4ERIA

Evidence for a dual role of an active site histidine in alpha-amino-beta-carboxymuconate-epsilon-semialdehyde decarboxylase
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
331
structure length
331
Chain Sequence
KPRIDMHSHFFPRISEQEAAKFDANHAPWLQVSAKGDTGSIMMGKNNFRPVYQALWDPAFRIEEMDAQGVDVQVTCATPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKVLAQVPLQDLDLACKEASRAVAAGHLGIQIGNHLGDKDLDDATLEAFLTHCANEDIPILVHPWDMMGGQRMKKWMLPWLVAMPAETQLAILSLILSGAFERIPKSLKICFGYGGGSFAFLLGRVDNAWRHRDIVREDCPRPPSEYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLGEQKIGGLVLSSNLGESAKDKIISGNASKFFNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence for a Dual Role of an Active Site Histidine in alpha-Amino-beta-Carboxymuconate-epsilon-Semialdehyde Decarboxylase
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
total genus 123
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4eriA00
4NP7A 4AC7C 4QS5A 3GRIA 4ERAA 4C60A 4V1XA 4QSFA 1R9XA 4NI8A 4GXWA 1ITUA 4WGXA 2QS8A 2OQLA 2GZXA 3B0YA 3GIPA 3SFWA 4CQBA 3IACA 1ONWA 1YBQA 2XIOA 4KIRA 4KEUA 4V1YA 1V7AA 2OOFA 4DI8A 3GIQA 3KM8A 4LH8A 3LGGA 3LSBA 3V7PA 1JGMA 2D2JA 3B0XA 4LCSA 1EJXC 4C6QA 2ICSA 4ICMA 2FTWA 4QRNA 4H9MA 2KAUC 3TN6A 2VUNA 3BE7A 3CJPA 1R9ZA 1EJWC 3LY0A 3IGHX 4GY7A 1A4MA 1K6WA 4LEFA 5FSDC 1YBQB 5G4HC 3IRSA 1DPMA 2R1MA 2YB4A 3URQA 4E3TA 4KF1A 1NFGA 4R85A 3F4DA 1UBPC 2VR2A 3K4WA 4GOAA 4IGMA 1V51A 2EG8A 4RDYA 3NURA 2W9MA 1RA0A 2I9UA 4KETA 2PGFA 2PGRA 3PNZA 1ZZMA 1A4LA 1YRRA 4G7EB 4GZ7A 2UBPC 2YXOA 4LCRA 4J5NA 4PBEA 4H9VA 4F0LA 4DLMA 1HZYA 1RA5A 2EG6A 3N2CA 3F2DA 3QGKC 4AQLA 3PBMA 3E0LA 4GX9A 3RN6A 4D8LA 3IARA 3MVIA 4M51A 2WJFA 4NG3A 3LGDA 2AQOA 3D6NA 2VM8A 4GC3A 2E25A 4C6PA 2WM1A 1FKWA 2A3LA 3ICJA 4GY0A 4YIWA 1W1IE 1K70A 2FVKA 3DCPA 3AU2A 2AQVA 3PANA 4G2DA 4EPKA 3ITCA 3MDWA 3QY6A 2R1PA 4R88A 4LANA 4H9TA 4CNSA 1V77A 2FVMA 2HBVA 2Z00A 4C6JA 1FWCC 4LAMA 1KRMA 3DC8A 3S2MA 3UR2A 2GSEA 3K5XA 3TNBA 1J79A 5HMEA 3WZ0E 1FWAC 2PUZA 4B91A 1BF6A 3T8LA 2R1LA 3QGAC 3JZEA 1M7JA 4I6VA 4OFCA 4DLFA 1UMLA 2F6KA 3TN3A 2YZ5A 4H9YA 2Z27A 3TN5A 1E9YB 4DYKA 3TN4A 4B90A 4C5YA 1S3TC 4XAZA 1FWGC 4XAYA 1RJQA 4GX8A 4PE8A 3ISIX 2P53A 4F0RA 1A5OC 2QVNA 2RAGA 1RJPA 4HJWA 4H9XA 4PCPA 2VC7A 3EGJA 3AUOA 3GU1A 1RAKA 5E5CA 3SO7A 3S4TA 2QT3A 1ITQA 3CAKA 4PBFA 3S2NA 1KCXA 3GTIA 1FWDC 1O5RA 4IFKB 3URNA 1A5MC 2O4QA 2GWNA 4H00A 4RDVA 4EPBC 2ANUA 3MVTA 4C65A 2HNHA 3MPGA 3MTWA 3NQBA 1FWFC 4LALA 2HPIA 3OQEA 4RDWA 4BJHA 1KRAC 3GU2A 4C6FA 4XD4A 3GTXA 2OGJA 4C6EA 2Z28A 2Z4GA 4DI9A 4C6KA 1I0DA 2OB3A 4P5UA 3O0FA 4CNTA 3HM7A 2Z2BA 1NDVA 1WXYA 3LU2A 1J5SA 1IE7C 4H9ZA 4JOMA 1WXZA 4INFA 4IGNA 4QROA 4XD5A 3MJMA 2HBXA 1EZ2A 4CEXC 4QS6A 4C5ZA 1XRTA 2PAJA 2BGNE 1YMYA 2VHLA 2DVTA 3E2VA 4DZIA 4KESA 2UZ9A 4TQTA 3F4CA 3RYSA 3QY7A 4RZBA 3OU8A 4HK6A 2R1NA 1YNYA 1RK5A 1KRBC 4R7WA 4HA0A 3A4JA 4QTGA 3OODA 4C6LA 4MUPA 4BKNA 2Z26A 3G77A 1FWBC 4DZHA 4I6KA 4C6DA 2G3FA 4H9UA 3T81A 4Z42C 4IG2A 1J6PA 4L9XA 1UIPA 1UIOA 4ZSTA 1FWHC 4PCNA 2Q09A 1EJVC 4DO7A 4LCQA 4H01A 3FDKA 5A6TC 4ERIA 1ADDA 1EF2A 3GTFA 4C6IA 4KEVA 3ID7A 4F0SA 3NEHA 3R0DA 3IJ6A 2GOKA 3QY8A 4WVXA 3MDUA 1A5LC 3FDGA 4IFOA 2I5GA 4L6DA 2WJDA 2D2GA 3T1GA 1QXLA 1PB0A 4C6OA 4ERGA 4CQDA 