4ERIA

Evidence for a dual role of an active site histidine in alpha-amino-beta-carboxymuconate-epsilon-semialdehyde decarboxylase
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
331
structure length
331
Chain Sequence
b'KPRIDMHSHFFPRISEQEAAKFDANHAPWLQVSAKGDTGSIMMGKNNFRPVYQALWDPAFRIEEMDAQGVDVQVTCATPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKVLAQVPLQDLDLACKEASRAVAAGHLGIQIGNHLGDKDLDDATLEAFLTHCANEDIPILVHPWDMMGGQRMKKWMLPWLVAMPAETQLAILSLILSGAFERIPKSLKICFGYGGGSFAFLLGRVDNAWRHRDIVREDCPRPPSEYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLGEQKIGGLVLSSNLGESAKDKIISGNASKFFNIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
publication title Evidence for a Dual Role of an Active Site Histidine in alpha-Amino-beta-Carboxymuconate-epsilon-Semialdehyde Decarboxylase
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 123
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4eriA00
2WJEA 3IARA 1EYWA 1R9YA 3G77A 2QT3A 4UBPC 5LXXA 1EJTC 4J2MA 3E3HA 2FVMA 1FWAC 1HZYA 1RJQA 2E25A 4LAMA 3GIPA 4GC3A 2DVTA 4KEVA 3MVIA 1PSCA 3HTWA 2OGJA 2HBXA 4KEZA 4C6FA 1RA5A 1V51A 1FWJC 4C6MA 4C5ZA 1V7AA 2QVNA 4DZHA 4H01A 1ONWA 2VC7A 3QY8A 2Q09A 3TNBA 4PE8A 1GKRA 2VUNA 3EWCA 4C6BA 2HPMA 3GU1A 4QSFA 3BE7A 2HPIA 3S2NA 1FWDC 3LGDA 3C86A 4KESA 3CAKA 4KQNA 3MDWA 4PBEA 1KCXA 2R1MA 1FWGC 2R1NA 4HK6A 4RDZA 4H9XA 2D2HA 4DI9A 3TN4A 5G4HC 4GYFA 4C6CA 3EWDA 3K4WA 3A3WA 3EGJA 1JGMA 4AC7C 1POJA 3GG7A 3GUWA 1M7JA 1EJXC 2YB4A 4RE0A 1M68A 2Z2AA 4J5NA 4XAFA 1FWBC 3PNZA 3IGHX 3MKVA 1NFGA 4LALA 4C6DA 3D6NA 1EJVC 2BGNE 4LEFA 1NDVA 4QS6A 4C5YA 1E9ZB 1E9YB 3GRIA 3LU2A 1W1IE 2OB3A 1XGEA 4PCPA 2KAUC 1GKQA 3E0FA 4DI8A 4EP8C 1XWYA 4NI8A 4GY7A 4RDVA 4B3ZA 3S2LA 1YNYA 4V1YA 4EPBC 4HA0A 4RDWA 4GY0A 3F2DA 3LS9A 1FWIC 5FSDC 1A4LA 1RK5A 1O5RA 3ISIX 4H9ZA 1M65A 3F4CA 2AMXA 1UIPA 1KRAC 3T81A 3B0XA 4GX9A 1PB0A 3S4TA 3IACA 4YIWA 3FEQA 4RZBA 5E5CA 1R9XA 4B90A 1RJPA 3K5XA 2DVUA 2R1LA 1A5KC 2Z00A 4GXWA 4KETA 4C6PA 4EPDC 2PGFA 2Q01A 4XAYA 3MVTA 4IF2A 2E1WA 1ITUA 3R0DA 4WHBA 2YXOA 1A5LC 2HQAA 4DZIA 1FWCC 3WMLA 1YIXA 1XRTA 4ERIA 3TN6A 3IRSA 4C6EA 1EJSC 1ZZMA 1I0DA 1V77A 4KEUA 3GU2A 1ONXA 1RK6A 3DC8A 5A6TC 4LCSA 2Z26A 4MUPA 3NEHA 3HM7A 1V4YA 2ZC1A 4C6NA 3UPMA 2Z29A 1FKWA 3LA4A 3RYSA 4L6DA 1EZ2A 2PGRA 2UZ9A 4IG2B 4I6VA 4IGNA 4H9MA 3LY0A 3ORWA 3S2MA 2CZVA 2ICSA 3O7UA 4DO7A 4IH3A 4IFKA 4HK5A 4PBFA 3E0LA 3F2BA 2R1KA 1XRFA 3ID7A 2WM1A 4L9XA 4LANA 4DYKA 4QRNA 2XIOA 4IFRA 3UR5A 2G3FA 2FVKA 4CQCA 4EPKA 3URNA 4RDYA 3DUGA 4DLFA 4ZSTA 1K6WA 4IFOA 1QXLA 3KM8A 2OQLA 2D2GA 3OVGA 3B40A 1WXYA 3IPWA 3JZEA 1I0BA 4GBDA 1J79A 2Z2BA 3HPAA 3CJPA 4I6KA 4CNSA 4H9UA 4CNTA 4B92A 3WYZA 2PLMA 4LCQA 1EJUC 4ICMA 4IQJA 3PNUA 2PUZA 4G2DA 3A4JA 3NURA 4F0SA 1A5NC 4B91A 2AQVA 3OODA 3E74A 2ANUA 4DIAA 2Z25A 5HMEA 1RJRA 4CQDA 1EJRC 1YRRA 3MDUA 3LNPA 3UR2A 1EJWC 4F0LA 4C6IA 1YMYA 1P1MA 4BKNA 4P5UA 1IE7C 3FDKA 1RAKA 4XD6A 4PCNA 2QS8A 4H00A 3T8LA 2EG6A 4XD5A 2FFIA 3RHGA 1J6OA 4Z42C 5HMFA 4G7EB 1NDZA 2GSEA 3GTXA 1VFLA 2BB0A 4XAGA 1PTAA 4V1XA 2QPXA 1FWFC 2VHLA 1A5OC 4F0RA 4GOAA 4HJWA 3K2GA 4R88A 1KRCC 5CH9A 3TN3A 1KRMA 1BF6A 1P6CA 4GX8A 4QROA 1GKPA 3E2VA 3OQEA 4UB9A 3ITCA 3TN5A 4C6OA 3F4DA 1YBQB 1V79A 1FKXA 2IMRA 2VC5A 3RN6A 1PO9A 3ICJA 2Z24A 4TQTA 4XAZA 4KF1A 3GTFA 2HBVA 4CEXC 4NG3A 1EF2A 3URBA 3AU6A 2AQOA 2WJFA 3UF9A 3FDGA 2YB1A 4C65A 2PAJA 4CNUA 1KRBC 4GY1A 2W9MA 3A3XA 3LGGA 4WGXA 3RCMA 1K1DA 4NP7A 4ERGA 4C60A 1POKA 1P6BA 4ERAA 3CS2A 4G7EA 3F2CA 4KERA 4KIRA 4R7WA 4HK7A 4GK8A 3T1GA 2FTYA 2P50A 1WXZA 4DNMA 2VM8A 3OOQA 3MPGA 2RAGA 4JOMA 3IV8A 2O4QA 1YBQA 2P53A 3NQBA 1ITQA 2FTWA 2Y1HA 4LCRA 3S2JA 3O0FA 3AUOA 2Z4GA 1RA0A 4BJHA 2UBPC 2I9UA 4J35A 1ADDA 2I5GA 3N2CA 4H9YA 1UMLA 1FWHC 2GWNA 4IGMA 2F6KA 3WZ0E 2Z7GA 4IG2A 3MJMA 2GWGA 1DPMA 3GTHA 4QS5A 1J6PA 4DLMA 4CQBA 3GTIA 4EPEC 1NDWA 1NDYA 1J5SA 1O12A 3QY6A 3QY7A 3B0YA 1FWEC 2A3LA 4WVXA 4XD4A 1UBPC 2OODA 2GOKA 2DVXA 3IJ6A 2HNHA 5HMDA 4QTGA 4E3TA 1K70A 4ZSUA 3OJGA 3QGAC 2OOFA 4LAOA 3MSRA 4C6QA 2EG7A 4LFYA 4GZ7A 3QGKC 3LSBA 3OU8A 2D2JA 2Z27A 4BY3A 3V7PA 1UIOA 2VR2A 3SO7A 4XD3A 4R85A 3PBMA 4C6JA 4C6KA 4M51A 4OFCA 3AU2A 3URAA 4AQLA 2YZ5A 3GU9A 3LSCA 1R9ZA 1S3TC 1A4MA 4H9TA 4IFKB 4INFA 4H9VA 4D8LA 2O4MA 4C6LA 2Z28A 4LH8A 3SFWA 3DCPA 2GZXA 3URQA 1A5MC 5AKQA 4LAKA 2R1PA 1QW7A 3E38A 3MTWA 3PANA 3UBPC 3PAOA 2ADAA 2EG8A 2WJDA 5FSEC 3GIQA 4CEUC
chains in the Genus database with same CATH superfamily
