFSA 1TKKA 3LM3A 3E0FA 4A3UA 1UUOA 1Z8AA 2QDHA 5ABTA 3BLOA 2OTDA 3WD3A 3M7WA 3VDHA 3VGEA 4HSNA 4AIBA 4QIUA 2A3AA 2PE4A 6REQB 4A22A 5HXMA 2GVEA 1XYFA 4GE8A 1FWFC 1E9ZB 5A6BD 3REQB 2GQ3A 3VKAA 4C6QA 2VX7A 1DV7A 3CB8A 4HSOA 2J24A 1E6SM 4OJYA 2W79A 3G3DA 4NZ5A 2PGRA 2ZX7A 4O17A 4D8ZA 2QPSA 4W7UA 3UCCA 4A29A 5K3VA 2W4XA 3P8IA 2E09A 4XZWA 5HNNA 3B8VA 1AUSL 2JGYA 4NXSA 2CYGA 2VURA 4BI5A 3KS5A 1NTHA 1E5JA 4G7EB 4NAEA 3SZ8A 3BWWA 3SN1A 4LUTB 3STEA 2VUNA 3VU2A 1D8CA 4MF4A 1QRQA 1WDRA 4DZHA 3KUMA 1W1PA 2B31A 4WSJA 4S3JA 1JAEA 5HQMA 4R27A 2VNCA 1ME9A 3PANA 1B3YA 3BLLA 2HV5A 1K7EA 3ABSA 3VI2A 2QR6A 4NZFA 2WNZA 5J04A 3LGGA 3EB4A 3PPFA 4LCQA 3IS4A 2HBVA 5ABFA 4WHBA 1OBAA 4E5TA 2Y88A 3AYRA 1FP9A 3EWXA 4AMAA 3UJSA 1LLOA 3VILA 1EUAA 3QJAA 1LQ0A 4FLRA 4XIMA 4KCVA 4JQAA 1LT8A 2DJLA 1ME7A 4JTLA 3W2KA 4GVHA 7REQB 1CX9A 2BZNA 2WCSA 2ABBA 1UWSA 4BCEA 2YA2A 4Z0JA 3URQA 4YXGA 2ZWZA 1OFPA 2Z1XA 1LRNA 1JCYA 3ANVA 3NQMA 1VCGA 1UKOA 1F6YA 1YTEA 3MMWA 4UQAA 4D71A 3DFNA 4KCUA 1O1HA 2EPOA 4K2SA 1LL6A 5FD0A 3TC7A 5C8BB 1BAGA 1UIPA 4MB1A 1DHKA 3EWWA 2W66A 3NQ6A 1VIZA 1OEPA 2PLMA 2WWCA 3DYOA 2BVDA 1LTDA 1TVPA 3UXKA 3EDKA 2J8FA 2TAAA 2Y1HA 4NJKA 3QFWA 1KB3A 3QXBA 1A5MC 1OCQA 5EA9A 2BWGA 4EKJA 1XLHA 2WQDA 1OCJA 5C2XA 3TXZA 1JYVA 4XKMA 4GACA 1F73A 3ZLFA 2NSOA 2QCMA 1IEIA 3KCJA 4HHPA 3QPZA 4H7ZA 3A22A 2EPLX 1KBIA 1R9ZA 1VZWA 1TUFA 1OT1A 3AHXA 1LL7A 4EPKA 4JZ5A 2VFFA 1BRLB 1EJTC 2HS8A 5FF3A 1XRSA 5A2BA 1S5WA 3WLPA 4TVUA 3HO8A 4DEFA 4NZJA 3NG3A 3VDCA 3GDRA 2Y6ZA 1SSDA 3AMGA 1E5NA 4UMBA 1RUSA 1W9BM 4HQVA 1QO2A 4HZMA 4ZE5A 4Q6XA 1KTCA 3VDBA 2VL4A 2PRMA 4J5NA 2IKIA 3AYTA 2HTMA 3AYSA 4XVEA 2FYMA 5F4SA 1IT8A 3UERA 2O0TA 2F84A 1ZBKA 