1PSCA 4BY3A 3LSCA 3GU9A 2ZC1A 3UBPC 2CZVA 3URAA 3LA4A 3LNPA 2Z7GA 4WHBA 4RDZA 3E0FA 3GG7A 4XAGA 1KRCC 1ONXA 3MSRA 3RCMA 2VC5A 4ZSUA 4C6NA 1NDYA 2PLMA 4CEUC 1E9ZB 2D2HA 1R9YA 1EJSC 1GKPA 1RJRA 3OJGA 1XWYA 1EJUC 1XRFA 1VFLA 2O4MA 4B3ZA 1J6OA 4DIAA 2Z24A 4B92A 1M68A 2QPXA 3FEQA 3OOQA 1V4YA 1GKRA 3PAOA 4EPDC 3E3HA 5CH9A 2R1KA 3F2BA 4HK7A 2AMXA 4UB9A 1NDWA 4IG2B 4GYFA 4IH3A 1P6BA 4IFRA 2DVUA 3CS2A 2Z25A 1YIXA 4XAFA 2DVXA 2FTYA 2Z2AA 3URBA 3F2CA 1EJRC 1FWJC 1PO9A 2HQAA 3PNUA 3B40A 2OODA 3O7UA 1XGEA 1POKA 3K2GA 3A3XA 2EG7A 3GUWA 3EWDA 2P50A 3AU6A 4DNMA 2FFIA 1NDZA 4G7EA 1I0BA 3IPWA 3MKVA 3HTWA 1RK6A 1P6CA 3IV8A 3GTHA 4EP8C 4IQJA 4C6MA 4CQCA 4IFKA 4HK5A 2ADAA 1FKXA 4RE0A 4IF2A 4GBDA 1GKQA 4KQNA 3EWCA 4UBPC 3LS9A 1A5NC 4EPEC 3UR5A 1FWEC 1QW7A 5HMFA 3RHGA 2Y1HA 2Z29A 3ORWA 2WJEA 1V79A 2BB0A 1M65A 3A3WA 5FSEC 4KERA 5HMDA 3HPAA 4J35A 3UF9A 2YB1A 2GWGA 1K1DA 4J2MA 3OVGA 3C86A 1EJTC 1O12A 4CNUA 4GY1A 1P1MA 2Q01A 2HPMA 3S2LA 1EYWA 1FWIC 2E1WA 3E38A 1POJA 3WMLA 4XD6A 1A5KC 3DUGA 1PTAA 4LAOA 4LFYA 3UPMA 4LAKA 2IMRA 3E74A 5AKQA 3S2JA 4C6CA 4C6BA 4GK8A 4XD3A 4KEZA 3WYZA 5LXXA
chains in the Genus database with same CATH superfamily
2OQYA 2C16A 1OFDA 1Z6KA 5AN7A 2QF8A 1TZ9A 3QPZA 1SW7A 1ITUA 1T41A 2PFHA 1WZKA 1DKWA 3D46A 5ABFA 3NPUA 4HGXA 3UJ2A 3EWYA 3O06A 2Y2WA 1JGMA 4LXFA 2YSWA 3LPFA 4JTSA 1UZHA 3BTNA 3ZSSA 1C92A 1YTEA 1KR1A 1YW1A 1EC9A 4TVCA 1QHZA 3LY0A 1RZMA 1VEMA 4B9YA 1V02A 5G4HC 1TB3A 1B3OA 2Z2UA 2E67A 4ROQA 4HD5A 1PUDA 1OHLA 1IV8A 3QQ0A 3ZLGA 1D7FA 1QBAA 5I07A 4KETA 3UQNA 5AC5A 3L4UA 4GZ7A 1P0EA 1RCXB 1REQA 1SJDA 2XGZA 3VKBA 4AEOA 3EB4A 3U2EA 2XDFA 2CLHA 1JGIA 1TVLA 1C93A 1SR9A 4X61A 5DMLA 4NG3A 3D6NA 3W2JA 1AMKA 3NUKA 1E70M 3UY7A 2YDRA 3AMDA 4QLJA 4N6EA 3ICJA 3EXRA 3C2YA 4XZBA 4H2HA 3PWIA 4D8ZA 1UWIA 2NQJA 2AQVA 1TJRA 4J3XA 3Q2DA 2VEKA 1HO4A 3F5LA 2GGHA 3W70A 2CETA 1KXQA 3C3NA 3I6RA 2VP8A 3QH2A 5DBUA 2ATMA 5D37A 1MYRA 6CGTA 1Z42A 3W02A 2X0SA 1VEPA 2D23A 5MHBA 2QCGA 5GNYA 4F0KA 3N12A 4B91A 3BG5A 4YTTA 4PMQA 4LNYA 2BY0A 1XYZA 3EDEA 3UA4A 1GHSA 1G1YA 2BVWA 1DWIM 2WZTA 1H5VA 2D22A 1RV8A 1UA3A 2QPUA 2PURA 1ZP4A 3AS0A 2NXIA 3K30A 3KTSA 2FVLA 1XLJA 1F5ZA 3ABRA 1P43A 4QLKA 5DY2A 3WJSA 5DMNA 3ZFHA 2DH2A 4XX6A 1UB3A 2PRLA 1A5MC 1OFOA 4J27A 1Q8JA 3R4IA 4AD5A 1KBJA 1ODUA 3SM0A 4LUSA 3C0QA 4RDWA 4OBTA 3OBAA 3W7HA 1DP0A 1W3TA 3VPLA 3DEQA 3B4UA 1US3A 3RU6A 4L5ZA 3VCRA 3KWSA 2G41A 3HMJG 1PE1A 3MJMA 2D0HA 3TCEA 3TA9A 5AB3A 3LZ3A 5LIKX 4UTUA 1CI1A 3COTA 2G4JA 4PULA 3APGA 4RZBA 7CGTA 3KZSA 3C2VA 4YJ5A 4XQ6A 4O50A 5FF3A 4OKDA 1EP1A 2HROA 3G77A 1AODA 1C9WA 1W9XA 4C7GA 1U2YA 5F2GA 1XBVA 2GPTA 3CUGA 5I3HA 2VJXA 1NQKA 4PSPA 1XFCA 5LNUA 1QPKA 1UR8A 3M0JA 3RF9A 2BTMA 1NARA 4O1AA 1FVPA 1IXNA 4YNGA 4DN1A 3TQ0A 1UG6A 3MDUA 3S5ZA 2BOEX 3GVQA 1NF7A 1PKNA 4C6OA 2ZX9A 4HP5A 4Y90A 5BRBA 3QXBA 2PZ0A 2GJXA 1IIGA 2X1SA 4I9TA 3DI0A 4F3HA 5DCDA 3SR7A 3GG7A 5JH1A 1GQJA 3AALA 4CEUC 4G7FA 2A6LA 1R9YA 3XISA 3W2NA 3OZOA 2I5QA 4LEQA 3QYQA 1TPDA 2R6OA 3NZQA 3WF2A 3OOQA 3DDMA 3TC6A 1HJSA 4B2DD 3R89A 2KZHA 1FHVA 5AC7A 1NWUA 1OG6A 4FNQA 3L23A 2Y24A 5E9AA 1T8QA 1KXVA 3F2CA 3LNMA 4RNIA 5G5IA 4IMGA 3B40A 3WQ8A 3PG9A 4GACA 1XIFA 1V6UA 1ZRQA 1K9EA 4DO4A 1HVXA 3WLTA 3THAA 1XXXA 3BK0A 