2VC9A 5C54A 2PDFA 4AX7A 1GWJA 2Y89A 1IGSA 4GE8A 4J3ZA 3ELFA 3AIUA 4MNLA 2AOSA 4LS1A 2E25A 1IT8A 2QXWA 3UR7A 3W7NA 3R58A 2BFGA 3QMTA 4FLRA 4K1WA 4DYJA 2PDXA 1FY6A 3VIPA 1QCWA 1TCDA 3P6LA 3BTNA 4XZ9A 2VGIA 4K6AA 1VGAA 1DP0A 2WMGA 2E0PA 4PULA 4RW5A 2NVCA 2QVNA 5H1WA 3I7RA 3FKRA 1XIGA 3RGTA 3UGRA 1LJYA 4PE8A 1WDQA 3GU1A 4Y96A 2RGLA 2VFGA 3R7MA 4WSJA 1Q8AA 3W75A 3T0BA 3M0KA 4ADTA 4HOWA 3DECA 1SJDA 3TYZA 4GI6A 4B3LA 2NV1A 1QW9A 3FXGA 4C6CA 4E6MA 2YDRA 3DFSA 5D09A 3GUWA 3WF4A 1M68A 1E6RA 3B0VC 5EA9A 1QATA 1MI3A 3SUUA 1JFXA 3AS2A 2WVVA 2Q8XA 1W1IE 3BWWA 4PCTA 4L7ZA 4PCPA 4D8ZA 1TPC1 3FAXA 4RW3A 4GVGA 1UH2A 1GOXA 4XSMA 4MY8A 3DH7A 4C1KA 3CQIA 3N34A 3TSBA 1UA3A 4KRZA 1CLVA 4HYRA 5DXXA 3SY8A 3G5EA 2BVDA 1T5AA 4AIUA 1WUFA 4RNJA 4F2UA 2HTMA 3MMUA 4GHRA 2GPTA 5CZKA 4UQDA 1JZ8A 1BTCA 1KBBA 1QNPA 1TQXA 5FESA 2BBFA 3O1NA 1RY8A 4RJEA 4R53A 2ZRVA 3OZPA 1F7BA 4US5D 3O06A 4LBRA 3BMWA 3QTGA 2QDDA 1C9DA 4K3ZA 1U83A 3U7VA 1DWGM 1P1XA 5I09A 4LB3A 3TN6A 5CZSA 2R94A 3CNYA 4LCSA 3BV4A 5JH2A 5I3KA 2Z29A 4Z1YA 3CWNA 1OGGA 3KRUA 3CQJA 1OEPA 2WVUA 3LPGA 1QVBA 3UXDA 3VTRA 1YTEA 4IGNA 1TYGA 4JTQA 4D6DA 3EA1A 3W6LA 5CZ0A 3RUBL 2VDGA 4J40A 4L9XA 2RHGA 4IFRA 3B8VA 3UR5A 4MPKA 3S5SA 1YNQA 4O19A 3DUGA 3LLXA 1J2BA 2E5BA 3L9CA 3KL3A 3M16A 2VXNA 2CW6A 1GNXA 3WEZA 3LZ3A 5FL0A 2XIMA 1DIDA 1DE6A 3SUVA 4MJMA 2E67A 1HVXA 3GC2A 3K1GA 1IT0A 2GLKA 5TIMA 1UP3A 2EQDA 2EHHA 5J5RA 1NOUA 1JVNA 1TE6A 3G3DA 2C8NA 4E5TA 3S5OA 3WMCA 4A05A 4NT0A 1FBAA 4N4PA 4ATLA 3MU7A 3NQMA 2VR4A 4Y8EA 2E9BA 4CCZA 3P0WA 3FK4A 2WSQA 4LU0A 3UZJA 4W9TA 2YCLB 4XQ6A 2A4AA 2AKMA 4EAMA 3H4XA 1XLDA 2PP1A 1VPYA 2NX3A 4PMXA 1F6KA 5IHRA 2Q3RA 4JTHA 2FFIA 2XH4A 4GUGA 3NL5A 3AHVA 4WUIA 4GOAA 1ZBVA 3ZJ6A 3VNKA 4FNTA 5CH9A 1KRMA 3BSGA 1KV8A 2KZHA 3PULA 2UY4A 4PRWA 4GZJA 3BG3A 2ZWZA 3RN6A 4PODA 1MXGA 2NXIA 1S5MA 2H9AB 4Q8WA 3HGOA 3UXAA 1T0OA 1DJZA 3VIOA 1OYCA 1L6SA 3NL2A 3EXTA 4UFJA 5C71A 3PTKA 5DRIA 3B8TA 2WWCA 3VE7A 3GHRA 1F3EA 2P8BA 2XFRA 2JEQA 3GDTA 3KOFA 3GNNA 1POKA 3W7RA 2H3DA 1H63A 1DJNA 4KERA 4GK8A 4JAWA 2ZUNA 5BMXA 4GUJA 2QCFA 1QOQA 2VX4A 1ITQA 3FHAA 3A5FA 1LDCA 5AYIA 2D3LA 4DZ5A 3C0SA 4LC8A 4M3PA 2WCSA 1EJ7L 3IVSA 3CIWA 2VVNA 3FOKA 4GVIA 3JZUA 3ANVA 3TYUA 2ISDA 2GWNA 1UKSA 5L6UA 3SJNA 1BTMA 5GNZA 4AZ7A 4HOXA 2QMJA 1M03A 4EXAA 3QY6A 3ZM8A 1O66A 1XLKA 3IJLA 2YA2A 1E43A 3GVWA 5FKYA 3CUIA 3BAKA 1OFAA 2DVXA 3SCTA 5HMDA 2NQHA 3GH5A 2YBUA 4LAOA 4JHMA 1E4NA 4LUTA 2XN0A 1A5CA 3DFTA 3VE9A 1P0BA 1D8WA 4B4HA 2OG9A 4E38A 3S9ZA 4AD0A 4AH7A 3FN9A 3KFTA 9XIMA 1PXGA 4YVVA 1U5JA 4ZOCA 2WMKA 1R9ZA 1I8JA 5HBFA 3WQCA 1M41A 2D2OA 4KWSA 3N3TA 1TUFA 4M5PA 4ZTYA 5IRPA 1EHAA 3GW0A 3STEA 4MNJA 2FDMA 2CPUA 4GD0A 1ODUA 4MWAA 4NIRA 2QCNA 3NZQA 3PAOA 1LWJA 1NELA 5GJNA 3QFEA 3AJ7A 3DG7A 4IP5A 2YCIX 1GW1A 1HG3A 3PBUA 4RNFA 1D9EA 3C0QA 4JYFA 1JDAA 3GR7A 3LV6A 5AYZA 3WKZA 3TTOA 4NX5A 1QO5A 4JN7A 4FR6A 3MMWA 3FA4A 3V0TA 2QZRA 2JKAA 4D9PA 3K8MA 5EFFA 1TX2A 1KR0A 3BLIA 3DYOA 3GXNA 3SN4A 3SRFA 4DHGA 3N17A 5CGQA 5D2TA 4H01A 4N9DA 5CJ5A 3LBMA 3NVTA 2ZCGA 1N82A 3TUUA 1BLIA 3LHZA 2HK0A 4QSFA 1TG7A 2R6OA 4DF2A 1EO5A 2DSVA 3HPFA 2R1NA 5EMMA 2BNJA 4ZQRA 4E4PA 5ABEA 3W1AA 5K2ZA 3QPZA 1NVMA 4GYFA 1DIOA 3K4WA 3P14A 3GG7A 1XICA 1M7JA 4ASTA 2QCDB 3UZYA 3PNZA 1M1BA 2VX6A 1PV8A 4R33A 4NAEB 1K9DA 2BOEX 4A8IA 3BZJA 3RLUA 7TIMA 3WNPA 2G4FA 5FJPA 1SQ7A 4DN1A 3WBYA 1AQMA 1TE1A 4ZB5A 4RDVA 4O10A 5CCZA 3RPTA 4PEEA 4HA0A 1HKMA 3FXYA 2A0NA 2O56A 4WK9A 1FWIC 1UROA 4JX6A 7XIMA 5FOOA 4W8AA 3AZTA 4MB3A 3WJWA 2A7NA 1E0TA 1WOAA 1KRAC 3PN8A 4QE5A 3EDJA 4MFEA 1Z32X 1S2UA 4QE4A 2QPUA 1R2TA 4U31A 1HJSA 1UD6A 3W88A 2IXUA 3USZA 1V3KA 3S9IA 1FWSA 3C3NA 3HU7A 3E5BA 5EMLA 1Z44A 3REQB 4WHBA 2OLHA 2BY3A 2VFHA 4LF1A 2G0WA 3E49A 4BI6A 1EQCA 2R24A 3DC8A 1X97A 2NV2A 3B9DA 4AXNA 3M0MA 1V4YA 3WK3A 2P10A 1TSIA 3T7VA 3TJIA 5A2AA 9XIAA 3A3HA 3XIMA 3G1DA 1ISZA 4D6JA 4WY0F 5KITA 2IPFA 4LYQA 1NH6A 3O3RA 4EF9A 2E4TA 1DTNA 3KVLA 3IAPA 1MZRA 5DANA 4LWWA 2ISFA 5DEZA 4ZB0A 3WF3A 2CKRA 2E6AA 3KS6A 1V0LA 3P61A 3VFCA 1E51A 4PTMA 7CGTA 1WDDA 4L6OA 5AVHA 3KL5A 1MQPA 4IMGA 3VIGA 1QWGA 1YXYA 5BROA 5LIUX 3BOFA 4Q4PA 5I77A 1JRCA 2DJLA 3BO9A 3GR4A 3TCEA 4AZIA 3UWWA 2FZ8A 5BOEA 3OA3A 2VGGA 5EBUA 3MI6A 3IJQA 4DF0A 3M0VA 4TOQA 3F4VA 4Q8PA 3UR2A 1HL8A 2INEA 4B2DA 5E93A 2F61A 3GLCA 2VRJA 5I3JA 3G1FA 5I07A 3Q2DA 3T8LA 2TODA 3L23A 1JPDX 3BUVA 3TLLA 3RJYA 1XPGA 3VMNA 3ATYA 4Z1CA 2D23A 3CZGA 4K39A 2ATSA 1A5OC 1DEDA 1SZNA 4HHLA 4H1ZA 3PSVA 2WVSA 4R88A 1TMQA 3POHA 2JGYA 2I17A 4M6UA 4PMQA 4X2RA 4C6OA 1W56A 5FF3A 1JI2A 3QZEA 3ICJA 1VENA 4TQTA 2YKKA 4A29A 4C7DA 5I6SA 4IP4A 2PA6A 5D33A 1T8QA 2PDCA 4K2SA 2GGIA 3NZGA 4MLRA 4YN5A 3TMQA 1GG0A 2IS7A 2PAJA 2ZFAA 3I65A 2YCLA 1C8YA 3S6DA 3NOEA 1JJKA 1ZCOA 2V5CA 1QWKA 2XTKA 1QI3A 3BZGA 1OZQA 1K1DA 3HB9A 4PUKA 2E8ZA 4C60A 4JNYA 4C1NA 1F9CA 3R0KA 2X1TA 1EIBA 3PZ9A 3RPMA 2H8XA 1K9EA 3E12A 1E1EA 2P76A 3T1GA 1NWSA 4DNMA 1C7TA 3DERA 4BQ5A 3ZJKA 2FVLA 1VIWA 2ALDA 3GG0A 1Q6EA 3L0GA 5KZEA 4L1XA 2VX5A 4PR4A 3G0XA 3R13A 3UFYA 5JBDA 2OJPA 1V3IA 3UETA 3GNPA 1HXJA 3THAA 4IGMA 1VZWA 3N15A 4D6HA 4NHVA 2PWVA 4HHHA 3GTIA 3OVQA 3L5LA 1JDDA 1OFEA 1JZ4A 1FWEC 2AGKA 4BQ2A 3AMCA 1RPKA 5CSSA 3L2LA 4BI5A 3CB3A 3TQPA 1W3JA 3IJ6A 1TFVA 4H41A 2GVEA 2R14A 3B0PA 2VVSA 4ZA0A 3G6LA 3E0WA 3DX5A 3W83A 3WH8A 5LXEA 1N8FA 1CXIA 3SUTA 2VEPA 3MP5A 4YVPA 3TWBA 3DGRA 2PDBA 4DELA 4HB7A 4KCWA 1W1PA 4A2SA 4JPGA 2VD8A 1XG3A 4Y9NA 1OFDA 3LSCA 1VS1A 4WDXA 1KM1A 3W2MA 3G0SA 5BYWA 1V3LA 4NJGA 1XSJA 1J0ZA 2DORA 4ZE4A 2R9RA 1H5YA 3BW2A 5FEWA 1EC7A 3BMVA 1AODA 3B9AA 3SCUA 1L9WA 3KE0A 4R9XA 2J4GA 3RITA 4GPNA 1XI3A 4IJRA 3RFAA 1ITXA 3DGBA 4FPSA 3LCWA 4ZEPA 2J7DA 1EJTC 3PG9A 1M7PA 2DT0A 1VP5A 4KWVA 1R2SA 2PGWA 4I5RA 5FI8A 4Q8TA 1GPFA 1V08A 1XYBA 4PUDA 1CEOA 5EMJA 4Q8VA 2PSNA 4LGXA 5E70A 5DT5A 3HTWA 5AHFA 4UWMA 3EMZA 