1UZDA 2NXIA 3OGSA 4K7YA 2NQJA 5CPMA 3T0TA 5CBBA 2ZRYA 4PEEA 3B05A 2HISA 4KFNA 4JTGA 3SRDA 3OHMB 1R3SA 2QF8A 2J74A 3OQEA 4U3AA 1E9YB 1Q6LA 4D6CA 3GIYA 3NA8A 3BAWA 1QPKA 2QS8A 4JIPA 5TD4A 1E9IA 2DZPA 1Q6FA 3HFTA 3ME3A 4YVVA 3W6YA 2A4AA 1UW9A 3AXKA 5AKQA 4RDYA 3WLSA 1S3TC 2A85A 2A0NA 4B15A 3I3EA 1GOQA 3USZA 3CH9A 3RDKA 4JQ4A 3H55A 5A95A 2Z2UA 4IGMA 3RR4A 2ZKMX 3ECQA 3SADA 5I5RA 4DBSA 4K39A 1ZP3A 1K02A 3VOCA 4GJIA 3TP4A 4Y90A 4BWLC 2CZEA 3DKLA 2E9MA 4JXCA 3M0KA 2C15A 3HF3A 1M7OA 3L4UA 4LVFA 1UYQA 5L6UA 1V7AA 3LHTA 4NVTA 5G4WA 4YCPA 2PDPA 2E28A 2QDGA 3RMJA 5K2ZA 2C0HA 2O55A 3U5YA 2BV9A 2PSNA 2DT0A 3MJMA 2CETA 4JTJA 2HE5A 4I9TA 5LGXA 2VZVA 4MPQA 1H4PA 1H62A 4D8AA 1DIKA 1TE1A 5T26A 1TTJA 4YVPA 1MXSA 3H2AA 3KBNA 4JR5A 3MHGA 4UNKA 2VHLA 2ZADA 3ALFA 4GUGA 5PTDA 1NELA 4B4FA 1IQ8A 5A6BA 2PGWA 1DQXA 2YYTA 4Y2WA 3OLIA 2ZX9A 3ITVA 3AXIA 3M5XA 2V3GA 1MQPA 3O9NA 3O6CA 3MWAA 3S46A 1YTDA 3SCUA 1W37A 3TN3A 2YOCA 4FLQA 3TCSA 4LEFA 3IUIA 4ZXLA 4I5XA 3BLIA 4O1FA 2O4MA 4GCAA 5A8QA 4L9YA 1LG1A 1Q66A 1AW2A 4WSKA 6XIAA 2C6QA 2PF0A 1XKJA 4C90A 1Q4NX 3UPBA 2B0MA 4N42A 4WGHA 4PTMA 5F2MA 4LALA 5AY7A 3SCRA 5T91A 1NP2A 1XC4A 4AZ5A 4DAFA 3P0XA 1CXLA 2VDGA 1UA7A 5KZEA 1I0BA 3FHQA 4JEJA 3OGRA 4BEQA 4HA0A 4GQQA 4MY1A 2VGBA 5JXQA 1C92A 1LL4A 2TODA 4N6FA 4P7OA 2XWDA 2PWDA 2CERA 3QV7A 4CD8A 1BVZA 2J27A 3UWQA 3VPLA 3RU8X 3B9EA 3U3HA 1UR2A 3NXLA 1J0IA 4PMUA 1WDWA 1RCQA 2GUBA 3WDQA 3UD6A 4IT1A 1FQ0A 1X38A 3IRSA 1NDZA 3ATYA 1ZJHA 1B5TA 1I1XA 1T8QA 2WM0A 2RFGA 5GPRA 2QT3A 3THUA 1TA3A 3MYPA 5FAJA 3UWYA 5LHEA 3EX1A 1VCFA 1VEMA 1BD0A 1XFBA 2HE8A 5AOUA 4AX6A 4M1BA 3WUFA 2Q8ZA 2QJHA 2V9DA 3THQA 1HGYA 3UETA 1WDDA 5BRBA 5I3FA 4HNLA 