3WDIA 2NSXA 2QYGA 1EXPA 2DT0A 1LLWA 3U7VA 4JX4A 4JIEA 5HMSA 3UPWA 5M2FX 1QJWA 3VIJA 4M1RA 5E6ZA 1Q13A 4GJIA 3BOXA 1FHDA 1TWIA 4HMEA 4JQ1A 5FCZA 1H11A 1A50A 4W86A 5EY5A 4J35A 3UF9A 3AAMA 1UR0A 1XH1A 1EJTC 2YCLB 4FF7A 3LCXA 4MY1A 2HPMA 2E1WA 3IIXA 3P62A 4S3CA 1PVNA 2QCLA 2WANA 3CUXA 4EACA 4MLJA 2NLYA 1W8GA 3VYLA 1KFCA 4WJEA 4LYRA 4ERAA 5I3KA 1R9XA 3V5CA 3OZMA 4YVVA 2QS8A 4IP5A 1O4UA 1CB2A 1UKSA 3QKEA 1LBLA 4OQVA 4ZB0A 1MWOA 1GPWA 1V7AA 4R5EA 5I6SA 1TVNA 3AROA 2R24A 2JKEA 1KBKA 3SECA 4XZLX 4QIUA 4FHAA 4XSLA 3O63A 4NNCA 3LLXA 2FTWA 1MQPA 2VUNA 3BE7A 2PTZA 3CIXA 3ARUA 2F8QA 4GYJA 1M9HA 4JTLA 1V0MA 3W7GA 5LSMA 3N18A 3BLOA 2V0TA 2GUYA 2E7FA 4CD5A 2PEVA 7ODCA 4ZQCA 3NURA 2P8BA 1RY8A 4XZIA 4LBSA 3AYSA 1ZBKA 1OGGA 5FJOA 4E4UA 3DI1A 4WF7A 1VC4A 4JQ2A 3RN6A 4UTTA 2PDMA 4M7TA 3DBNA 4I8DA 1RQEA 4M51A 1ZJBA 2WJFA 2DFAA 3LGDA 5FF4A 5BOOA 1EX1A 3PSWA 4MZYA 1TPFA 1ZS2A 3NSMA 3A9BA 5C8BB 3EPMA 4NU7A 5C6MA 5LYRA 1NSJA 3DCPA 1EHAA 1VP5A 2IKGA 5KZ6A 3GDBA 1XH2A 3PF3A 1R2TA 5AYXA 4NJJA 5DXYA 5H2ZA 3C8FA 4Q3MA 5BXSA 2FZ9A 1FFQA 5DMYA 3K13A 4NSBA 3LCFA 3OGSA 3UR2A 1WXJA 2ZXBA 3LTPA 1GTEA 4IPJA 1V08A 3A4XA 1JDFA 4KS0A 6ENLA 2ZXAA 3I4EA 2CLEA 3A5FA 3RR1A 2V5BA 3GC5A 1E9YB 3GXFA 2ZTKA 4NZFA 2ZWYA 4IIDA 3ISIX 5GJMA 4F0RA 9XIAA 4PMUA 3J7HA 4JHZA 3PM6A 2OXNA 4FS9A 5CZ0A 2V30A 3GK0A 1DJXA 4AIEA 4IUOA 4MJ4A 1LLOA 4ZOCA 1I4NA 1GVIA 4HYRA 3PBUA 4RW5A 3TP4A 4XWUA 4XB3A 1S2TA 1F2JA 4RDVA 3GFZA 3EX4A 3PTKA 4X2PA 1GQIA 3MYOA 1PHWA 1PWLA 3A9IA 3EX3A 2XVGA 3GVGA 4P7RA 3ZR4A 4HOWA 1EEPA 3LRLA 2OGJA 2NSOA 5T91A 3P0WA 3SN4A 4P5UA 1W54A 1IE7C 5EMJA 3HF3A 4XD5A 3WN6A 1E4MM 3ARWA 4CCZA 4QS6A 3IGXA 3V5FA 2IXUA 3CB8A 2A3HA 5AVHA 5BROA 3ZT5A 2DIJA 2REQB 4M82A 3A22A 2RJHA 4MY8A 3H2CA 4MDPA 7REQA 4JFVA 1DEDA 1UR3M 5CZSA 1Q2RA 3FA3A 5LIWX 2ZRXA 3GAYA 4WZHA 1X96A 4GABA 3GHRA 1J0KA 3KEHA 4Q8MA 1YNPA 3VOJA 1UOZA 4V2XA 1E5JA 1KTNA 2GLKA 1HKMA 1XLFA 1QASA 3FDKA 2WM0A 3SN1A 1H2JA 4FXSA 1XCFA 2WOQA 3IAQA 1E72M 4QNWA 2O9TA 1EOKA 4UWMA 4AFYA 3STCA 3BLLA 1IHIA 4LYPA 4GJ1A 4JXCA 4M8UA 1ZU8A 2BZNA 1PSCA 1YE6A 4NASA 1RD6A 4IPLA 4PUUA 3W1PA 3GFYA 2BXYA 4IMEA 1F7BA 3WFLA 3NQCA 2QPSA 2J7DA 4MFEA 3JU2A 3LCIA 1ZENA 2I57A 3APYA 3AZRA 4XG1A 1XRFA 1KNWA 1RQBA 3GBDA 1VZWA 2WWCA 1EDQA 3ZVHB 4IOTA 1TWZA 4PH6A 3LTSA 3AIUA 4H83A 3E3HA 1BYAA 3I68A 4GKLA 4UB9A 3AI0A 2VC9A 4LYQA 4KEMA 2V6AA 3VNLA 5JUVA 4LB4A 4UQDA 1P1XA 3QZ6A 3W25A 4F2TA 3GTNA 1B31A 3GUWA 1W9VA 2FFIA 2WMGA 3KBSA 1OC6A 2PF8A 2PWVA 4FALA 2A3BA 3GBEA 4MLRA 3BOFA 1RVKA 1H1ZA 4EP8C 1I2RA 4CQCA 4CD6A 4OECA 4LT9A 1DWAM 1SJAA 3KHJA 4OWGA 3U4FA 2XIQA 3EMQA 2VGFA 2WCSA 3QR1A 2JALA 3FXGA 4KQNA 4Q4MA 4JHMA 5CZKA 1V3LA 3UR5A 4XTIA 2WVUA 1R7AA 4AWEA 2W79A 2YYTA 2J27A 4BZYA 3GG1A 3VGDA 4KGJA 1K7XA 3VGBA 1FWIC 2CKSA 1BWVA 4H8UA 3WMLA 2O55A 2INZA 1D3CA 2BVTA 2VRKA 2Y8VA 3ITTA 1PTAA 4LWWA 4LAKA 3S83A 5CGTA 4PUEA 5G1YA 4A6GA 2UV8G 4BQ5A 4Y7EA 3VUPA 5IBXA 2DZUA 3EWUA 2J47A 1WQ5A 3SZ8A 1Q7ZA 3MP3A 1I9CB 5D2VA 3HPFA 4QSFA 1HG3A 5LA2A 3TLLA 1RR2A 4RZ6A 3SFWA 3UY8A 1T7LA 4DWSA 1FCVA 3CT7A 3TMQA 1EC8A 2QCDA 3VUSA 1Z3NA 4PUDA 2WSQA 2FYMA 5I3FA 2DJLA 5CC6A 1QFEA 3OYXA 5I3JA 3KCLA 4FLOA 1ITCA 1FDJA 1SQ7A 3NVDA 4QRNA 5HBFA 1TCMA 2JKPA 3ITGA 2P3EA 4HNLA 1NWSA 