2DW6A 3BOXA 2WWDA 2ACQA 1ZHAA 3DFYA 4Q3MA 4DZHA 1W3NA 3LRMA 4KMQA 2YBVA 5I2UA 3QY8A 4ZTXA 1GQLA 2PZNA 2ZE0A 4DXKA 3NO5A 1EFZA 2EO7A 3ZLGA 1O6IA 2V82A 1KCXA 4FX8A 1GGOA 1PZ0A 4H9XA 2FTPA 4Q8NA 5BRBA 1KGWA 1OY0A 2OKTA 1JUKA 3A3WA 4FOUA 1DTUA 3W70A 1RQHA 2XJ7A 4QDPA 1UOZA 1GVYA 4JFWA 4XAFA 2QCEA 1E6NA 4PUUA 2Y7GA 2Z7KA 2PF8A 2GQAA 3CHEA 1V3HA 4C5YA 1XYFA 3WIJA 2OB3A 3BAWA 1F05A 4CD6A 5E0CA 1G0CA 3NZPA 3UJEA 1R3TA 3DKLA 1MZHA 4L9YA 2JFEX 1AD1A 3KZSA 5DCEA 3W0KA 3KP0A 2NSXA 1RLDA 3IK4A 2AMXA 1SGJA 4MJ4A 2G37A 4OKDA 2YXXA 4D1JA 1RSCA 2NQ5A 2PDMA 1TPEA 1L6GA 2R1LA 5JVLA 1SJBA 4AZHA 5DBTA 1GJUA 2IKJA 3KW3A 2YLAA 4NJJA 1LTDA 4O15A 4GH3A 3CQHA 1D2KA 3VOJA 4FX7A 2F7FA 1S3HA 1QUMA 5L9FA 2F2KA 3W27A 3TW7A 1BSIA 2WOQA 3WMBA 2W92A 4XZNX 1TMHA 3WUEA 2VENA 3PZUA 1VCGA 1PKNA 3BLDA 3ATZA 1O68A 4S2BA 4PUMA 1GEQA 4PTXA 2OX1A 3S2MA 3LN3A 1A0EA 1QI4A 1XDLA 4L80A 4E0CA 2EBNA 1CGXA 4LAUA 4MPQA 1Q8JA 2ZA2A 3Q45A 1IIGA 4XBKA 2PDGA 3R8GA 2C14A 3A21A 3UPWA 1PBGA 1JD9A 2WAGA 2F38A 2X1IA 3U2CA 4QDWA 4GWEA 3TP4A 4UQAA 1OX4B 3B40A 2VWTA 3RM4A 4K8GA 2J7BA 4JTTA 1H7NA 2O92A 4AEFA 3REQA 1TV5A 5D32A 2DIKA 2DSUA 3UZXA 4POCA 3WK2A 2E9LA 3CJPA 4I6KA 1NARA 1R30A 3SRHA 1Z8AA 4FXRA 3S5NA 1EJUC 1TWWA 3FGCB 4KGLA 4UXDA 5HNNA 1AJ2A 1TV4A 3ARXA 4V33A 2J8GA 1E0UA 2QW5A 2DSWA 3R6IA 1RCXB 4H8UA 4JIRA 1NY1A 1O5XA 3LCGA 1BGAA 1XF0A 4KGJA 4EWJA 4OBTA 1SZFA 1QR7A 3GK0A 1RAKA 2HNEA 5LZLA 4O1EA 1I2NA 3ZYZA 2YA0A 1AQFA 4B5SA 3W7IA 3S1WA 2OSXA 1WDSA 4YCOA 4IOTA 3AZSA 5AC8A 3RX2A 3OGSA 3ARVA 3K2GA 3EWZA 4ZO7A 2Z0IA 2X2GA 1XLBA 4O17A 4K8EA 2Y24A 3OQEA 1VHCA 3VCCA 2EF9A 4XVDA 1FP9A 3LPOA 1THFD 2CLLA 2IMRA 2NXHA 5U4NA 1Q63A 3GY1A 4CNNA 3GHSA 3H70A 3I7QA 1KQZA 4Q6JA 1AL8A 2CWNA 2VMFA 2G97A 5HQMA 1FHLA 3V16A 1H7XA 3UF9A 4ZFMA 5LSMA 3AOFA 1BWLA 3HV8A 3A3XA 3UY7A 3SCOA 3CC1A 4CD4A 5XIMA 1ECQA 4OT7A 3SI9A 4MKVA 1HX0A 1XBZA 1XGDA 3CS2A 4JCMA 1VJZA 1VC4A 2OU4A 1HF6A 4MHBA 9CGTA 1ICQA 1R6WA 3SCVA 1Y5WA 1EIXA 2VOMA 3VM5A 4J3WA 1KXQA 2OZ3A 1MYRA 4JOMA 4QNEA 4QJ1A 2Y1HA 2DZAA 1JZ2A 4KRUA 3DG6A 5A8QA 4RZ6A 1UR0A 1JYWA 2QDHA 1X39A 1R7AA 1G4SA 3MHUA 4HPJA 4MVAA 2CKSA 4KW2A 3B8IA 3QJAA 2VNCA 3GFXA 4MKSA 1GOOA 1TCMA 4QAIA 2OT1A 4EE9A 2GDQA 1LRNA 4AWUA 2PD9A 2TYSA 3TJXA 1JPMA 1VHNA 1BXNA 3L4WA 3U0HA 4W85A 3W87A 4C1LA 3SGUA 1E5JA 4L4OA 3WK0A 1RBLA 5BZAA 6REQA 3RG6A 3AFBA 4GI9A 4E3TA 1W3LA 2WMFA 2XINA 3QGAC 5HAOA 6TAAA 1J96A 5G4WA 2FPYA 3QMRA 2C19A 2IPGA 3UW6A 3SO7A 5BRQA 3POCA 5KMYA 2UY5A 4LV4A 5G5IA 4WF7A 3N29A 3VKCA 3GU9A 1PX3A 2EGZA 4RV8A 1TV7A 1JEZA 1DOSA 1UC4A 2REQA 1VLIA 4XZMX 1F73A 1GYNA 3T09A 2R1PA 3HOJA 2ZZ7A 3ITVA 2BVWA 4LPCA 5I5RA 3M07A 5HUPA 5CZJA 1GEHA 4HPHA 5D9PA 3GIQA 4F8XA 1G4PA 4AAJA 1TZ9A 3SADA 4JFTA 4RK8A 5A2BA 1L0PA 2FPVA 3B03A 5HNUA 2HROA 1GPWA 1FRBA 3OA5A 3P8JA 1LCOA 3ITYA 2ABBA 4S3JA 4YTSA 3OIHA 2HBXA 4TMCA 4FF7A 1QK2A 4M56A 5CC5A 4IZGA 3E0VA 4NZ1A 1JDEA 3TTQA 1CYGA 2CLOA 1XLHA 3KBMA 3WK1A 1H50A 1IGWA 5H8PA 3V5CA 3Q58A 1QI5A 4DUVA 2VUNA 3M5YA 3UZZA 3VOIA 1ZAIA 1Q3NA 1VJIA 1MXSA 1NF7A 3CM4A 3QPEA 1GZGA 5JBFA 1GOQA 1YTKA 4HK6A 3CT2A 4O54A 2DUXA 3VGGA 1UR2A 1MFUA 1XYLA 2QUNA 3AXHA 2CHNA 2GFTA 4PUNA 3N2MA 4I5UA 1FWBC 4NZJA 1EJVC 4LEFA 1QW8A 4DO5A 2YL9A 4CGTA 1HFBA 1W37A 3KHDA 4IL0A 4KFNA 4B3ZA 4AY7A 3ZO9A 3QBUA 2FH6A 4ACZB 4F2BA 2OZ0A 1A4LA 3P84A 3T0CA 3TC7A 5KETA 2UWFA 1N8IA 2NV9A 4X60A 4X9YA 3VGBA 3LERA 1EXPA 1R9XA 1E6ZA 3AO0A 2BP1A 3CV1A 1A5KC 2Z00A 3CZ8A 1E6QM 4JN8A 3E2RA 3SCNA 4XAPA 2XVLA 2DDXA 1OABA 3ARZA 1A5LC 1J2WA 4HNOA 2WNNA 1OK6A 3IRSA 3IJDA 3TKFA 1B3WA 4NXKA 4TV5A 4HP5A 2BGQA 4C6NA 4YYCA 4FR1A 1TVLA 2WZEA 3CH9A 1PX8A 1A3HA 1EPVA 3LY0A 1GT8A 1W2VA 1NTHA 4WQ6A 2HCVA 1E4IA 5HNRA 3FV9A 4IH3A 1QPNA 1JNDA 7PTDA 2FGLA 3MBDA 1TRDA 1XKJA 2ZZ5A 4QLKA 4NI3A 3H22A 2HDJA 3N13A 4CQCA 4X63A 2Z1KA 1N2VA 4IFOA 1UZ1A 3KM8A 4JIEA 3EX4A 2BS9A 1XJBA 2A85A 2D0HA 3N4EA 1XUZA 2V2CA 5EL1A 3AIQA 4YU1A 3P7YA 4M1RA 1O7AA 2ZC8A 3P67A 4W84A 5D8WA 2IQ0A 5DMMA 2Y8VA 1OC6A 2BZNA 3NM3A 3TSDA 4UOZA 4CNTA 1W0MA 2Z1VA 1ODZA 4YTUA 4LCQA 3KTSA 3NURA 4TV6A 3APYA 3T8QA 4O1BA 1L8NA 3ME3A 4H4IA 3WDJA 3I6RA 3LV5A 1WV2A 3WENA 1IR1A 3N2XA 3VKJA 3M9YA 4GI8A 1BKSA 3VGDA 4PB5A 3M41A 3AHXA 1V3JA 2NT0A 3M7SA 2QS8A 1B3YA 1ADOA 4XD5A 5BXSA 4DBUA 1R3WA 3KUMA 1CX9A 4KCUA 2J25A 1PTAA 3DOPA 4LRSA 4HJWA 4DEFA 2BSLA 4O1CA 3TN3A 4W5UA 3SECA 3CB8A 4DO4A 5EMUA 1FTXA 1CGUA 4YCPA 1FKXA 2VC5A 4GNKB 1JPKA 3RLGA 3GTNA 4HU4A 5FAGA 3TTYA 3RNDA 3BOLA 4O8RA 1B90A 5HR6A 3EA2A 2BOGX 2X7WA 3CLWA 3AIRA 4UNIA 4HMEA 3GDBA 4N7QA 4DAIA 3MI3A 4GY1A 5IHSA 1ISWA 4JTIA 3ARQA 4EF8A 2OFJA 3MCOA 4ERGA 3HG5A 2QR6A 1CB2A 4FXSA 4J27A 3TC6A 4Z2HA 2C6QA 1RCOB 5H2ZA 4PL1A 2DIEA 4KIRA 3PB2A 1KTNA 2JIEA 3TONA 1G67A 1CGTA 4ZQCA 5C2XA 2DZUA 2OPJA 4WX2A 3ZR4A 3VO0A 3MCMA 4QEHA 6ENLA 4LOCA 4ZO9A 3B05A 1XH1A 3TMLA 2Z4GA 1C9WA 5DMYA 3FEMA 5GVJA 4HSNA 1V7YA 1SM9A 4HU3A 3CMJA 3KVKA 3R8RA 3KHJA 3OLEA 4DLMA 3ES8A 1C7SA 5J8LA 1QHPA 5AYBA 3LB0A 3PHAA 5EU9A 1KM2A 4UMAA 1E1CB 2OKOA 1Z7AA 2PZ0A 3ARTA 4F2TA 3TZFA 2PURA 3BL3A 4KWUA 4ZODA 1S1RA 4NU7A 2OOFA 3MSRA 1A0CA 3VVGA 5DO8A 1YDYA 1A47A 1U2YA 2PE4A 4LFYA 4XX6A 4GZ7A 4B9YA 2PWUA 