2Z0IA 1U5HA 3FDGA 1PTGA 3RRXA 2HXTA 3FA4A 4BQ4A 3KDOA 1XG3A 2INFA 3QMTA 4I6VA 1QASA 1ELSA 1E1CB 1XBVA 2Q71A 3B8SA 3R43A 2Z7KA 1G7VA 2VGGA 2WW5A 3SGZA 1W3KA 3QZ6A 3BDKA 4LRTA 3H26A 1Q6DA 3CC1A 1GJWA 5D04C 1B30A 1KRAC 3FFSA 1DJWA 2UZ9A 4ACYA 2G96A 2BODX 4ZO9A 1L8NA 1EDGA 3W7EA 1POKA 4GX8A 3ZT5A 1PZ3A 3MB9A 5H6HA 2WHMA 5CG0A 2VMFA 4REQA 3W83A 2WMHA 1EHNA 3KXQA 1PS9A 2PPGA 1BQGA 4QROA 5M2FX 1EIXA 2PEVA 4JY8A 2BY0A 3PZMA 1J6OA 1QNSA 4GNJA 4H19A 4UUIA 1B3WA 3TN6A 2NV2A 4J7RA 1P0DA 1F74A 3REQA 3LXCA 5JMUA 1JUEA 4PMXA 3UT0A 4KCTA 2GOKA 3N04A 4JTTA 5K9DA 1TPWA 4IFRA 2CESA 5E0CA 1K7FA 2G95A 2RGMA 3LSCA 2DVXA 3PTKA 3WQ5A 4XBSA 3CPGA 2YLAA 3MI2A 3AIBA 1C8QA 2E6AA 1IXPA 3KL5A 1JEZA 2FTWA 4GXMA 1ITUA 2ZA1A 4KRZA 3B4YA 4EPEC 2IW0A 4JTHA 2CLOA 1JG9A 1K9FA 1Q4WA 1NAL1 2Y7DA 3OVPA 4C6OA 1NQKA 1XDMA 3KRSA 3FJLA 3HFYA 1DQWA 1O95A 2YB4A 4IL2A 3C2OA 4KESA 1WDSA 3G1YA 3F1QA 4I9JA 4UTTA 1J0KA 5HMSA 1W5PA 3ARPA 1OZQA 3NL5A 3RO6A 3LTYA 2WPGA 3E6EA 1PHWA 4K38A 5CSUA 4YTQA 1ZBCA 3E49A 2B7OA 3DBPA 4EPDC 4NG3A 3K1DA 1TTQA 2FTYA 2TMDA 3SR7A 4R9OA 4A05A 2ZYFA 2WBGA 4BY3A 4TVCA 2RDTA 3ZM8A 1Z89A 5BU6A 2HBXA 3W72A 2QDEA 1ICQA 3OVQA 4NNCA 1GQLA 3A9IA 1DE6A 3IGSA 2Q3OA 1GZJA 1VGAA 1RJRA 3LI1A 4FX8A 7CGTA 2X30A 3BH4A 5M17A 1H1ZA 3B4UA 2DSKA 1UP2A 4IJCA 1WOAA 4GISA 2OYMA 1SJAA 2ZZ2A 5J5RA 5D09A 3WUGA 2GSEA 3LCLA 5DANA 5FJJA 1Q6OA 1YBQA 3NDYA 1CGWA 4PUUA 4NX0A 3GRIA 3LCGA 4WJXA 2QIWA 3E02A 3HJEA 2ZZ6A 2F2KA 3W1PA 4AY1A 5FJUA 4IIHA 1UR8A 4J3ZA 3ZJKA 2OWWA 4GI4A 1EDTA 3UPWA 1DHPA 3OIXA 2R1KA 2GK1A 3T05A 3T7VA 3HQOA 3GXFA 3CQJA 1ADOA 3S1XA 4RZ5A 4L9XA 3CM4A 4K1GA 2QKFA 3KCLA 4JYEA 3UWVA 1WPCA 4DNMA 3QKZA 2C7FA 2YFOA 1S2UA 3GHRA 