4E2OA 4OBRA 3IGHX 2A3EA 5CPOA 3R2GA 1R6WA 4GVIA 2HZGA 3O3RA 4HNOA 2R1MA 1XICA 3GNXA 4E3TA 3PBWA 3VIHA 3R58A 4MY9A 1FWWA 3PFMA 4JTCA 5DRCA 1L6SA 4DWSD 4PBEA 3N2OA 5BW6A 1W9UA 2R14A 3VD3A 2FZMA 3WEMA 1YDYA 1IWAA 4NAEA 1ML1A 4GG9A 2F2HA 1X38A 4H6QA 2A3LA 4A8IA 1OM0A 1G94A 2QR6A 1QT1A 1UMYA 1HUVA 3B9OA 1T8XA 4LNCA 4QE5A 2Y7EA 1V6TA 2Y0FA 3WG6A 1KCZA 1SFLA 1NTHA 7TAAA 3L68A 1V6XA 4HA3A 1SVDA 4MPKA 1ADSA 4QE1A 4C6JA 2WPBA 2FGLA 1P0BA 3F5KA 3WD0A 1Z32X 1YXYA 4LUJA 1K9DA 3NO5A 3ANYA 3R43A 4H4IA 4O0QA 4KFPA 2DZBA 3QR0A 3MHFA 3QQ1A 3CWHA 4OFCA 4XISA 2RHGA 5FF7A 5KSWA 1Z41A 1SW3A 2Z27A 3S1XA 4FB7A 2VFFA 4HQVA 2ALDA 3QZEA 6TAAA 3IJDA 2VOMA 1JAKA 3CWNA 2OMAA 3H4XA 3T9PA 2W3ZA 4QDWA 4E2VA 4GO8A 3G0SA 2CZFA 3QYSA 3SDOA 3BQ5A 3VNZA 3EOEA 4FPSA 1XL9A 1YEYA 2H8ZA 5MF5A 4YCOA 1GORA 4BI7A 2EPOA 1ZTVA 3M0YA 5M03A 4O1DA 4QG8A 3M5VA 5E5CA 2QCHA 4PMXA 1TVPA 3KOWA 2CFFA 3AYVA 3MSGA 3PWAA 1WUEA 1W0MA 4LB3A 2X40A 3TDFA 3U48A 1MEHA 2VC6A 4EXBA 2Y88A 1QPQA 2WMHA 3SEPA 4DJEC 4PRRA 3MVTA 5DCEA 2PWHA 2HPIA 3CHFA 4CCDA 1MO0A 2AOSA 4M5PA 1WKFA 2J7HA 2IQTA 3SSJA 3DFPA 1R3YA 2FJUB 1RQHA 3W7RA 1AZ2A 2G3NA 1K3UA 4ZODA 3CQHA 1J18A 1EXBA 4DAIA 2NQ5A 2CXEA 1O1ZA 4UTKA 1J5SA 4EE9A 2PCEA 3NZRA 4INFA 3EMCA 2JKAA 5EMUA 4DO5A 2HBXA 1EZ2A 1XG4A 2DU2A 4O17A 1JEZA 3HGSA 3NGJA 1OADA 4IP7A 1P0KA 4ATDA 5ABGA 3PS7A 3PK7A 1VPQA 2UZ9A 3E02A 3RYSA 2ZRWA 2YW3A 3VIFA 4PTWA 1CLKA 1KRBC 2UY3A 3KRSA 3I3BA 3EXTA 1PXGA 4H9UA 2W67A 4F66A 2VZTA 5IM51 2HE5A 4H01A 2GGEA 3V75A 2NWRA 1W3NA 3DERA 1RALA 3EA3A 2XSXA 4L4PA 1IEWA 3G1HA 3W29A 3I4KA 3ONBA 1DJZA 3NDOA 3QV8A 3S6DA 1O68A 3JVAA 5I3IA 5IDIA 3R0UA 1E3ZA 6ALDA 3RMEA 1GQNA 1PB0A 3N9RA 4RNFA 5CJNA 1S1RA 4P8UA 3LHUA 3T0AA 3O9NA 5LHFA 3CH9A 3NOYA 4Z17A 1M7PA 2ZCGA 5FESA 1OK6A 2XZ7A 2E68A 4ZO9A 4A2RA 3GNDA 4LYKA 3E0FA 2DJXA 4ZENA 3G0UA 4YYCA 2Z1VA 5K2ZA 3KOFA 4X0NA 5C9RA 3FSUA 3PPHA 5TAOA 4PCFA 4LAUA 3O6DA 2NQZA 1QI4A 1GK8A 4DWSC 2PTDA 1JYVA 1IXQA 1GKRA 3C0JA 2R1KA 3T2OA 3TWAA 1CENA 3QSRA 4GYFA 2VEGA 1KBLA 2OCZA 3QV7A 4KRTA 1TTIA 1OD8A 3K8LA 1PZ2A 1YIXA 1C7SA 3CL8A 4NJKA 1JDAA 4AB4A 5L9FA 3O7UA 2J75A 4MDOA 1BKSA 2TAAA 4B15A 3LXAA 1PWMA 5D8WA 4WOZA 1SZNA 2QUMA 3T07A 2G4FA 1JL8A 3GM8A 3N2TA 3RM9A 3LOTA 3TROA 4RNHA 5KITA 2J79A 1XGDA 2GQAA 2BHZA 3OA3A 3WCZA 4AD3A 3A3WA 1U5JA 3V36A 4GI4A 3BDKA 4O16A 1SZEA 3WNOA 5D09A 3W7IA 3C86A 4IHCA 1V7YA 3PZQA 4O28A 3DN5A 1TPH1 4OV4A 2A7NA 3MBDA 1EYWA 3UT0A 1VQTA 1XKJA 1S5WA 3RO6A 4BEUA 4HU3A 3WUGA 2X7WA 4GK8A 3MWAA 3HQOA 1BKHA 1XPYA 1AW5A 4NP7A 2W5FA 4ZXOA 3TWBA 3ABXA 3W7EA 1VFFA 1H7WA 4NI8A 1D2KA 3H12A 1X1ZA 2GVEA 2I14A 2HK0A 4G56A 4KGLA 3KOZA 5T9BG 4PEEA 3EB2A 3G18A 1Q65A 1G6CA 4GJJA 4KWUA 5E93A 2D2JA 1OK4A 3BLIA 4EAYA 3V35A 2ZUTA 4DYEA 2WHMA 1FP9A 4B5UA 1BHGA 3H8AA 3ARPA 3HJEA 3VNJA 2ZBTA 1TTQA 5H91A 1VIZA 4JD4A 4HCDA 1T40A 3W88A 3KOXA 4FP1A 1SSDA 3E0WA 2FB2A 3QLLA 3F4DA 3H7UA 4RDYA 2X0YA 3P14A 1ZGDA 2WMIB 3CB3A 4JNZA 1YRRA 2WB5A 3HV9A 1YXCA 4LCRA 3WNPA 2XPKA 1U1UA 1R3RA 2W4XA 5FA5A 3WH7A 4H2CA 2QF7A 2V2DA 2XH2A 3MANA 1HL9A 3LEPA 4A4AA 1XRSA 4JYDA 1CCWB 3UU0A 3VGGA 1W31A 1W1YA 4NZ3A 1LTDA 1JVNA 3TSDA 4GIYA 3C52A 1OX4B 3TOYA 4FK9A 1OJXA 4Q7IA 4S3BA 1B90A 4CNSA 3QOMA 3NR0A 1PKMA 3R8HA 5I5RA 4JN6A 3O1NA 