4DM1A 4TVDA 5K4ZA 4H6KA 2W61A 4J4KA 3A47A 1IZJA 4O18A 4PB3A 4IFKB 3TDFA 2C1HA 4INFA 4AZCB 4GBUA 4OU1A 1KBLA 3KLKA 1WNOA 3TR2A 3S3GA 3E38A 4LS2A 4UR7A 1EH9A 4ADSA 3NTYA 1BVNP 1L2QA 3ZVIA 4W8LA 1V02A 1UP2A 3V1HA 3G77A 3W7MA 1UUMA 3KDOA 5HWMA 3PTQA 3R25A 3EX3A 4J1OA 2VGFA 3PTDA 2WZIA 1DJXA 3EZ4A 2H6RA 4UFIA 3OQ8A 1IZCA 3UGVA 3FJ6A 5M3WA 1XD1A 2D0FA 2A6LA 3KOXA 4HYWA 2BVTA 4W7VA 2YCJA 3NM1A 3KBNA 3SFKA 1XLMA 5M1TA 1ALDA 2AL1A 3AYTA 4IPJA 1PTDA 3MUAA 1JZ7A 1ONWA 2X1SA 3EDEA 1G7UA 2Q09A 3MY9A 3W7LA 3EWCA 3EAUA 1XLGA 5ECVA 1Z6KA 4P7NA 1FHVA 4Q7NA 1FWGC 3VIKA 4IIFA 1H1NA 2ZZ2A 4TVUA 1VCFA 3CQKA 5G4HC 3NVDA 5AHEA 1Q6DA 3W71A 1XC6A 3TYAA 1S5WA 1EBGA 2QQ6A 3BCJA 1WZKA 1H5VA 3II1A 3CK5A 4RE0A 1LUCB 3FYPA 4XVEA 3W26A 5BCAA 3HQNA 3V75A 1UR3M 2VEGA 3PZNA 1H11A 2WCAA 4BF5A 1K9TA 4LQ1A 1W1ZA 2KAUC 4Y9OA 1MEWA 3E0FA 4DI8A 4EP8C 5C55A 3W7HA 5C5YA 3TTSA 2ZTKA 4O14A 2V5LA 2IQTA 3BGJA 3LI0A 3R4IA 3IS4A 2RDTA 1HTIA 3IACA 4B9ZA 2V69A 2QPSA 3WNMA 4IIBA 3GXFA 3W7PA 4HYVA 1R3RA 4YXGA 5ABFA 3ANUA 3HG2A 1VPQA 1E9LA 1XSKA 2ISVA 3A24A 2VP8A 3CXOA 3CZEA 2HQAA 2PLJA 1NJJA 1JCJA 3OB8A 6CGTA 4EX4A 3N25A 1TPWA 3CPGA 3WNKA 5D37A 1HW6A 3IWPA 4MWAE 3UYCA 4ORIA 3VILA 3W7JA 5RUBA 3TH6A 1KO0A 2NVDA 4H9MA 4QCFA 3MMTA 1Q2RA 4S38A 4IPLA 3ID7A 2DZTA 4ZL1A 4ZMGA 1MNZA 4R34A 2WKJA 2WMIB 3N2BA 1UD8A 3SY5A 1HIZA 3L65A 2YCEA 2W91A 2V5DA 2QIWA 3TX9A 1G9HA 5D05A 4DBEA 5LA1A 4G1KA 2GYIA 4NSBA 1GTEA 3PZMA 4YPJA 4A3RA 1UOKA 2DIJA 1NSJA 1TIWA 3PNUA 4PGLA 1Y0EA 3CUXA 1OT1A 1RXOB 1KXTA 3MHGA 4M1BA 3WLNA 2OYLA 5CLTA 4DF1A 3VYLA 4Q33A 2J78A 4GYPA 6A3HA 1WKDA 3S5YA 5BRPA 2XVGA 2OYKA 1KKRA 1XW8A 2VZUA 3G22A 4J3VA 2ZZ6A 4P5UA 2D73A 1D7FA 9RUBA 3ARYA 5IFPA 3FYYA 4H00A 1SJAA 1QPRA 3COTA 3M0IA 3FY1A 1AMYA 3WD4A 4F66A 5K9DA 2CLEA 1NDZA 1TQJA 5EBAA 4JDBA 5BNKA 2BVYA 2ESCA 1I2OA 1JULA 2HXUA 2QUVA 3R11A 2ZX9A 3BJSA 4JCLA 3W2JA 3NQ8A 4A22A 4L6HA 1ZCCA 2CHRA 3FNDA 1DXIA 3F4NA 5D9MA 2H90A 3VGEA 4E8GA 3AMGA 2WXDM 4OJYA 2PI6A 2Y5SA 3S8HA 4NG3A 3BURA 2C3ZA 3GM8A 1IHIA 4QQ3A 4QJ3B 3V18A 3SEPA 4S3EA 2VEMA 4JICA 3N3MA 1KRBC 3N19B 4X61A 2WANA 2X0YA 2WKLA 4AD1A 5I0DA 1MQQA 1KNWA 3LCHA 1GJWA 3U5YA 5GPRA 1PZ3A 1LLOA 3H4WA 1LL7A 1DWHM 3SN1A 1QHZA 4QM1A 4DUXA 1LBMA 3U8GA 3IGUA 5G1TA 3EBVA 1JF6A 3RO8A 1I45A 4HMNA 3LXAA 2OOGA 3VIJA 1W9BM 3WQPA 4ZO6A 3FFSA 3TK7A 1P0EA 2FTYA 3PUEA 1SZRA 4JQ2A 3DU0A 1Q6OA 1W3KA 3UR8A 1CLXA 2YDAA 3NFUA 1ADSA 4BR1A 1OG6A 5F1VA 4RE3A 1DXEA 5DX7A 1V6XA 5JU6A 2BMBA 2I9UA 1G94A 3HGJA 1AW2A 1HJWA 1ZQ5A 4GFIA 4MAZA 2VFDA 1KB3A 1CCWB 5K3VA 2X30A 3VKKA 3WLLA 3RMEA 1ZJIA 1QU4A 2BOFX 4G6CA 1HJUA 2WCGA 2PTDA 3CASA 4W4QA 2IXVA 1Z42A 1YXCA 1UKOA 3KCOA 2W66A 1H2JA 3DHFA 4LB4A 5CBIA 1XDJA 5F2IA 5HPCA 4QTGA 4XO6A 5FJUA 4GNJA 4HZ7A 3F1QA 3TEVA 1TWSA 1CT5A 3N04A 3MHFA 3HFTA 3M5VA 3E0IA 4TXEA 1PL9A 4OFCA 3JW7A 4S3BA 2O9TA 1C8QA 2R82A 3CHVA 2YSWA 1ECEA 4IL2A 3QR0A 3K1DA 3WBEA 3DCPA 2VEKA 1ELSA 4GNVA 1GVQA 1NIUA 1U5HA 2J75A 4GO9A 3UQNA 1KFEA 1E1CA 4ENLA 4ZCWA 3W6MA 4DZAA 2I7GA 1J5TA 1X1NA 2XM2A 3L5MA 3GNOA 3LXBA 3IGXA 2G96A 4JTCA 1JZ3A 5EGRA 2DW7A 1FWAC 4UIOA 1UCWA 1IWPA 1XGZA 4KCTA 4KEVA 1PSCA 3B8SA 1MUCA 3NOYA 3LRKA 4OOUA 3VNLA 1PKMA 4RZ4A 1I1XA 3V1PA 4B4FA 3ITXA 1VQTA 3SIZA 4NZCA 1J0IA 3GHTA 2EPKX 2YZRA 4LY4A 3WNLA 2E77A 1MSSA 3CTLA 4RDZA 1TR9A 1OFPA 3BLPX 1FCQA 2XG9A 1D8CA 3RF9A 3MJYA 1TB3A 1EX5A 2YB4A 4LUSB 3CAWA 4GINA 4J5NA 3EWXA 1NFGA 2PRLA 3VNJA 1HP5A 2BGNE 2XIJA 3NDYA 2RKXA 3GRIA 1C90A 2NWSA 4WDWA 1RCQA 5FACA 5AC4A 1UZHA 1KCLA 4DJEA 4EPBC 4RDWA 2FZ9A 2VGBA 3BCDA 5G1YA 1AZ2A 1M65A 3F4CA 3M43A 2HISA 2A2IA 4HSHA 5A2CA 2XUCA 1HJXA 1HT6A 2QCCA 4FHAA 2TPSA 4MUZA 3DFOA 1ZAJA 3GE7A 3QTPA 2ZDSA 3FVDA 1AA1B 3LEPA 1XIJA 1XH0A 4UUIA 1FCVA 2J6XA 1Y65A 4JY9A 4ONVA 1IF2A 3TOPA 1TTJA 3U7BA 4S23A 1H0IA 1V0KA 2QKFA 3M6DA 1FKWA 2OTDA 3MO4A 1TR1A 1EZ2A 4IG2B 3U2EA 3U4AA 3MO7A 3EMQA 3JUGA 5CQ1A 2CZFA 4DO7A 1AJZA 1F8MA 4UFKA 4GKLA 5EPDA 4GUHA 4KFPA 3W4RA 2OQYA 1UQZA 3URNA 4CN1A 1K6WA 5LNUA 4GZEA 1OF8A 3WF0A 4P7RA 1WXYA 4DWDA 1ZJBA 3UJ2A 2AKZA 2J8FA 3QZAA 2ZUMA 3HQ1A 1QT1A 3M0YA 4O8AA 1S2TA 2Z2BA 5A6JA 1E1FA 4JD4A 1G6CA 2FZMA 1H60A 4PTDA 1UWQA 3PJUA 1I75A 5HR7A 1A5SA 4G2DA 4KT2A 4B91A 1SW7A 2RDWA 2CZ5A 1OX5A 1EJRC 1S39A 5A5WA 3PBYA 1XDMA 3NQ7A 4U3CA 3AYVA 3ZMRA 3Q67A 3GVRA 1E70M 3NZ1A 3HMJG 1XIBA 1R5YA 2X09A 4NNCA 2E6FA 4G56A 3OW1A 1H7PA 1CI1A 4AZGA 2BY2A 1JXKA 3RHGA 3IV3A 1VFMA 2IKIA 2J7FA 3VDAA 4MLJA 2BB0A 2DQWA 3VINA 5D9NA 4CCDA 3L21A 4F0RA 4FK9A 1KM5A 3M5ZA 3W84A 1MFVA 2RDXA 1XBVA 1YBQB 4WLCA 3UG4A 3GXIA 1PEZA 2Z24A 3P3BA 1C3FA 1V6TA 2HBVA 2DZBA 3DHUA 2FQIA 3T0AA 4IGSA 2GDUA 5FJOA 2YB1A 1AW5A 3IIXA 3CLMA 1LT7A 4TMBA 4C65A 2IKGA 2E1DA 2QJJA 1TV3A 3BJTA 1NOFA 4DBWA 2G3IA 4I90A 1QNOA 3C4UA 3SSZA 3MC5A 1A5AA 1BEUA 3JR2A 4WXZA 1P5BA 2O55A 1JDFA 3H2MA 4PCSA 1YPXA 3M5XA 4ICCX 4GUFA 4JQ1A 3SSJA 1KBJA 2J66A 2RGMA 3WNOA 2VR5A 2VKZG 5T8GA 4KS0A 1FFRA 1A3XA 1BD0A 3T6CA 2OCZA 3CZKA 1U1HA 3RRAA 1ZLPA 3UWZA 1T41A 1ML1A 2C0HA 1K8YA 1JPHA 3DEQA 4H04A 3BQ6A 4JTFA 2ZA3A 3WLRA 1UKTA 2P0IA 4AB4A 1BSLA 3H12A 2V63A 3VMPA 1UR9A 3S42A 1UBPC 3V0UA 5AFDA 1CIUA 3RMJA 1WDPA 2QMKA 2PWFA 