2CCRA 2P76A 4MG4A 4DI9A 1WDQA 3IIPA 3MP4A 1EEPA 2Y24A 5D03A 3M5ZA 3OLGA 4KPLA 1FXPA 3G77A 2JIWA 4H7VA 5D2XA 4HU8A 4OBTA 5M3WA 5REQB 4E6MA 5CBIA 4W8BA 4LS0A 2VDIA 3HM7A 2J7DA 4WKFA 1UPMB 2Y2WA 1R38A 3HV8A 4L9ZA 4PUEA 3G18A 3DHFA 3CV7A 5ENLA 3W85A 2XSBA 1G9HA 4UTWA 4X22A 2CU0A 3BG3A 4HPHA 1V3KA 4XZIA 4XZLX 4LC8A 3MZNA 2J6XA 1UKQA 4S3FA 3DEQA 1B54A 1H50A 4XD3A 1CLXA 1UJQA 2D24A 1AW1A 2F6KA 4R7WA 1GG0A 2XJ7A 6TIMA 4HHLA 3TR2A 1UR9A 3MV11 2CKRA 2R14A 3IJ9A 3GG7A 1MXGA 2NLIA 3ZR4A 2R94A 4DRSA 1JDAA 3VO0A 4LB3A 1RPXA 2C13A 3W24A 3C3NA 5C5YA 3SCOA 1AQMA 3TH6A 3UFYA 3QQ0A 1SU5A 3A9BA 5HULA 1GPFA 4P8UA 4D6HA 5DEZA 4FX6M 1X7FA 3R58A 2VEMA 1VFMA 1A5KC 1KKRA 5A2AA 2FMNA 3KL3A 4IXHA 1FWWA 1UR3M 3CS2A 5I06A 1OZMA 2PUZA 3AZSA 2VX4A 5D2VA 1TUXA 4L56A 3C2VA 3C5QA 4AHOA 3WFZA 2XIBA 2WK2A 4MHBA 4HOXA 4QDPA 2KX9A 4NZ1A 2PFHA 3ZJ7A 4TMBA 5I77A 3TQVA 1XISA 1M01A 4K8HA 4IX0A 4IFKA 1CGYA 1TWZA 4B92A 4XAFA 2FZDA 4OWGA 1S3HA 5HNRA 2GK1B 2PU1A 4WRHA 1KM4A 1EZWA 3TX9A 1F8MA 1TV2A 5HR6A 4ZMGA 4AFYA 2QPXA 3KOFA 3B3DA 2PS2A 2QDDA 4ZFMA 3GG8A 3S9YA 1BWVA 1W8SA 3IACA 3N4FA 3U0HA 1OINA 3GTNA 1CIUA 2ZRZA 4GKLA 1D7KA 3N18A 4JN6A 2QLYA 3ARWA 4HMCA 4ZBCA 2Z24A 2G37A 2W91A 2PWGA 4PMRA 2DORA 4LWWA 3JRKA 3MHFA 2C79A 1FH7A 1NSJA 3VKCA 4ZOEA 2WM1A 3H2NA 4LFYA 3W02A 1V02E 1K8ZA 4MWAA 3K1GA 1OFDA 4TMCA 1SGJA 1H0GA 3MBFA 3S6DA 1NQ6A 1BG4A 2MUCA 1F3EA 1AL7A 2PDIA 1PCWA 3S1GA 3VD3A 5E0KA 5AYBA 1V3LA 3W1QA 2GQAA 4KKXA 2YBTA 5CBJA 2XH2A 3PR2A 4C6NA 4DO6A 2O56A 2POTA 2ZXDA 5I02A 1XIMA 1M65A 1GZGA 2WBKA 4B2DD 4V28A 2XH7A 4QM1A 1G94A 3LCIA 3KOXA 4MWAE 1Q5MA 5EFFA 4POCA 1J0HA 1REQB 3ANYA 4RX0A 3UXIA 2E25A 1YXCA 2WZTA 3JZEA 4ZA0A 1H41A 