3CQKA 5LXEA 1AK5A 1I1WA 2CNCA 2DZSA 2P5NA 3JS3A 3IIOA 3IJ8A 2CPUA 3RUBL 3AHTA 2VCAA 4QHRA 3VM7A 1F61A 3QRHA 4XAZA 5EMYA 3D0CA 1GUVA 4DNHA 1S2VA 3TCSA 4X9SA 2H6RA 3GB6A 3KWXA 4W7WA 1LBMA 2MNRA 1SMAA 2VC7A 4W87A 3BSMA 2FPVA 2TODA 3S4TA 1TFVA 3APTA 3HGJA 2H3BA 3QMTA 3NQEA 2UWFA 2BSLA 2NVAA 2Y89A 3PPFA 3WD2A 1L9WA 2DH3A 4S3EA 3OQEA 1B3ZA 1ISXA 1UUQA 2V2CA 1A3XA 5BU9A 4ZVJA 1LBFA 1ME7A 3FAWA 1E4IA 1F3EA 1KM5A 3IK4A 3HBLA 2WPGA 4X0VA 5HDRA 3ARYA 4H1ZA 3WQVA 3GDKA 3U4AA 2DP3A 3MO7A 3AYRA 2C79A 1KGUA 1C90A 2RGMA 4ZGYA 3TVAA 4S38A 1IR2A 3CZGA 1OIFA 4ZO8A 3W1XA 3LN3A 1B2YA 3GDTA 3M0VA 4JKKA 1PBGA 2ONEA 4FNRA 3T78A 5LGZA 4PTNA 5HAOA 2GQ8A 4AIBA 1TJ2A 4LGXA 1NEYA 3S42A 1AD4A 1GONA 1GOKA 4DELA 2EKGA 3TKFA 3D3FA 1EJ7L 4HA0A 5A94A 4XO7A 1G69A 1M53A 4CLMA 1UIPA 2VNCA 1TZ7A 4X63A 3L2MA 1FWHC 5FEWA 1KA9F 4Z2HA 4HBKA 4A05A 1KCKA 2WLZA 3TR2A 3M7WA 2VGBA 3KLKA 4JFTA 5A6TC 3IEBA 3W6YA 3PSVA 2H8XA 4DRSA 2CLMA 4FA3A 1DJYA 2QCMA 1ZJHA 3EWZA 4QLLA 1LWJA 1GW1A 4GXMA 4ICCX 1YTDA 2ZC1A 4O8AA 2ZUWA 3AXXA 5CCZA 3P6LA 2VGIA 1XLMA 4CGTA 4JTDA 2PGEA 4NILA 3ITOA 3B9NA 3KAOA 3S3GA 1ZFJA 3MBFA 1XYBA 1FXQA 4EXQA 2OEKA 4MJZA 1OFQA 1ZCOA 2AAMA 1A49A 1YDOA 3EEGA 1UR4A 2E5CA 1M68A 1LROA 5FACA 3CV6A 3QTPA 1NDWA 1MXGA 1JPDX 4UIOA 3GDMA 1SMDA 1FBAA 1G5AA 1UZ1A 4UMBA 3WK2A 1CXFA 3FIGA 4E8CA 2C7FA 4AWSA 3PBYA 3LQGA 2NX3A 4MZ1A 2OODA 3TX9A 1RPXA 5HXMA 3GQYA 4K8GA 1TV3A 1G7UA 2J66A 3MKVA 3SY8A 3DYMA 4U3AA 4O0KA 3A4AA 1Q66A 1XUZA 9RUBA 3B3DA 4XUYA 3L21A 3OLEA 1JPIA 3WDRA 1CLVA 4XZNX 3LPGA 4HNUA 1NVMA 1PJ9A 5GQBA 5T9CE 3W7JA 3QSTA 3RHGA 1O94A 2BB0A 3ENLA 5C7VA 4S39A 2GWGA 4R3UA 1QMLA 5IDZA 4KCTA 2X1TA 1F8IA 3UXDA 5BMXA 3W82A 3H22A 1UC4A 4JIPA 2WBKA 3BCFA 4W5UA 4ZQMA 4JTJA 3S2JA 5K7JA 3W71A 5C9WA 3CM4A 3OTRA 4QDPA 3G1FA 3IAPA 4LV9A 2EPNA 3F4VA 5FJIA 3W75A 4JNYA 2C1HA 1LF1A 4Q8NA 4JIRA 1C8QA 3ELFA 2PPGA 5HULA 1GZ1A 1MUWA 5CBIA 3KW3A 1WP6A 4BWLA 1B9BA 1GVSA 4JYEA 2AL2B 4FSAA 4JTUA 3GIQA 1EWEA 4O14A 3W76A 4N9EA 5I3GA 3T40A 2PLCA 4KKXA 4K68A 4Q8OA 1ZP3A 3NTYA 4UQBA 4I5UA 1E5NA 1KLYA 3BAKA 1EJWC 1FQ0A 3AXIA 4ACZB 1MNSA 1E6QM 1UR2A 3QPYA 1GGOA 2EF9A 4L64A 4NJHA 5HNTA 5HUPA 3OW1A 2YL8A 1IZKA 3IVUA 4CU6A 1H62A 2EG8A 3SI9A 4YWIA 3VIIA 3QBUA 2GOUA 3MHGA 3CV2A 4HOXA 5CSUA 3RIKA 2OOGA 3P3BA 2VX6A 1Y0EA 3IARA 2I16A 3ATYA 3RR4A 3W2LA 1P6WA 5CC3A 1XISA 1U1HA 4KIEA 4QNEA 2JEPA 4GIRA 4YLWA 1L8NA 2J25A 1W1ZA 1ZJAA 2G37A 2DORA 5F1UA 3H55A 2EXOA 4XBSA 1AD1A 4MADA 3OPSA 1UQYA 2EPHA 5D30A 1H50A 2HMCA 1FCQA 3MUIA 3W53A 4IIFA 1KWKA 3U5YA 3MV11 1OZMA 4LVGA 1JUBA 2FVMA 3G24A 5DMMA 4I90A 5C7HA 3EX1A 1KFBA 1KRMA 5REQB 4JIHA 3TU9A 4WSHA 1J79A 3DZ1A 4TX8A 4I7VA 3D47A 5FJTA 5DXXA 2DY3A 4RW3A 1HGWA 1KGWA 3IV3A 5TD4A 4TX9A 3K8MA 3GAKA 2VFHA 4HNTA 1SPQA 3QGVA 4Z1BA 3P74A 3IK2A 2BXZA 2DZPA 4PMJA 1JYWA 3TN5A 3BV7A 3UJFA 1NU5A 1FWGC 4WEVX 3N4AA 1A53A 1U33A 3OO2A 1QI0A 3PUGA 2ZRZA 4UQCA 2OEMA 3AUOA 1RAKA 3JRKA 1KD0A 2Y70A 3RX3A 4CNPA 2AMGA 1DV7A 3O07A 3WO8A 2PZNA 2WVTA 3EPOA 3UPBA 2AL1A 2O7QA 4Z2GA 5CSRA 2YBTA 1B30A 3G1SA 2HNEA 3NQBA 4K8EA 4RXGA 4CVUA 1BF2A 2AGKA 1KRAC 2FMNA 2G8ZA 4M0XA 4F4RA 1BXBA 3CPUA 4NL1A 4GZJA 4HT3A 4DI9A 4GO9A 2ZDRA 4P8WA 3MUAA 3RLHA 3N15A 4CNTA 1VCVA 2FIQA 4HPNA 3VNYA 4PFHA 4FAMA 