2EG7A 2AAMA 2ZKMX 3D0CA 3IK2A 3QHMA 4X3ZA 1YW1A 3GC4A 4NZFA 4R85A 3S6OA 2YX0A 1GOKA 4U2YA 3P74A 1TTIA 1TVNA 3SW6A 3V5FA 1EOKA 4D8LA 4PL2A 5LIXX 1HJQA 4A8RA 3B0UX 4ZBCA 2YGYA 4KWOA 4PMOA 3PANA 2WNZA 3UBPC 3ZWTA 2WSPA 3QOMA 2FMOA 2ZUTA 2BLEA 4JY8A 1YYAA 2ACRA 3EOLA 3GXTA 3AISA 1DJQA 3DXIA 3E96A 2GSJA 1B30A 2GJLA 3MB9A 1KC7A 2J62A 1IXOA 1DBTA 1CXEA 3LPPA 1IXQA 3MVIA 3RRXA 5BWAA 2DH3A 5DELA 2C91A 1UKPA 1H41A 2XGZA 3WCZA 3A5VA 1CXLA 4Q6XA 2ZDRA 3C8FA 4YWIA 1ZS2A 3S6TA 4LNYA 3DI1A 3BW4A 2OX4A 4WDTA 4P7QA 3M0XA 2OELA 4P7LA 1DV7A 3WJXA 5KZ6A 3B97A 4BFAA 1J01A 3WQFA 1XSIA 4H6RA 2EKCA 2HZGA 2HVOA 4PMDA 3TOYA 3CZLA 4DI9A 4O13A 2ZVIA 4S3CA 1POJA 1Q6LA 4PFMA 5K9CA 2WNWA 2D1ZA 1GW9A 3MKVA 4UCGA 1R46A 1NDVA 4A8NA 4JTLA 1Q6FA 4JYDA 1GKQA 3AAMA 3BJFA 4RKAA 4NNBA 2ZOXA 3N6HA 4V1YA 3W7GA 3IRDA 3LCFA 1R7OA 4NASA 2QDEA 1EXBA 2CBUA 3RM8A 4PZVA 4JTDA 3S47A 3QLLA 5EKYA 4YIWA 3STGA 3TFXA 2FHBA 4DJFA 1B3OA 1VRDA 4IX2A 4KIEA 1MXDA 5CBJA 3NO1A 4IF2A 1DQXA 2WNQA 3OG3A 3W7OA 5FIPA 1ITUA 4WD0A 4OBRA 2IUZA 5AB3A 5U7SA 5G2IA 3IANA 2A3HA 1E0VA 3DZ1A 4MUPA 4MKNA 5HULA 4IM4A 1KD0A 4I7VA 3SN0A 4L6DA 5AN7A 2YA1A 3PP7A 2NWRA 2V38A 3VOCA 4UMBA 1UPMB 3H2OA 3LCIA 2FZBA 4WOZA 3LTYA 3HURA 3F2BA 4RPPA 3GVGA 4ZGYA 2WM1A 3G24A 1BYBA 5GNYA 1MQRA 2POZA 1LOQA 4GH1A 5REQB 3RCYA 1HKVA 2D2GA 3TV8A 2DH2A 4MIMA 4QQUA 2XIQA 4I5XA 1OVDA 3S5ZA 5KEZA 1PAMA 1H51A 3GYEA 1XX1A 4CU8A 2AMGA 4G9PA 3WYZA 4GVFA 1B4EA 5DBUA 3ZLFA 1DYSA 1A5NC 1FDYA 2SFPA 2CFFA 3LBOA 2QIIA 4K37A 3LM7A 4NY2A 5KZDA 1JGIA 3QGVA 2EPOA 4B5WA 1MNSA 5C9WA 4IUOA 4UZSA 1QRQA 5AZ1A 4BKNA 2YL5A 2A3EA 2E3ZA 5G2WA 1IWAA 5FF7A 3CV6A 4XV0A 4GIRA 2PB1A 1K8CA 3TA6A 4Z1BA 1GHSA 3R12A 4GIEA 1VFLA 3UPBA 1E40A 1TA3A 2DZSA 3VUSA 3ONCA 1VH7A 1MWOA 3W9ZA 1P6CA 4I7UA 4QROA 2O9PA 1S5TA 3OBAA 3C8NA 3BLKA 3F4DA 3V3WA 3LHYA 3TW6A 4XAZA 4MF4A 4AY8A 5CAHA 4LTSA 4UTFA 5F2MA 3R8HA 3UG8A 4FNRA 5BOFA 3N6JA 3TQKA 1F4AA 3RCNA 2TSYA 3GWQA 4LC6A 2C7FA 1GZJA 4GCAA 3UVAA 1MVYA 1Z9AA 4ZOEA 3SGZA 3VC5A 3W02A 2VEIA 4N42A 2PC4A 3EB4A 1W3TA 2WLZA 1JAEA 2CBIA 1I2QA 4ZQMA 1EEPA 4JGDA 2WSRA 4C91A 3O6YX 1N8WA 1YBQA 3VPLA 5CSRA 2FTWA 3S2JA 3NPVA 4AUBA 5E0KA 3H55A 1F5ZA 1I2RA 1UR8A 3GFZA 1JZ5A 1ZAHA 4Z0SA 1TPFA 4MJZA 1Z69A 1FP8A 4JQ3A 2XWEA 3W7EA 4H7VA 1EPXA 1NDWA 1WE5A 1O12A 3CHDA 3LMZA 1E4MM 3B0YA 2P5NA 1EF3A 1IIHA 3FIGA 1A50A 4O28A 1YKWA 1NFPA 2QCGA 1E55A 3WQDA 2FKPA 2BODX 1K7EA 2HJPA 2WMHA 3LHVA 1VBHA 4YMZA 1CGWA 4XD3A 5DMLA 4QGCA 3AROA 4C6KA 4DVOA 4I7WA 4PH6A 1XIMA 3QKEA 1UUQA 1LYXA 4K68A 5HDRA 3PZVA 2Z28A 1CNVA 3QLDA 4J2PA 2WM0A 1M7XA 2WKGA 2Y63A 3PWIA 2XU2A 1YDVA 3P2VA 3BLFA 2GSHA 2ZXDA 3E2QA 4N02A 1Q6CA 3TYBA 1S2CA 4QR6A 3IIPA 1EYWA 1Q6GA 2QT3A 2YW4A 4C7FA 4M6PA 4QG9A 4HA4A 4F3HA 1KV5A 4JTJA 4CN6A 3G8RA 2ZBTA 4ZO8A 4GYJA 4FF5A 3C0JA 4LVDA 1NP2A 3EDDA 1GUVA 2DY3A 1UG6A 2Y6ZA 3UP8A 4C6MA 2XISA 1US3A 1GYLA 2J7HA 4KPLA 1RVGA 2XFYA 3UJRA 1WPCA 3MUXA 3W29A 1YHTA 3WJSA 1XV8A 4XZWA 3PZOA 4UFMA 3H6OA 3E5PA 3LGDA 3GG1A 3MDWA 1UD3A 3PUOA 1OYAA 2EEXA 4UR8A 1JCLA 4Y6GA 3P5YA 2OZTA 2E8YA 3PZTA 3DKJA 1KFLA 2XZ9A 3CU2A 1D3GA 2ISSA 4TO8A 1O60A 4Z2GA 3I7SA 4OWGA 2QUTA 1L8PA 4LALA 2WYSA 4H7ZA 4ATWA 4L9ZA 1E9YB 2HWGA 5HWNA 3LU2A 2O0TA 2Y7FA 5JUVA 3ERPA 2YYTA 7REQB 1Q45A 1TVPA 4UTJA 3IVUA 4F79A 4NQ1A 2ALRA 3KRSA 3NPUA 5AVNA 4PB4A 4LEQA 3B0XA 4GX9A 2FFCA 1XL9A 4C1NB 3AXMA 2W0UA 2VL4A 4A3UA 4B90A 3BQ5A 2DVUA 3AMDA 1W5OA 2CZDA 3KL0A 2WK2A 1C91A 2E1WA 3CTTA 3TYCA 4NXSA 3DHPA 2VC6A 4BEUA 2ZZ4A 4M29A 3EDFA 4GVHA 4C6EA 2Z26A 1EL3A 4NJIA 3SAZA 2V68A 1XFBA 4IXHA 3UPMA 3KTXA 4IPIA 1KCZA 4L56A 2FB2A 2NX1A 1FOBA 1PJ9A 1Q65A 2ATMA 1W1YA 3MP4A 1UWUA 1TJRA 4K7VA 5I3GA 2BXZA 2YW3A 2GUBA 4PBFA 1L6FA 4HSOA 3W38A 4ROPA 1FH8A 3W3OA 3FA3A 3H26A 2J7CA 3W53A 5AC5A 4L64A 1PKLA 1FA2A 2IPWA 5HA7A 2NUXA 1GQJA 3LLDA 1HKKA 1W5MA 3BLOA 1KKOA 4LS0A 1KM3A 2P3ZA 4NYUA 1GTHA 1W32A 3GNRA 4DUOA 3CGTA 2WLYA 2PUZA 1FCBA 3RK8A 3OODA 2F2HA 4WDUA 1E56A 2CNCA 1B9BA 4US6A 1E9IA 1W3IA 1UASA 4F0LA 1AZ1A 4DJDA 1M01A 4ECLA 1ENUA 4XZIA 5H8MA 3NSXA 2YR1A 3W1RA 1QNQA 3UT0A 4PCNA 4AD4A 3KRZA 4Y9AA 4ZQOA 5REQA 2EPMX 3H2FA 2R8WA 4X9SA 3ZT7A 5HMFA 3NDOA 1XPYA 3UZWA 1C8VA 3WLIA 1OD8A 1XINA 4FS9A 2VFFA 1VEPA 3WL1A 5GNXA 6XIMA 1DXFA 1XCXA 5HXMA 1GKPA 1XXXA 3MANA 3FX4A 4F0KA 1TV8A 3DAQA 2YLLA 4L5ZA 5I03A 5DY3A 4ZVJA 4JIHA 3MZ2A 2FYMA 4UZUA 1BKHA 3VI2A 3BLEA 2AQOA 2WJFA 4Q22A 1F6PA 1QI0A 4OIFA 3WQ5A 2WVTA 2PFHA 1B1YA 3V5OA 1IWBA 2W9MA 1CDGA 3LGGA 4KRTA 3EKZA 4J7RA 2FPTA 1W5QA 1K6AA 1GOWA 5XIAA 2AQWA 4R3UA 3CEUA 1P6BA 1QPOA 4ERAA 4OTKA 2WPGA 1EHNA 3U9IA 3BLLA 3FS2A 1H09A 3OGVA 1RALA 2V8ZA 3CL8A 1T6MA 4DY1A 2OLSA 2E7FA 2QCLA 3DFHA 1W17A 2DUAA 4GACA 2P53A 3AICA 5FEPA 5T26A 3SURA 4AZ6A 3I6EA 3H4GA 3VD4A 4HTBA 1ZALA 5H6HA 3KOWA 4AISA 2I1OA 2IPJA 4P8VA 3KZPA 3CYJA 5A1AA 2VFIA 1FCUA 3N2CA 4W7WA 1WDWA 4RX0A 1FWHC 2VYOA 1W9UA 4U5IA 4DJED 1W3HA 3MKKA 1OJXA 1JG9A 2CZEA 1KGXA 3K46A 1QBBA 3P80A 3QYSA 4EAYA 5D04C 3MV11 5C7HA 3LHUA 4AHPA 2I9EA 4YS1A 3LK6A 1G1YA 2F8QA 2WSYA 2HNHA 3QMSA 2E9MA 4IXXA 3UA4A 2QCHA 4FOKA 4UNLA 3VC6A 3NO3A 3RX4A 4PTWA 1M7OA 1JCXA 3OU8A 3W7KA 1P0NA 2JBMA 4TR9A 2CU0A 3SDOA 