4A8RA 1GW9A 2PAJA 1GG1A 3GG0A 2ESCA 2J6VA 4O4WA 5KZ6A 2FVMA 5LKYA 3BSMA 4OV4A 3UY8A 4JIEA 1N55A 3URBA 1RJQA 3EMQA 3TIMA 3KOZA 1A0CA 2F6UA 4CU7A 1J5TA 2IKJA 1O66A 1XLIA 4E4UA 3AI0A 1OX5A 3W07A 3M43A 1SPQA 2XIOA 4R7JA 2FIQA 2LLEA 5HWMA 5C54A 1F2JA 1BEUA 3STCA 1W3HA 5JIWA 3PVFA 3S9IA 2BX7A 4MZYA 1RBAA 3F03K 3S0CA 4O1CA 4PUMA 1AH3A 1JJKA 4M6QA 4GGBA 2DV0A 3OGVA 5IHRA 1J10A 3TMQA 5EFDA 3LCWA 1RLDA 1XLAA 3OB8A 1EJSC 1RA0A 3A3XA 2IPFA 4A8LA 4H6QA 4LUSB 3FVMA 5CC5A 5HWJA 3WBXA 3LN3A 4OZOA 4ASTA 4DVOA 3F4CA 4XZ9A 2PMQA 4ENLA 2D0HA 3AIWA 3BGJA 4MKNA 4WK9A 3EKGA 1LWIA 3WN6A 4L6DA 4CKQA 4O28A 4B2DA 2X1SA 4UR8A 5C7VA 2OGYA 2A7NA 2HQAA 1KRCC 1RZMA 1TCDA 1YDVA 1WO2A 1OJXA 1IWPA 1H3GA 1VH7A 3F2CA 1NU5A 4F79A 1EFZA 4LXFA 5IHSA 4V1YA 4MDOA 1EJWC 1A0EA 1PPIA 4D6DA 3E9AA 2WSYA 3CZLA 5KEZA 2J88A 4UNLA 3QQ1A 4A21A 3B9AA 3P80A 2E1WA 3H22A 4NF7A 1P0NA 1GVEA 4DPQA 1F6PA 3JR2A 4J1OA 3L65A 4Q4KA 4M1RA 3P62A 8TIMA 4I5UA 3M6DA 5LA2A 3CL8A 3EWCA 3VNYA 3FW6A 1WNOA 1XL9A 1BLIA 1RP8A 2DVUA 2F8QA 2PA6A 4F66A 1DJHA 3N1AA 3RHGA 1JF6A 2QQ6A 3GTFA 4IMCA 3WENA 3L5LA 3LRLA 3HJZA 4GA8A 4AVNA 1UD2A 2G5WA 4B16A 1VYRA 5KETA 1OQFA 3G2GA 2V3DA 4UTTC 3L0GA 1V4YA 3E2SA 3VINA 1SZEA 5EMKA 1AH4A 3GKFA 1Y7VA 1MXDA 3WMCA 3CZ8A 4O57A 1KRBC 5XIMA 1W2VA 3MW7A 1V0LA 3QPEA 3GDTA 3QOKA 4ZQMA 3UYIA 2DEPA 3STPA 2REQA 2ONEA 5CH9A 3EMZA 1V0KA 3WEOA 3VVGA 1DJIA 1QOQA 4FK9A 2DPEA 1E55A 5TQLA 1PTAA 3EDFA 1ZHAA 1M04A 3CZGA 4ZXOA 1AODA 5E70A 3K2GA 2BXYA 1ITCA 2NV9A 5FF2A 2WHKA 1FOBA 3EX2A 2DIJA 2WVTA 4OECA 4ICMA 3W2JA 2QCHA 1V77A 3GSMA 4PMYA 1GOIA 1SJCA 4IGHA 3D0CA 2Y5JA 3D46A 4Q7IA 4C6BA 4L80A 3KBVA 3RITA 3UG5A 1RK5A 4AUBA 3CJPA 2B4GA 3LOTA 4H04A 3TDFA 