2CESA 1V3JA 1N7KA 4W7VA 4ZBCA 3N6JA 5FJUA 2B7NA 3MB9A 1LJYA 3HPZA 2BODX 1K8YA 1U30A 3W26A 2VHLA 1TIMA 3DKJA 3NL5A 2JF7A 1H63A 4CN1A 3N6HA 7A3HA 4M1BA 1XINA 4Q8UA 5J04A 3ZSTA 2G97A 1TV8A 1RK5A 3TFXA 3A24A 3V0SA 3MO4A 3DGRA 3RILA 1B3YA 3A6OA 4D71A 1OX5A 4D6GA 1W2VA 1LM1A 4Y9OA 4L4OA 1BG4A 5XIMA 1M7XA 1MDRA 4Y2WA 2VOTA 3VD4A 4Z0JA 2FFCA 3M6DA 3AMKA 2QCFA 1XIHA 3V3WA 4U28A 2HEJA 1GCYA 4EXAA 7REQB 4UR7A 4XIMA 3GW0A 1AQHA 2E09A 3RPTA 3N1AA 3FVMA 1FRBA 1QXLA 3CU2A 4Y8FA 3BH4A 1ICPA 4XUGA 4UFJA 3TOPA 4L65A 2NQLA 4M29A 2FTPA 3OVPA 4L61A 3O6YX 3EMZA 3TTOA 2FH6A 2EJ1A 4IICA 3OHIA 2X0HA 4BK9A 2WHKA 4GYKA 3ZOAA 3A23A 4GISA 1S3HA 3BZJA 2QV4A 3GY1A 5E0FA 3C3UA 1JR1A 4HN4A 5DX7A 2VO5A 4RV3A 1J6OA 1W3JA 4FNTA 4U4MA 4QSHA 2E5BA 3FEQA 1ZALA 2J7GA 1TREA 2PWDA 1TTPA 5CKSA 2C19A 3T2QA 4O15A 4AY1A 4GZIA 1XC6A 1PHQA 1UC5A 3GXIA 8A3HA 3VKKA 5EGRA 3WEZA 3G1AA 4OOZA 1UR1A 3VMOA 3OLDA 4Z1YA 3UG3A 3H2MA 3PZNA 2TRSA 4S1FA 5FL0A 3H7RA 3TAKA 3QMSA 2VL4A 1XGEA 3B9DA 1KV8A 2DZAA 3EWBX 3T7VA 3NL2A 3EA2A 1Q6OA 2I56A 3IV8A 1OEPA 4MOZA 2IPJA 1MXSA 4AXKA 4PRTA 3N3MA 1A47A 1LUCB 2WZIA 3GHTA 3UWQA 1I60A 2IUZA 5D03A 4XVEA 4AZIA 4XZ9A 1LRQA 2VKZG 1IT0A 3GD6A 1V79A 4Z1AA 2XN2A 4JCMA 4TUFA 3GNNA 1UP0A 2YJQA 2QGYA 2VRJA 4AC1X 1HJUA 3ZWSA 2VYOA 1QOPA 2PDFA 3UXLA 1OYAA 3OG2A 3W83A 4QJ5B 1A5BA 2FKPA 2FHBA 1TX0A 1TTJA 4EF8A 1OCJA 2FGBA 1Q4WA 1UASA 2DIEA 4YU1A 4UR8A 3ZYZA 3QM3A 4V1XA 5I09A 2X09A 3P93A 3ALFA 3WQDA 2Z7KA 2PDBA 5FI8A 1FTXA 2WNWA 3RNDA 2OJPA 4GINA 3W84A 5B80A 1MEIA 4E0CA 1QU4A 3N9SA 2YCEA 4LH8A 4W89A 2ZICA 3ABQA 3LGGA 1V3HA 2Z1KA 3AIVA 2ICSA 3UD6A 1U83A 3BG3A 3KTCA 3ANVA 4UQEA 3W28A 1D9EA 3DECA 4CQ8A 4AZBA 4F79A 5A2CA 3S9IA 1HVQA 4GE8A 4FEZA 4ZQOA 3B8TA 2HVOA 3N2BA 5HJXA 1TR9A 1M1BA 1UBPC 5EFDA 5JIPA 5C5YA 2CLKA 3FA4A 2ISFA 3PNZA 3CV7A 4H7CA 4LY4A 3T55A 4A8LA 4DLMA 4MPQA 2EG6A 2XSBA 4AYSA 1QATA 3CLMA 3BW3A 2YCKX 5KETA 1GTHA 1VHCA 1FFRA 3W7MA 3UVIA 2JEQA 1QNRA 3WLMA 2HCVA 3U2ZA 4R9XA 4IP4A 3A21A 4DJDA 2NUWA 4PSRA 4QJ4B 3DU0A 5D9NA 1FH8A 3INPA 4PTMA 1J0ZA 4EPKA 2PB1A 1UD3A 3LMZA 2B31A 1W9DM 2Z6JA 3QW3A 1Q3NA 3LTYA 1W3HA 1VKFA 5EMMA 5FF0A 2QJJA 4DLFA 4AU0A 1JRCA 4DBDA 4MSSA 2DUAA 3ABZA 4AZGA 1M41A 4H9YA 2Q8XA 5I3DA 4GUHA 3PC0A 2P1FA 3GC2A 3UETA 1Q85A 3WLQA 5F2MA 3CT2A 4XAYA 4X9YA 4GX8A 2E6YA 1BEUA 2RAGA 3WLJA 1W91A 4RE2A 3NO3A 4U33A 1G01A 2CWXA 3KDOA 1FDZA 1TELA 2SFPA 3B8UA 1TJPA 3WJYA 1XGZA 1SO5A 1PTGA 2OYKA 4WKAA 3RU8X 4AWUA 3S47A 3JR2A 3W23A 1H60A 3K1GA 3LUTA 3FJ6A 4MNKA 3MMWA 1JZ6A 4KPLA 4LALA 5EKYA 2F2KA 5CQ1A 3LBOA 4JDYA 4C6EA 1E15A 1GOWA 3C5QA 4OVXA 1JCTA 1DQXA 2BY1A 1Y7VA 4K2SA 3N2XA 3H54A 4XKYB 3O6CA 4G8TA 2QXWA 2PC4A 1XQKA 3RAOA 1G4PA 4UTFA 3LXCA 4DQWA 2GFTA 1DIDA 1V8EA 1MW3A 4RJEA 3USBA 4DAFA 3L0GA 1WAWA 4S2CA 2QIIA 4AVNA 2PDHA 1QBBA 4TQTA 5C2XA 1XUUA 4O11A 3M0ZA 5D33A 3ZJ8A 1E6ZA 4AUBA 1X7FA 3IJLA 4QM1A 4LRSA 5AYYA 3CWOX 3EKGA 3PZMA 3GXMA 3C2RA 2FMOA 1J6PA 1GG1A 4W5ZA 1BVZA 3IJQA 3TTYA 3CLWA 3U2OA 3GR8A 4UQ9A 1JAEA 3SURA 3UWUA 4ERIA 4UOJA 2B81A 2C0HA 3MMTA 5BRPA 3W7CA 3UGRA 1JNEA 3R0DA 2WNZA 2GOKA 2PBOA 3M7SA 1O66A 4V28A 1KW1A 1TYGA 2POZA 1L6GA 5BZAA 1GG0A 4GI8A 1E1FA 3GG0A 4IJBA 3N4FA 1QNPA 1A80A 1JCMP 3M5XA 1M7OA 2V8ZA 4NAFB 1E55A 2P0IA 1D8WA 