2CESA 4RE2A 4NILA 5A6SA 2QYGA 3GXDA 2CETA 1A4MA 3VD3A 4U10A 3WLSA 2ZRZA 4GC4A 3UG3A 5D2XA 5GJMA 3QM3A 2J47A 2QAPA 1W9PA 1RD6A 3RU6A 5AKQA 4P61A 1J0HA 3WLKX 1SSDA 2OMAA 3MWCA 1YXDA 2WJDA 4HBKA 1JPIA 3ZR6A 1M04A 4HNUA 3IARA 2ZUUA 2DP3A 4AVFA 2GL5A 1K02A 1XP3A 1Y5XA 1RJQA 4DB7A 4F9JA 3AXXA 4AY1A 4E4FA 3P0XA 3G1SA 3AS0A 4GLEA 1Q4WA 2DT1A 1PZ2A 1KFWA 4DAFA 4TX9A 5BMWA 4W89A 2OGJA 3C61A 4XKYB 1V51A 4GUIA 3VDGA 1O4UA 2A7PA 2FDSA 1V7AA 3FSTA 1ICSA 2GQ8A 2Z6JA 2B4GA 3WFZA 4URIA 3U2OA 4UTTA 2HPMA 1AL7A 1WOBA 4CKQA 1WX0A 3L2IA 3O16A 3C86A 4ML9A 1SUXA 2HRWA 4YLWA 1OT2A 4FXFA 4TX6A 3THUA 4IMAA 3VU2A 3GAKA 5DRCA 1OFBA 1JGMA 3T2PA 2B81A 4R7OA 4FLOA 3RLHA 4S3AA 3PUDA 5HWJA 4QS6A 2PBGA 4G7FA 1WA3A 5A6KA 3GD6A 1HKJA 1JIBA 3TCSA 1UWTA 4JX5A 1KA9F 3BAYA 3GDLA 3BSHA 4ZB2A 1S46A 3PJWA 2CLMA 1XKYA 3BAXA 4KCVA 1JCMP 3QHNA 4DWSC 2QEZA 4BA0A 3PY2A 4GYPC 5IBXA 1V3MA 3WD3A 1GVEA 3BG9A 3T81A 2DZVA 1PB0A 4DYEA 4GMEA 4XBSA 2QV5A 3ITGA 3TJLA 3VAVA 3BDKA 2CLIA 3QV9A 4BF9A 1GQKA 1LQ0A 1GK8A 4GGHA 4QDMA 2Q01A 3VKDA 4RNIA 4GO8A 3NNTA 2FGZA 3NJ3A 4PFHA 1X38A 4HN8A 5LNRA 1F3WA 1SO6A 4WY0B 2BWGA 4DZIA 4DO6A 1XRTA 1I60A 1V77A 2WHKA 3GZAA 1ONXA 4GFSA 7REQA 1NOWA 1SO4A 3T42A 4RUBA 4PMJA 2DGAA 3RX3A 3KBVA 2UZ9A 1CB7B 3DC0A 4JEJA 2ICSA 3KVJA 4HHPA 3LD5A 1DORA 1NQ6A 2B31A 5E09A 4QRNA 1XCWA 2FVKA 1UHVA 1UJQA 4EPKA 6REQB 1GZ1A 1VJSA 2PRHA 4AZBA 3QV8A 4CCEA 1JFHA 2P88A 3B04A 5G4EA 3APTA 3W24A 3IPWA 5C7VA 2X40A 1J79A 1TJPA 6ALDA 4PMVA 1SFTA 4B92A 2D69A 2I57A 4LX4A 1BWVA 4REQB 1XRSA 2ODOA 3UERA 1YQ2A 5D38A 3VIHA 4XZHA 4ZFCA 5AC7A 1Z89A 2UY3A 1JZ6A 4UTIA 4HKPA 5AYYA 2ANUA 3QR3A 1UBSA 2REQB 5HMEA 5EFDA 3LPFA 1GVOA 3WFAA 1Q6QA 4UFLA 5B7ZA 4UCFA 3NXFA 4C6IA 1DIEA 2OEJA 3H21A 1PPIA 4JIIX 3AWNA 2VZVA 4OOZA 1QHOA 1W8SA 1CGYA 4QNWA 1O1ZA 3DN5A 3A4WA 5LIWX 4Z42C 2GSEA 2PTYA 5F1UA 2IQDA 5A8PA 3HQOA 1VKFA 1EWEA 3W2UA 5I00A 1JD7A 3MA8A 1HQTA 5I78A 1D7KA 2Y5EA 3L4VA 4Y9MA 3C2OA 1V79A 3LENA 2GVJA 3H7VA 4HGXA 4W88A 1NU5A 2VCAA 4A6GA 1QPKA 5BXPA 3AU6A 4H7CA 2Y5JA 1QOXA 1J12A 2QJGA 3NPXA 1KFKA 3L67A 1JCNA 3WEOA 4L61A 1PUDA 3RCMA 1TIMA 3A4AA 4Z08A 3WDIA 3PTMA 1V6WA 4ACYA 3WQOA 1UH3A 3EPNA 4D6EA 1XM3A 4AVNA 3F2CA 2JGQA 3USBA 5CZTA 3BGGA 4LAZA 5JBEA 3W85A 3ALGA 3TE9A 2PDYA 2W4XA 4H2CA 4AHOA 1MDRA 1MRQA 2XSXA 1DJYA 3APGA 4AYSA 5HANA 3OBKA 4JR5A 1R47A 3GSMA 2BV9A 3R89A 3MBFA 4BS0A 3ALFA 5TBOA 4HQVA 1UWAA 3R10A 5FJTA 4DX3A 3L0KA 3T4WA 7A3HA 1JF5A 3QEZA 1GVRA 2J27A 3ARWA 3AC0A 4Y90A 3H2CA 3OGRA 3EX2A 5TQLA 1OC7A 1OG0A 1LLWA 3C2FA 3VMOA 2YYUA 2F6KA 2V81A 3TW9A 1BXBA 3UU0A 4MGGA 3N1AA 4QS5A 3CAVA 4YVXA 4EPEC 1F2JA 3GAYA 4IUGA 1G4TA 3QV6A 2A3LA 3C2RA 3QF0A 4IP7A 4NUWA 3W72A 2BGSA 3W07A 5CXPA 2DPEA 5E6YA 4DJFD 3FA5A 4ZSUA 5F2LA 4AWTA 4JHZA 3W7DA 2ZX8A 3PBVA 2G41A 2Z2UA 2GGJA 4W86A 2DEPA 2JALA 3PZGA 1VRXA 1GQNA 4C6JA 3O07A 2CWXA 3WUFA 8RUCA 2PDPA 3N73A 1LF1A 1CWYA 5C9ZA 3EA3A 1XUUA 2HEJA 4DJEC 5A8GA 4L4MA 1HL2A 3F5JA 1MW1A 1A53A 4YJ5A 3OTRA 4FI4A 1MEIA 4RL3A 3KWXA 3ABZA 4IGHA 1KGUA 4H8VA 3G1YA 1SW3A 1NWUA 2IW0A 4MFDA 3W23A 3VZXA 4W5ZA 5IFTA 8XIAA 1UWSA 2FGBA 4LUIA 4W93A 3HPZA 3H2AA 1KM4A 1PWMA 5CPMA 4DXVA 3WQ8A 3E6EA 4NJKA 1TWZA 3SR7A 1TV2A 4NAFA 5I06A 3TR9A 1VF8A 3MV01 1K3UA 1BQCA 1KXHA 4E8DA 1KLYA 1FWJC 4C5ZA 2J79A 3PJTA 4F0HA 3PBGA 5CJMA 3T44A 7TAAA 1H3GA 3B8WA 3IJ7A 1J8VA 4JBRA 1FX6A 1WZAA 4EVZA 1VYPX 4WJEA 3AS1A 2PRMA 2FZNA 4PBEA 1GOIA 1J0JA 1BRLB 1ME7A 1QO2A 2J9XA 4D71A 3ZQ9A 2V0TA 1UMYA 4YL2A 3EGJA 1PCKA 4B16A 4QCEA 4ZOBA 3GH7A 4FNPA 4H2HA 1OINA 5ABGA 5FL1A 1H49A 2PDWA 4NF7A 3NYZA 2NT1A 4XKYA 1VYRA 4NI8A 4ZXLA 2ZZ3A 1X98A 5CPSA 2X16A 1M5WA 1HL9A 5LNVA 5DY2A 5TNVA 1XS2A 4NZ3A 1B4KA 1LBFA 2W63A 4PMZA 3W76A 3NSNA 3HZ3A 1NWRA 3BXWA 4H6EA 2B7OA 2PDQA 1ISYA 2NZLA 3VIFA 4OV4A 3LCXA 3IUDA 3WDQA 2Z1XA 1K8XA 4JKMA 1PDZA 1BVZA 1C29A 4Q8QA 4O0ZA 2Q02A 3OHIA 4QLJA 3WBAA 2YXOA 2EKGA 1FWCC 3BC9A 3WMLA 4JTEA 2BG5A 3WQWA 1W5PA 2ZRWA 2PCQA 3U3HA 1W9DM 3HBLA 1RK6A 2Z1SA 4WKHA 5D02A 4KKXA 3H53A 1KFJA 4XG1A 2XVPA 4J3SA 3NPWA 1DJHA 3RYSA 4ML4A 3N4FA 1QJWA 2D20A 1QNRA 2X7VA 3FAWA 3OG2A 3BGAA 4RLIA 2BY1A 2GGHA 2R1KA 2VQTA 2WB5A 3CBWA 4W7UA 1E6XM 4LW7A 5F2GA 4BWLA 5LKYA 2C16A 2OYMA 2ISWA 1QXLA 1J9YA 3EWUA 5I24A 1A3WA 4IHCA 2W67A 3FJLA 2V2DA 4I9AA 4WY0A 3M4HA 3JZEA 3H24A 1ZPTA 4GBDA 1OIFA 4QAWA 1QFEA 5F4WA 1QASA 1EZWA 1H7OA 4ICMA 1DQUA 3MT1A 1DQWA 4YNGA 1E3XA 3SB0A 4E2OA 4PMUA 3UNDA 4V27A 1UQYA 1TTQA 4U28A 2V5JA 5IOBA 3W7CA 4JKKA 1K03A 4DIAA 1S1PA 4IISA 4FB7A 2HVMA 3RU8X 3NCOA 1EJWC 3H2NA 2X0SA 1KWKA 1GVSA 2GUUA 3TROA 1IE7C 1KM6A 3FDKA 2Q3OA 4XD6A 4OQVA 1OIMA 3QHOA 1IV8A 1TZ7A 4GJ1A 4YHGA 1OFQA 3W37A 1MMFA 2Y70A 1JYNA 2PS2A 3RDKA 5J5DA 4ATDA 3GTXA 1E4LA 3OVPA 4DRSA 5FA5A 3P93A 2GOUA 3MUIA 4LSBA 1EP2A 3ZIZA 3E2VA 5BW6A 3JS3A 4PCFA 1E3ZA 4REQA 3QN3A 4L1GA 2Y4SA 1OFRA 4CU7A 1GJPA 3EDKA 1QI2A 3WQ4A 1N7KA 1J0KA 3OP2A 5HMSA 4S3FA 3W1LA 4G8TA 4M7SA 4AIOA 2PD5A 3RJXA 3N14A 3L7RA 2PP0A 1XIFA 3U4FA 2WC7A 4JHOA 2ZQ0A 1PZ1A 4MAVA 3H54A 4I9MA 1FWTA 1G69A 3RXZA 4JTKA 1AVAA 4HNNA 3WQVA 1IT7A 2QJNA 1MEHA 1OX6A 1RY0A 1KTCA 4QX4A 5AHLA 3CIVA 4NX0A 3NGJA 1UZDA 4FP1A 2ZXBA 1RBAA 5D03A 