1SW0A 2CXGA 4EVZA 1C9WA 2X7WA 3W7QA 4U4MA 1X6LA 3RCYA 3VIOA 1ZQ5A 4V15A 4QDMA 4H9YA 1SO4A 2HK1A 3ES7A 2E3ZA 4GFIA 3PTQA 4Y9OA 2WANA 2PLKA 2GJPA 4IH3A 4TTUA 3PZQA 3VC6A 4P61A 3DX5A 4YTTA 1MZRA 1R87A 4S3AA 1MUMA 1R9XA 4IP4A 5CSRA 2V0TA 2R82A 4EF9A 1WKEA 2E40A 3G8EA 5FOOA 2AAMA 4F2TA 3GH7A 5JUVA 3HPXA 1WQ5A 1EGZA 1O1ZA 4NL1A 5MF5A 2VM8A 2G50A 5C9UA 1TIMA 3LPFA 1FCQA 1LOSA 3RFAA 1W9UA 3QPYA 3IV3A 1PXGA 1FKWA 3LNMA 3FS2A 2Z6IA 1FH8A 1Q8JA 1MEHA 1JCXA 1IT0A 3KLLA 1W31A 4BI7A 1YPXA 1PKNA 3B0YA 4CQ8A 1DPMA 1IR1A 3QOMA 5C71A 2NX3A 1CXEA 4KEZA 3PFMA 3P5ZA 3ZFHA 2WQPA 2QEZA 2VX6A 3CZKA 3KBSA 3HU7A 3KP1A 3F2DA 3N14A 3N2TA 5FESA 3SUWA 1M5WA 3G0UA 1QNRA 4IG2B 3B0PA 1UWIA 2D69A 3NL2A 3NOYA 3UQNA 3FYYA 4ERGA 3WLHA 3RLGA 2SFPA 3VUSA 5CXPA 2P1FA 3MI6A 2PZ0A 2XISA 5AECA 4IICA 3RM9A 4YLWA 3FNDA 1VKFA 5A8OA 1XWYA 1E0UA 1TREA 4PCTA 3CUGA 3T08A 1JCMP 1FVPA 3BW2A 1A5NC 3SUUA 2OX1A 1EPXA 2R9RA 1WB0A 4AB4A 2Y7GA 3SURA 1O60A 3LBCA 3FKKA 1KKOA 3W88A 4MKVA 4WLCA 5EYWA 1TV8A 4E3TA 2PGFA 2VOMA 2QCGA 3SM0A 1XV8A 4RXGA 1U33A 3B0XA 4K37A 3V0TA 4IIBA 3TTSA 4AF0B 2CLIA 3HGOA 4R88A 2XYLA 5IFPA 1NWTA 1OK4A 4WX2A 4IWWA 5KITA 3VXGA 4LSBA 3W4RA 1NARA 3N11A 3DI1A 2C0AA 2UWFA 3KLKA 1P7TB 1XH1A 4YTUA 5DF0A 2J79A 5CCZA 2WSRA 2A3BA 1G5AA 4E2DA 4EANA 3GNXA 1JCNA 4Y9NA 3P5YA 4XD4A 1WZAA 4ZQCA 1O7AA 3QH2A 1U83A 1SW3A 5DBUA 1Z9AA 2VCBA 1SYTA 1U5VA 3STFA 3DERA 1UR0A 1AD4A 3AHTA 4HZ8A 1OX4A 2ZUWA 1LOQA 1QMLA 1CGUA 1TZ9A 1P7TA 3T9PA 3G1RA 4W7WA 4XIAA 3GU1A 3GXNA 3U57A 1BYCA 2E8ZA 4JL1A 1A3XA 1EKOA 2E77A 2VRJA 4IP5A 2PDQA 4F9DA 3DFHA 3DKJA 4DBDA 4JL2A 2ZUMA 1UUQA 4DJEC 4E4PA 1E4NA 1XQKA 3TTQA 4D6EA 2ACUA 4FNUA 3NQDA 4EXAA 1QI4A 4GD0A 