3WUBA 2XVKA 4D2JA 3PZOA 3URAA 1SW0A 1R3TA 1NWRA 4RDZA 3LD5A 5HWMA 3TH6A 4AVOA 4XAGA 1XLIA 4PBGA 3DC0A 3IVSA 4X3ZA 4JL1A 4BWLC 3R7MA 1EJSC 1NY1A 4HNCA 1Z89A 2PWFA 3JZUA 4REQB 5JBFA 2C3ZA 5HATA 4F8XA 3L5AA 5B7ZA 3AHYA 5A6SA 2ZZ4A 1XLBA 4IFRA 4M81A 2CXGA 3UP8A 4XAPA 3WJXA 3K2GA 1VPYA 1QRQA 1DHKA 5D2TA 2ZADA 3VM5A 1CB7B 3UR7A 2IQ0A 3GTHA 4RLIA 1LT7A 3AHVA 3VOFA 5BXPA 1HX0A 3RK8A 4EKJA 1AL7A 1TUXA 3B0UX 1AVAA 4PTVA 4IM4A 2WQDA 5ECVA 3NYZA 4D8AA 4QEEA 4URIA 4J3TA 1QW7A 3P8JA 3VDHA 2PE4A 2GK1A 1VIWA 4MF4A 4LPCA 2XN0A 1JPMA 4DZ5A 2YYUA 2DSVA 4ZTYA 2ZUUA 4I9JA 1VFSA 4XTDA 2JFEX 2D69A 4LAOA 3S1WA 3BGJA 2RDWA 2QUTA 3TYDA 1KR0A 4AZ6A 4D1JA 4R7JA 3VZXA 1GVEA 1UH2A 1GOIA 3HIJA 5FD0A 4B2DA 3R6IA 3GW3A 4FX7A 3U57A 3FVDA 1XR2A 3AJ7A 2DZVA 3FGCA 3FXYA 1HGYA 2OOFA 4OIFA 1VCGA 1W5NA 2YCLA 2YOCA 1NAL1 3SUTA 3H7VA 3DKLA 2Y4SA 1V3IA 4JCLA 3AZTA 2XJ7A 3UZWA 1SUXA 1R47A 3RLVA 4MWAA 3AS2A 3GWQA 2EKCA 3W74A 3CJPA 3H23A 1GT8A 5I77A 1ISVA 1QDSA 1PTDA 1GVQA 1LRTA 3L67A 4M6PA 4NVTA 1DBTA 3ITLA 1Q6QA 1SO4A 5DELA 3SCSA 3STEA 5C54A 1H51A 1TSIA 4REQA 5D38A 3W24A 4M7SA 1RA0A 2I9UA 2PGFA 1BVNP 4G7EB 4H8VA 5GVJA 4GQRA 3BG9A 4C1LA 4J5NA 3W7PA 1VJSA 3UWYA 1WAUA 1VH7A 3E0LA 3CZEA 4DJFC 4ZXLA 3RCYA 4K36A 2XN1A 3A64A 4UCFA 1BSLA 2ISDA 3I3DA 3E49A 3OG3A 3RPMA 2VX7A 4YVXA 3V18A 3WBXA 2HTMA 3RM4A 3CNYA 2QJIA 4BI5A 3WDPP 1TE6A 1SFSA 3AMLA 3SY5A 4DM1A 3ITCA 2WHLA 3AMCA 4R88A 4LANA 3SUUA 2PLKA 1V77A 4GFIA 4HA1A 1QK2A 1BG9A 4MJMA 1B3XA 2QAFA 3ZXWA 3GVRA 1OY0A 3WZ0E 4S3JA 4NNBA 4HOZA 3AC0A 2WSPA 4L1WA 3P0XA 4LJ3A 2GDQA 4D6EA 3TYEA 5LKYA 2YZ5A 2FB3A 1IXPA 1O6IA 4BF9A 5TNVA 4DYKA 4B90A 1S3TC 5HJYA 2WNQA 3TA6A 1SO6A 2XIIA 4OUIA 1P7TA 3BAIA 4XV0A 4C7FA 3FCPA 4M19A 5HJLA 2F9RA 4LF1A 2BMBA 3BXWA 1I1XA 1B0IA 1WCGA 5AC4A 2PDWA 3EGJA 2XHYA 3QQWA 5BYWA 4PBFA 1GOQA 2PDJA 3GKAA 1L2QA 4ZFCA 4CN4A 3S2NA 1FWDC 4TX6A 4MWAE 3DIPA 2NQHA 2VDGA 3QC0A 4N2YA 1W6TA 1FWRA 3W1QA 2RDTA 3WFZA 2DDXA 1KFEA 1WDSA 1L6WA 4XKMA 5A3HA 1DJGA 2XH7A 2ACQA 2WMJA 2X30A 1E51A 1RPKA 1WE5A 3LCGA 4TR9A 4YTQA 3GE7A 2H90A 1VFMA 3MQTA 2ZZ7A 2DZXA 4G5DA 2GVGA 1CNVA 3KBVA 1MI3A 5CG7A 2DSKA 2ZC8A 4H8NA 3EOOA 4CEXC 4LUYA 4WKFA 1Q6FA 1VR6A 4KWSA 5FAGA 1CX9A 1VFOA 3KVJA 4PEKA 2QDEA 4FMVA 3G6LA 1DQWA 3LX9A 3LV6A 1TV4A 3UCCA 2PWUA 2QJHA 4HHHA 3W72A 5CLTA 4BEQA 4HK6A 3GYCA 1G7VA 3ARXA 4PODA 1GQKA 3EAUA 4QQ3A 4BKNA 2Z26A 4I6KA 5EMKA 2CKRA 1CXEA 2JIWA 4H8HA 1RXOB 1DHPA 4YS1A 1NFBA 1FH9A 2Q09A 4DJDC 4MB1A 5KEZA 5CSSA 3T8QA 2VI0A 3TYBA 1J0JA 3JW7A 3CZ8A 4E5TA 2OZ8A 1W1PA 3KP1A 3PBVA 3WLNA 3S5NA 1XM3A 3RDKA 2VCCA 3WX7A 2BVDA 3DESA 3CAVA 5CBJA 1UP3A 3MUZ1 3N4EA 3ZQ9A 5E9XA 4GIEA 4IWWA 1OWQA 4MMWA 1LDCA 2OG9A 2OWXA 3CO4A 2CHRA 3O05A 4A3RA 4WK9A 2Z7GA 1NFPA 4WHBA 4BF7A 1XLLA 1XLGA 5E70A 1TE1A 3BICA 3RCMA 3CAQA 4J4KA 1TUFA 2W91A 2QV5A 4MNJA 2E9MA 3OLGA 4R53A 4J3WA 1VFLA 4HA4A 4FIRA 3VDGA 1E0UA 2AAAA 2R8WA 1HKVA 4NYUA 1CGXA 3IGUA 4IH3A 2A7PA 1C29A 2I1OA 1AW1A 2A2IA 3CS2A 3CGTA 4J3UA 3GXPA 2J6XA 5AYBA 4IGSA 1GEQA 2ABBA 2HQAA 2OGYA 3GUGA 2CBIA 4AG0A 3T08A 1JDCA 1OT1A 1UPMB 1D7KA 4RKAA 4AW7A 1NDZA 4JBRA 2BGSA 1LQAA 3OP2A 2GJNA 4WKHA 1ONRA 3I3EA 2VMFA 3WF4A 1WPCA 3W1NA 3ZR5A 3BMXA 3ARSA 5K4XA 3QHMA 2CIPA 4GVHA 1W1TA 4IMDA 2L5HA 3H53A 