2C13A 2F9RA 2VM8A 2YCKX 3CIXA 2XN2A 3OOQA 3DBPA 4TIMA 4RXFA 1W1TA 2E40A 3DBNA 1G7VA 1KCKA 3WD1A 1SO3A 3AXIA 5TAOA 4GABA 2FH8A 5CPNA 2CXGA 1B3ZA 2E5DA 4NYYA 1FDZA 3GB6A 1TPDA 1MUWA 1VB9A 5JQ9A 1ZU8A 3QW4B 3EYPA 4E4UA 1WBJA 3UWEA 2E68A 2YBTA 2GWGA 3MWAA 3L5AA 1VFFA 1O1HA 3G1HA 5ABFB 5DF0A 2EPNA 2Y88A 4ZQPA 3QY7A 1ITCA 2VEFA 4P8XA 1YNPA 4WVXA 4XD4A 4U33A 2GOKA 2V6AA 4WOQA 2VRKA 4IMCA 3PB0A 1JUBA 3RM9A 3BMXA 1XLFA 3D47A 3QGKC 1JQVA 4UQCA 1UR1A 2D2JA 3PBWA 2XWDA 5D8ZA 1UIOA 2VD9A 4JFUA 3O0KA 4R9OA 4V15A 4GQRA 3AU2A 2QV4A 1Q66A 3H8AA 5AHIA 3W1QA 5HJYA 2XFWA 1F8IA 3MP3A 3BICA 4O0QA 4WXYA 4AXKA 3SFWA 2BX7A 4UNKA 3PF3A 3IJ8A 3URQA 2GJRA 4WZHA 2OR2A 2GVYA 1U22A 1CBGA 1I1WA 4CQ9A 1H4PA 4QSHA 1XG4A 2QDGA 3EMCA 3M47A 2WC3A 1EA9C 3SIMA 1CXHA 4DJFC 4LVFA 2DSZA 1E15A 1XIEA 2V3DA 1KR1A 1VD6A 2ACUA 1EA0A 1BYDA 4QP0A 4GC3A 3AUJA 5I7GA 1EB3A 2Y7DA 2VZOA 3VX0A 4DWSB 3WD2A 4C6FA 3ZXWA 4E2DA 3JRKA 2ZE3A 3O15A 4GCXA 4B5NA 3LCLA 2WV8A 2QCMA 3KBJA 4MTVA 4YTTA 4WGHA 3PC0A 4UOJA 1TO3A 4KESA 4DJDD 5CBBA 2R1MA 1F3TA 3LZ5A 3VCRA 2D2HA 3CWOX 1Y8BA 3K8LA 3TN4A 5CPTA 3VKAA 1JYXA 3EWDA 4XTDA 2OGYA 1HGWA 3A22A 1HJVA 2V5KA 3S83A 3T40A 1UP0A 4AW7A 1OB0A 3C2EA 4D8AA 3TFCA 1H7RA 3BK0A 1EC8A 3L4UA 1S2WA 1VFTA 1ZY9A 1PIGA 3RIKA 5IDIA 2C1GA 1EDTA 4CQ8A 2WZTA 2B0MA 3GVQA 5DCBA 5HPOA 3F2DA 2V2HA 1LWHA 5FSDC 3G6MA 5H8UA 3W2KA 3G2GA 3KX6A 5TD4A 3OEXA 2PDJA 2FLIA 1OCNA 4M19A 1UIPA 3KDNA 3W6YA 4DNHA 1BRLA 2G95A 2PBOA 1YLVA 3AHYA 3LQLA 4O11A 1P0KA 5FJIA 3MVTA 1IEQA 5JXQA 3TQVA 3FSUA 2V3FA 2YFOA 3EXSA 3FVMA 3TTEA 2O9OA 1CZ1A 5HATA 1HKWA 3B8DA 1AH4A 4IQLA 2JKEA 1R86A 1R0MA 4OV9A 2PGRA 3ARSA 1B54A 2C0AA 4JX4A 4JL2A 4EK7A 3MZNA 3WLJA 5J04A 1DVJA 4ORMA 4DPPA 4N0RA 1WXJA 4S39A 3CL6A 5BXRA 1WZMA 1CXKA 3EEGA 1F3XA 4UQ9A 1XR2A 2QLYA 3ZOAA 4IICA 5CPQA 4GQ0A 2E6YA 1DIKA 1TMLA 3PPHA 1C8XA 3N12A 2BTMA 4M81A 2V5BA 5G1MA 3L4XA 1JYVA 2P1FA 4PC8A 1EC9A 1FUYA 1A49A 4HPNA 3CHFA 4O12A 5I3HA 1V0MA 8A3HA 5EMKA 3O6AA 2XM1A 1YEYA 2Q8LA 3OZYA 4IIGA 4BQ3A 1A80A 2BXYA 2MANA 4GIYA 5DFAA 1P4CA 1Q2SA 1V5XA 2PODA 2QHAA 5T9BG 4Q4RA 3SCRA 3G18A 3SRDA 1AJ0A 1RV8A 2P0OA 4G7EB 2GGEA 1ZBWA 2J9ZA 1AFSA 3EXRA 3UCQA 2Q8ZA 4QFUA 2ZX6A 1U5VA 2B7NA 3B06A 1IEIA 4Y7EA 1Q6RA 4GXPA 4HA1A 5FJJA 2DT3A 1EGZA 5AOUA 2CYGA 3WH7A 5HQEA 3CO4A 3N2OA 1N55A 5AHMA 3F4WA 3A12A 3ANYA 3SCQA 1CPUA 2DZXA 1VBRA 4OBSA 4M6VA 5CC3A 4M24A 1DWIM 2VFEA 2OSWA 3SJ3A 2Y85A 1LT8A 2UV8G 2PGEA 2YXGA 1LORA 5XINA 4HK7A 1AQ0A 4QEEA 3ZS4A 1RHCA 5CPOA 3UXLA 3HMCA 4OE7A 3PJXA 3QYQA 2X41A 3TZNA 3MPGA 2RAGA 4OVXA 3PUGA 2GDVA 3NQBA 1Z41A 4LBUA 3UESA 3M0ZA 4LCRA 4W87A 2WZHA 2A79A 4BJHA 1SJCA 1OZMA 2OXNA 3QC3A 2I5GA 4WKFA 3PWAA 1UMLA 3ARRA 1VEOA 4WSHA 4R27A 3AZRA 2J6VA 1UWRA 4Q4MA 2PP3A 3AWOA 2UY2A 5HK4A 3PZIA 2XN1A 3GKFA 2I5IA 1J6PA 2V9DA 5AYXA 3P8IA 3GW3A 1ONRA 1QOPA 4L4PA 3JU2A 1ZNNA 2Y62A 4RR4A 3LRLA 4HNLA 4JNMA 4FLQA 4MM1A 1A5UA 2X8RA 4DXXA 1ISXA 1OCJA 2POTA 3A9IA 4XB3A 5IDZA 5B7YA 3N2TA 3IIVA 3RAOA 4XO7A 1YPIA 2JKPA 1EP3A 4UTHA 1BG4A 1T7LA 2FJKA 3PBMA 1KLZA 3E9AA 3ZR5A 3E02A 2PDIA 3G1VA 4H9TA 3RPDA 2C79A 4K7YA 4HT3A 1Q13A 1XLJA 3UWYA 1RVKA 4MB5A 1BYCA 2CEQA 3B9OA 4LBSA 1MW2A 4J3UA 4E3VA 5LHEA 4PSRA 2G4JA 5CC7A 2JEPA 3GBEA 4JTAA 4CEUC 4HCDA 4AZ5A 4UFHA 5CSYA 2FVMA 3N9RA 2X1RA 3WQGA 4M82A 5BWFA 5BU6A 4HPXA 5M17A 5T9CE 1UB3A 4N6FA 2XSBA 5EB8A 2J74A 4HNTA 3ENLA 4FO4A 3W2NA 2ON3A 1TKKA 4HIBA 2XGBA 1VLWA 1W9XA 3M0LA 1WB0A 2W5FA 3IEBA 4IIDA 3WF2A 2H9AA 3AYSA 2MNRA 1FXQA 4NKCA 2ZRUA 1ZL1A 1CECA 2HPIA 3A64A 2PU1A 1XC4A 3CAKA 4OZOA 5CJNA 4I8YA 1BPLB 2A5HA 1UJPA 2GQ9A 1ZBKA 4O16A 4I8DA 2FZDA 4L4LA 4AC7C 1YX1A 2C71A 3MCNA 4RZ5A 2P8CA 1EP1A 5D2VA 5HQLA 3THQA 4K8HA 2CIPA 3M1ZA 4AU0A 2A3BA 3OIXA 2G3NA 1X7FA 4Y9PA 4FX6M 1REQB 1TPB1 1XIDA 4DWSA 1BYAA 1XGEA 3OHMB 2QNEA 3CV7A 3EPMA 3SBFA 3VD9A 5F4SA 1XISA 4GY7A 3M44A 3BCFA 3NEVA 5C6MA 3EEZA 2R91A 4NZ5A 1LQAA 1TJ1A 1OCQA 5E9AA 4LVAA 5CGTA 4DJDC 4HN4A 4RZBA 5E5CA 3HGSA 1SO5A 3K5XA 1XYMA 3C0LA 3GBDA 3WX7A 4PN2A 4XAYA 4AFYA 3EKLA 3G1AA 2XH7A 1ZGDA 1FVPA 4DUWA 4S1FA 3CEPA 1LL4A 2XDFA 2PTWA 3STFA 1GOMA 5BXTA 3AIVA 3R0DA 3R1ZA 2WW5A 1YIXA 4ERIA 1EJSC 4AIBA 4KEUA 1QNSA 3GU2A 3ITOA 4XIMA 1VYSX 4A3HA 4L65A 3MUCA 3SRKA 4OECA 3J7HA 3W74A 4UMCA 3IGSA 3PPCA 3PSWA 1T40A 4QHRA 3ZWSA 4MDPA 1W2PA 3MSGA 3W22A 2WHLA 2QUUA 4EWND 1EWDA 1K8ZA 3AIBA 2VDIA 1PHWA 3KVMA 2QGHA 5BU9A 4DLFA 1X8FA 3TXVA 4MYXA 4X0VA 3OVGA 3N9KA 3SZ8A 1RZMA 5HJLA 2OSYA 2DZWA 1M53A 3BANA 1LBLA 5CSUA 1RQEA 3A23A 2XYLA 3BAJA 2CCRA 1S2AA 4UTLA 3W2LA 1BQGA 1J0YA 1EYEA 2AQVA 3TWAA 3UCCA 2RH9A 1RJRA 4Z0JA 4CQDA 1VEMA 3SUSA 2XSAA 3CO8A 3GKAA 2V30A 4HMDA 4GIAA 4PA8A 1P1MA 3L4YA 5F4XA 3GH4A 2QJHA 3L4ZA 4TTUA 3OZMA 1OADA 4PRTA 1V93A 4JDYA 3HF3A 3UWUA 3GYCA 3NIYA 4FALA 4AHQA 4K1GA 1KXVA 3TAOA 4C90A 1E6SM 4LYPA 2GK1B 4WR3A 3VDCA 5C2GA 2NXGA 3P81A 4FMVA 4CD5A 2CC0A 4Z1DA 3VM7A 1KRCC 2W6RA 1HGYA 3C52A 4J3TA 5TF0A 2QCDA 1J93A 4D6FA 3WJZA 1DE5A 2PC8A 5A8NA 2HK1A 4NAEA 1LWIA 1PO9A 2O9RA 5LYRA 4HZ6A 2PWGA 1EGMA 4JTGA 4PRRA 3T05A 4PBGA 2QVHA 3D3AA 3VDBA 3MYOA 2VRQA 4Q4KA 2XPKA 5CKSA 1M9HA 3ABQA 2XVNA 4H8HA 1KTBA 1M6JA 5PTDA 4ZXOA 3DIPA 