1AA1B 4RPPA 3HG5A 2J8GA 3CQHA 3CUFA 1FTXA 1WV2A 1T7LA 3WLNA 4A3YA 3W7HA 3EWZA 2UY5A 2G97A 3H2CA 1X8FA 5AB3A 2ZDRA 1GHRA 3B0VC 3OG3A 2YR1A 3JS3A 3BL3A 4B5WA 1V6WA 3MO7A 3CEPA 3PWGA 3A13A 2EJ1A 4NZCA 1K8XA 3GTIA 5JH1A 1J8VA 4EE9A 2DP3A 3LHZA 3QV9A 1UZHA 3TYBA 3B03A 2E8YA 3SECA 4UR9A 3AWNA 4NJIA 4OOUA 1ZP4A 3EPOA 2XU2A 3V5FA 3UWZA 4M80A 5I6SA 2PD9A 4X9YA 1QPRA 3WCZA 3QN3A 3W86A 1JD9A 2WWDA 3O15A 1KFJA 3T44A 3MSRA 3G1VA 1J2WA 3IIVA 3BVJA 2ISVA 2C8NA 3OG2A 2V5CA 2VR5A 4RNIA 4KMQA 4GJJA 2Y70A 5CSYA 3WLJA 4DELA 2YBUA 3D3FA 4NI8A 2GGEA 1Q2SA 1EP1A 4JX4A 4Q4SA 3O16A 2YLLA 1OCBA 4ZR8A 1SUXA 2W3ZA 4MFDA 1JXJA 3N6JA 1PTDA 3FA5A 4GXPA 2WYSA 2V6AA 3AIEA 4Z17A 2Y4SA 4JOMA 1DJZA 1HFBA 2E4TA 2HEJA 3QR1A 4R7OA 2FFIA 2FH6A 3I3DA 1CW2A 4CGTA 3OLDA 1LP6A 1K8CA 2E68A 4LU0A 3NQ7A 5A6SA 3VNKA 4LRSA 3TW7A 3GAKA 1J93A 1FRBA 5DY3A 4UZSA 1E6XM 2CLMA 3VGFA 1JZ3A 2O9TA 2FVLA 2YIHA 2CIPA 3GHUA 2OYLA 3CUZA 1KR0A 1H7NA 2D0FA 2HROA 4L4PA 1TWWA 2WHLA 1KBLA 1YNPA 2OPJA 4CD7A 1UWQA 2Q8LA 7A3HA 1WZMA 3LUTA 3QC0A 2X09A 3OP2A 2BASA 1UP3A 4XZNX 1T40A 4KWUA 5BRPA 3RIKA 5D30A 3GR4A 1JGMA 5CC7A 2HK0A 1FDZA 2V5KA 3S5OA 1GPWA 3O3RA 1OWQA 5BMXA 2G3NA 4M6VA 2D0GA 2RJHA 4AWEA 3GW3A 3FGCA 3LHYA 5BW6A 3EKLA 4PL1A 2NXGA 3R6IA 4D6IA 4RE3A 1EO7A 2WC3A 3AO0A 1FWTA 1TMHA 1DWFM 1EIBA 3PBUA 1XRTA 3U2ZA 2OZ3A 1V5XA 1G0CA 1TSIA 1TR1A 2BBFA 1UBPC 3HG3A 1GCYA 5FA5A 1QHOA 2Z00A 3AIQA 3CAVA 4R53A 4R3UA 1YPIA 1C8YA 4DYKA 1ZRQA 2XM2A 1HKMA 3VFLA 3R10A 3TYDA 1UKSA 3LV6A 3OEXA 3O6AA 3ARTA 2WXDM 1PYFA 4QLLA 4FOJA 3S83A 1TE6A 1VFLA 2MANA 4AXNA 2I5GA 4KEMA 4O18A 1GKRA 2D2OA 3K8KA 3EEZA 1OHLA 2PF8A 1PZ0A 3WBWA 5HMDA 3ABRA 4PMQA 4DZ5A 3L4XA 1QI3A 3UR5A 1M03A 2VXNA 1CYGA 3AU6A 3WLRA 1O5RA 1AG1O 1MNSA 1IGSA 5F2GA 3I6RA 1VP5A 4K7VA 1E70M 1F07A 1N8IA 2PDLA 3TFCA 1EP2A 3W73A 2R1LA 3U2EA 1ISYA 1WP6A 4V27A 3H54A 4C5YA 4MUPA 2V5JA 4WDUA 1TV7A 1ECQA 3FKRA 2XFWA 1L0PA 2Q8XA 1BTCA 4PMJA 1B9BA 2QVNA 2NQLA 3DGRA 3EGJA 3ZLGA 3H7VA 3LENA 3SCTA 3G0XA 1KXHA 6ENLA 3WJZA 4AD2A 4GC4A 4GQGA 4G5DA 5E0FA 2C16A 4GUIA 5BXPA 2EO7A 2ZVIA 3GD6A 1XFCA 2P88A 3WLQA 3UA4A 2PTXA 1R30A 4JIIX 2OG9A 1KQYA 4CLMA 3ANUA 5H8MA 5LNVA 3L7RA 3QHMA 3TMLA 3RCMA 2OGJA 1RPKA 3PK7A 3H23A 1TX2A 5DMLA 2D20A 4EAMA 1YYAA 5G2IA 2AL2B 5CGTA 2PD5A 2QUNA 3E2QA 1L6WA 8RUCA 3GIQA 3B40A 2PP0A 3GFYA 4IF2A 3TC3A 2BSLA 4WKAA 4FNTA 2OEKA 3IJQA 3O0KA 3SRFA 2DUAA 2AMGA 2X2YA 1UB3A 4JFUA 3PBGA 3COTA 1J11A 3VMOA 1QDSA 3MVIA 1E1EA 4M51A 1SO5A 5FI8A 1JYWA 3UPMA 4O8RA 4UMCA 3T6CA 2PDUA 5A8NA 2BXVA 4Q4PA 3V1HA 4LS2A 3QV8A 4DJFA 1JULA 4G7FA 2NV1A 3PBMA 1ODUA 4X2PA 3FEQA 3WDHA 2J7EA 6ALDA 3QTGA 4C1KA 1G4PA 4LF1A 4WR3A 3OW1A 2CZFA 3ZR5A 4AWSA 3M0VA 3NM3A 4R5EA 3L2IA 2GUUA 3VNJA 2PGEA 1VLWA 4GVFA 2PCEA 2OKOA 2HSAA 5I3IA 2QJIA 3CB3A 5HUOA 1NFBA 3S2NA 1TA3B 4BWLA 1KM3A 4I90A 3GE7A 4FX7A 2J75A 4LPCA 1A5BA 4YTSA 1IXQA 4MAZA 1BYAA 4HPNA 3VNLA 2DZVA 1F8IA 3SCVA 2O9RA 4B5VA 4KH2A 3MS8A 4U31A 2VO5A 3WDPP 1BYBA 3E5PA 4LVDA 4NAFA 2WC4A 2ZRWA 5FF7A 3NSXA 3TA9A 2PDNA 5DXXA 4FPSA 2XVKA 1DOSA 3A64A 3GKAA 4NNAA 5C0QA 1XG4A 3S2MA 3DC0A 4TU1A 3EOOA 3ZOAA 1HQTA 3FYOA 1LUCB 3T4CA 4HBKA 3OA5A 1QOPA 2DZBA 2GJRA 3W01A 1RBOB 2E67A 5A6AA 1SZFA 1Z41A 2WKLA 3WDIA 4DUWA 1S5TA 3ZO9A 1EA0A 4YTRA 4A3RA 3L23A 2C3ZA 4PMNA 4ZQRA 1EXBA 2OO0A 1LORA 3WQCA 5F7UA 1ISZA 2J66A 3H7UA 3TQ0A 4S3KA 1THFD 3WK3A 2GJXA 3WLLA 2XVLA 1LJYA 4NJJA 1TPC1 3FK4A