3SCPA 3ARUA 3O6DA 4G7EA 2YPIA 2Y8UA 4U2ZA 3WDPP 1W1VA 4BI7A 3F5KA 3ES7A 4FNQA 2KX9A 3OPSA 4YHEA 5FF2A 3WL0A 7ODCA 3TQ0A 3RR1A 1EQPA 4DQWA 3QOKA 3FJNA 1QMLA 3IV8A 2ABAA 2O4QA 4DPQA 2NQJA 3BSMA 3AQUA 3U48A 2Y61A 2UBPC 4HCHA 2WSKA 2ZUWA 4P8UA 1OHLA 3ZSSA 3VA8A 4AX6A 3WLHA 3IIOA 3W81A 2Z7GA 3GG8A 1DPMA 2O7QA 3BW3A 2ZIDA 3GTHA 4AYGA 1P0DA 4CQBA 4CQAA 5CC6A 4GI4A 1NDYA 1LP6A 3OVRA 4FNUA 4UTTC 3DYMA 4LVBA 2OWCA 4GQBA 1BWKA 3QSRA 1Q7QA 1O94A 1G5AA 2ZA1A 4FAMA 1WAWA 3P82A 2CBJA 3EOOA 3OBEA 3FKKA 3IVTA 3QH2A 4HNCA 1PYFA 4BEQA 1HO1A 3TVAA 3RO6A 3UEQA 1UA7A 4F0MA 2D22A 4ZOAA 1DL3A 3URAA 1H61A 5LGXA 5AHNA 3FHQA 4D6IA 4H9VA 4CNPA 4A21A 2ZUVA 1DHKA 1P43A 4AWSA 4FIRA 1MUMA 5IBXC 1Q4NX 3LUTA 1EGVA 1EEXA 8TIMA 1QW7A 2GVGA 3VDHA 3ABRA 1RP9A 3KS5A 4GKTA 1WO2A 2CERA 3DDMA 3PPFA 1OCBA 4M8UA 1QPQA 1SYTA 4MNMA 4Q4SA 1BGGA 5LXXA 4J2MA 4GA8A 2DSKA 2YOCA 4O50A 3PFMA 2OO0A 3GIPA 4O4VA 2DJXA 3T0DA 5IXEA 4UTWA 1WP6A 3NQ6A 1XBYA 1EDQA 4FA3A 2NLIA 2Y0FA 2V3GA 1IZKA 2D0GA 1BXCA 3LTSA 3D46A 1V03A 1JCYA 3D3FA 5D4YA 1MO0A 3W1PA 4F9DA 4I9TA 3AHZA 2WHJA 4JQ4A 2CLKA 3THDA 1Y7VA 3UJFA 4QBXA 1SMAA 4XUGA 3IIZA 1JI1A 2WBKA 1TA3B 1CTNA 1PE1A 4BCEA 3HA1A 1VBGA 4XK2A 3W1XA 2HV5A 1F74A 3KEHA 2ZX5A 1OQFA 4ICNA 3D6NA 1R2RA 4B15A 2HMCA 1E9ZB 1LG1A 3NG3A 1CW2A 2QULA 1IQ8A 1RR2A 5A6BA 1TWIA 4GXMA 3K13A 4FIQA 4UTUA 4XWUA 4HPGA 1XWYA 1BFNA 1B0IA 1US0A 3LMYA 4P8WA 3VNMA 4LYKA 4JZ5A 4HD5A 4Q8UA 2VDHA 1ISVA 3VOHA 3AALA 4WEVX 3ISIX 1K4HA 3GDKA 2J88A 2TMDA 3CQ0A 3MQTA 1SPQA 3R79A 4MSSA 1X7IA 4EOUA 4JFVA 1RJPA 4KETA 2A3CA 4EPDC 1UZ4A 2BDQA 5CEWA 3AJXA 1VIZA 3MUY1 4FZIA 1B5TA 1WBHA 2XVKA 3FJ4A 3HIJA 1HKIA 1FHDA 3PG8A 1ZTVA 1REQA 1TUXA 1ZZMA 4ZENA 2GGGA 1OGBA 3QQWA 2EPLX 3HM7A 1P7TB 1TRIA 2I56A 4Z2LA 1HUVA 5AECA 4HU0A 4BK9A 3LA4A 3EB2A 1T8XA 3SCWA 4WIWA 3VIMA 3T78A 1XIIA 2CZVA 5H91A 2YFNA 1UPPA 3AIWA 4DYKA 1V6UA 3VABA 2Z1WA 1NEYA 5I23A 2A1YA 1LL6A 4JN6A 2GVLA 1SSGA 3LQGA 3CHCA 1G01A 4Q8MA 4Q4OA 4O1AA 2ZZ1A 2DZPA 3ZVHB 3VFLA 2TAAA 1I0BA 4MMWA 1AMKA 3SM0A 4QIUA 4LT9A 4IQJA 3ARPA 1TPVA 3TSMA 3WJYA 2DU2A 2VZSA 3A4JA 1E73M 3EX6A 1RD5A 2Q6ZA 2XIIA 3V36A 2XH2A 3ECQA 1J4EA 2Z25A 2C15A 3TA9A 2QGYA 2PLCA 3SQSA 2L5HA 3QPYA 1ZJHA 1KM0A 1YE6A 3HV9A 1S38A 4YWSA 5I79A 3EWYA 3NA8A 1B3XA 3BG5A 4NRSA 5LNWA 3CV2A 2FIQA 2J7EA 1K4GA 1JDCA 2QPXA 1FWFC 4N9EA 2VHLA 4LUYA 4CCCA 2OO6A 2IKHA 4U3AA 5LNSA 4DBSA 3CMGA 1SW0A 1D3CA 3L2MA 4E2VA 5MF5A 3VNYA 3B9NA 1HN1A 3PAJA 1ME9A 1EF2A 4CU6A 4RXGA 1JR1A 3WMSA 4PMNA 5HOSA 3ZJ7A 1X96A 4IQEA 3VK5A 3WBXA 3KCJA 3SQMA 4WSKA 1MW3A 4IX0A 3BH4A 2C18A 5DXYA 3M6YA 4XUYA 5D2YA 3GUGA 5E0FA 1WQ5A 3EOUA 4S3KA 2GK1A 3A6OA 2INZA 2FHCA 1GHRA 1WXZA 4EXBA 4HU8A 3M0JA 4OUIA 3AHTA 3I3BA 5A6LA 3WG6A 2HS6A 3QQ1A 3AUOA 1ESWA 4NNAA 4OGZA 1RA0A 2W27A 3MUZ1 3PZQA 1E72M 3UWQA 3C3UA 1XH2A 1VBUA 4M0XA 5CG7A 2H8ZA 3IJIA 2PTXA 3TC3A 3DFNA 3W7QA 3WEMA 3I3DA 1KQYA 3VUPA 4AC1X 2QF7A 3GVVA 4Q32A 3NAVA 4PUEA 5SWUA 4XZLX 4QJ4B 3LDVA 4WRHA 1RUSA 2E09A 4D2JA 2BHZA 1JRBA 3VD5A 3EOEA 2YL6A 3UWVA 3W00A 1OX4A 3VNIA 3Q65A 4MWAD 1WAUA 2DUZA 5LA2A 3LSBA 1U33A 1XBXA 3LBCA 2J8TA 3V7PA 5ECUA 1O5QA 1NM9A 4V28A 3O6CA 3OYZA 3FGCA 4AQLA 2VTFA 1S3TC 1AG1O 2LLEA 1YADA 3GNXA 4PTNA 3K30A 1OD0A 3QSTA 2O4MA 3ITLA 5DMNA 1JUEA 1HO4A 4YTRA 3KBSA 4LAKA 4UQEA 1W54A 3MKCA 3MTWA 2GJPA 2B7QA 3WUBA 1QTWA 1FH9A 1YPFA 4H8NA 4JNZA 2C1IA 1JNEA 3G3MA 5CLWA 1R9YA 3ZT5A 3HG3A 3L68A 4UBPC 4JXCA 3LLFA 4MNKA 4LAMA 4CD8A 3WLPA 1VFOA 4NRRA 3H7RA 4IJBA 3W1MA 4E8CA 2PTZA 3PFRA 4U5KA 3AI0A 4UOQA 3W28A 4ES4A 3T2QA 2JK2A 1LOLA 1X8CA 1OSEA 4GYKA 4QG6A 5KZMA 1FWWA 2X0HA 1UUOA 3CT7A 4AEOA 1RQBA 5I02A 1XFCA 2XHYA 1GKRA 2XGIA 1MRAA 1EX1A 4TTGA 5C9UA 4TUFA 4H3DA 1GONA 3GO2A 1E0XA 1HVQA 1KW1A 4MZYA 5D30A 3QQ0A 1GYMA 3S2CA 3TYDA 4BWLC 1B9ZA 4EACA 2ZICA 2VOTA 1J18A 1HP4A 2QF8A 5LIYX 3QV7A 2Z2AA 2WC4A 3T08A 1EUNA 3A4XA 3T55A 3I4EA 3NQGA 1L2UA 2NQ9A 3UZ5A 3HG4A 3ZT6A 1PIFA 2JQXA 4CUCA 3WO8A 3TU9A 3N6QA 2PWHA 4LV9A 2D24A 1YDOA 1FDJA 2XZ7A 2HSAA 3DI0A 3EX1A 1ZRQA 3HPXA 1R3QA 3B3DA 3WLTA 1U1UA 2A3AA 2WQDA 2NUYA 1PCWA 4GJIA 3GQYA 3LHWA 4C6PA 2F6UA 2PGFA 4Z2IA 5DN1A 4YYFA 3R5EA 1WYIA 4K38A 4D6CA 3OYXA 4ROQA 3NQFA 1SFLA 4HTYA 3S46A 1F6YA 4BF7A 4IJCA 2CHOA 1WKFA 2Y8KA 5CPLA 5A6TC 3EB3A 1PHQA 5ABHA 3UD6A 1R8LA 3SY1A 1R85A 1BHGA 2NQLA 1TREA 1TX0A 2XFFA 4I6VA 4FXJA 3ORWA 3CYVA 3INPA 1FXPA 3O7UA 1WCGA 1XRVA 1MDLA 4PEKA 3B4YA 2OEKA 1YTDA 3IUIA 4O57A 3ZLHA 1XYAA 3RLVA 2G3FA 4HNVA 5LIKX 4AVOA 3UNTA 3UXIA 1S5NA 3WQ6A 1I9CB 4JTUA 1GVIA 4ZSTA 4GGBA 3RR4A 1DWFM 4IQDA 2YL8A 3GS6A 5A6MA 4A4AA 4B2DD 3PS7A 5FEZA 3C5QA 3QVQA 8XIMA 3HPAA 4CNSA 3WLOA 2WZMA 2O7SA 1K7XA 3G1XA 3R2GA 1P7TA 5C70A 1PDYA 3DFPA 1DJIA 3VIIA 1ZP3A 3OLGA 5A8OA 3LTPA 1TPUA 1E71M 4O1DA 5ABTA 1NWTA 1YRRA 3WD0A 3MDUA 4IMDA 1DJWA 4MZ1A 4ADUA 1FHUA 3KRBA 2Y2WA 4M7TA 2HE8A 1YMYA 3FLUA 1IEWA 2ZYFA 4JYEA 4JIPA 4S3GA 3L12A 3L0NA 3MS8A 3CL7A 4AMAA 3W1NA 2CXEA 1W5NA 2EG6A 1NF0A 2J77A 4QLLA 2NUWA 4AD3A 2YIHA 2F84A 3ZVHA 1EUAA 2OEMA 3PK7A 1R3SA 3VZYA 2GQ3A 1K9FA 1Q7ZA 2WMJA 4GX8A 4UB9A 2DV0A 3QKZA 3DENA 2GJNA 3ITCA 2PMQA 4NVTA 3GC5A 4DBDA 4EANA 2BY0A 1GG1A 4H6QA 3VOFA 5FD0A 3R43A