3EYPA 4Y9NA 1ZLPA 1B4EA 2PDIA 1PCWA 4WY0A 1FWEC 2Y1HA 3HQPA 4F2UA 3E5PA 1XSKA 1VAHA 1K1DA 2OZTA 3Q67A 3H4GA 4WY0F 4CNUA 1P1MA 1GVRA 4WXZA 4Y8EA 2QZRA 3D3AA 1KCLA 1UUOA 4Q4PA 3CHDA 3B05A 5A8GA 1HKKA 1XSIA 4I9AA 2GGJA 1SFJA 2ZOXA 5EL1A 5G2IA 1E73M 4O1EA 3LQLA 4D6IA 3HGRA 3R13A 5A8PA 1Q45A 4UNIA 1T6MA 3G1RA 3T4WA 2DSWA 4AHQA 4A3UA 4CQBA 4AYGA 3AQUA 4V27A 1E56A 4HVXA 1RLDA 4Q6JA 1DIOA 2J77A 1TX2A 3LLFA 2PWGA 3RJYA 3NO1A 4MWAB 2MUCA 4Y9PA 3WMSA 4LCSA 1ZCCA 4JTIA 4RPPA 2NW0A 5G1TA 3VX0A 1GQLA 3CBWA 1F3TA 4OTKA 3S0CA 4L6OA 4ILSA 3VK5A 3M47A 3DHUA 1PX4A 5ECUA 4UZUA 2Y5SA 3URQA 1GJUA 3EDKA 1Z9AA 1AW2A 4RE4A 1HP5A 4GOAA 4IGMA 2W9MA 3KE0A 3F5JA 1XLHA 1H09A 1T96A 1EBGA 4MHBA 4Y6GA 4PB5A 2IXVA 1AQMA 1X8FA 3NGFA 2B4GA 3C2OA 3AWNA 4MKSA 4IX0A 5GNZA 1NOFA 1N2VA 2A1YA 2QHAA 3DXIA 4IXXA 4NAEB 1DWHM 5J5RA 3S8HA 2QMKA 3FHQA 4E4FA 2XWEA 2HE8A 1H61A 4QFUA 1OCBA 1U5HA 3HZ3A 4BR1A 1EO7A 3AU2A 2QLYA 2CZDA 2V82A 3MP4A 2D73A 1EZWA 4C90A 2IW0A 1OF6A 3QY6A 1CEOA 3LI0A 2X1RA 1BSIA 4XZWA 1QPNA 3S46A 3TIMA 1CGUA 3BAWA 3WH8A 1FWCC 3AJXA 4J28A 1OFBA 1TPEA 4JTTA 1QNQA 1W3KA 3FS2A 2OQHA 5KZMA 4PMNA 1ESWA 5AFDA 1UWQA 2BVYA 5IBXC 3A47A 1R85A 2DV0A 2F6KA 5AHFA 4JGDA 2EPKX 4AZCA 1X8CA 2ZVIA 3SQLA 1WKEA 3VVGA 4US5A 2HK1A 1SYTA 3TEVA 3QLDA 3UXAA 1AQ0A 5DLCA 2BY3A 3CASA 1I8JA 1E1CB 4WY0B 2YDSA 2BFGA 4FLQA 2O9PA 4HJWA 3VILA 4PCPA 5I00A 3BAYA 3EOSA 2G3JA 2WC4A 3O6AA 1GZJA 1ITQA 3VNMA 4EF9A 3PAJA 4N02A 3DYPA 1KCXA 4XZHA 2GJXB 2GWNA 4HSOA 1I75A 4JTHA 4QQUA 2WKGA 4KFOA 5ABTA 4PL1A 1TZZA 3U0HA 1XCWA 3W4RA 3SUVA 1SGJA 3G1XA 1KFJA 1Z8AA 3PZIA 1RUSA 4HMDA 3CK5A 2B7PA 2E6DA 3C8NA 3LU2A 3KVMA 1S2WA 4GYPC 2INEA 1H1NA 3HO8A 2RUSA 2CZ5A 3A12A 4E38A 1KM1A 3MJYA 1GVFA 5DT5A 1V0KA 3WQCA 1Q6LA 1GYMA 3TXZA 1NOWA 3LCHA 4WX2A 1M03A 3ES8A 4I5RA 3G1DA 3QEZA 4ZQRA 1LL7A 1OCQA 3LZ5A 5FJRA 4QTGA 4RR4A 3WJWA 4B16A 2ZRUA 4DZHA 4IG2A 3RITA 1H49A 4O52A 3N3TA 3KHDA 4A21A 2FH8A 1G0CA 4CD4A 4GNVA 4FX6M 1UD4A 4K1GA 3VCCA 1VJZA 4F0SA 1EA9C 1K9FA 3B8SA 3CMFA 3BWWA 5B7YA 4S3GA 3ZO9A 3L4YA 4J2PA 3YPIA 1LL6A 2X7VA 4UFMA 4L9YA 3DFHA 2NXHA 2WVSA 2CLOA 1JYNA 3TSBA 3GU9A 3UBPC 1CBGA 3W9ZA 1MQRA 4DY1A 4GNKB 4O8RA 4PMYA 2CC0A 4ADSA 1BXCA 2QW5A 1FA2A 2HV5A 5M3WA 1RJRA 3UGVA 4POCA 1ISWA 2PDQA 1L2UA 3PZGA 3CQJA 5AYIA 1GOXA 2OT1A 3LBCA 4RZ4A 2BLEA 2QDHA 3S1UA 5C9XA 3DHPA 4ZQPA 4HK7A 2ZVRA 4IG2B 4J3VA 3W85A 3B06A 3WFAA 4MG4A 4PUJA 4BHYA 1N8WA 1UUMA 3EKZA 2FTYA 1MQQA 2ZZ3A 5GJNA 1J11A 4JQAA 2ZYFA 1KGXA 1RVGA 2PBGA 1TG7A 3FX4A 4TTUA 1XP3A 5M1TA 4PMDA 3CYVA 3W07A 4YHEA 3F4NA 2YLAA 2PTWA 5GPRA 3GO2A 2PU0A 5HQLA 1JZ7A 1OINA 2OLSA 3W7LA 1OD0A 3VGHA 3NQ2A 3WH5A 3CL6A 5AHIA 1C7TA 4E4PA 3ITYA 5HMFA 4P2VA 2Y7DA 1R7OA 2OX4A 1CGYA 1LQ2A 4L4MA 4K8HA 2Z1XA 3NPXA 4RZ5A 3E96A 3T0CA 4J3SA 3UWVA 4LC8A 3DH7A 3ZS4A 1YQ2A 2CCRA 4TTGA 4QXIA 5F4WA 2NLIA 4C6BA 4KEZA 4ICNA 1UH4A 1E71M 3TYUA 5AHNA 4HSNA 1UWAA 1PZ1A 2WMIA 2PP3A 1J10A 2ESCA 3NXLA 3SRHA 4KRUA 1SO3A 1FHUA 2OQLA 5LIYX 2PDUA 3F7JA 4MYAA 2ASHA 1S5TA 3AZSA 2Q8ZA 3WKZA 3ATZA 2XFWA 1L0PA 3DYOA 3IACA 2Z1BA 3W27A 1ONWA 4RX0A 4DF1A 2NWSA 4C1NB 3TJXA 5BWFA 4GFSA 1XSJA 1VYSX 4AIOA 1Q6DA 1EJXC 5BMWA 4C6QA 1LORA 1BTMA 4UC5A 3FYYA 2Q02A 4ICMA 3GXDA 3WQ5A 1XYMA 4XK2A 2J9ZA 3UG5A 5M17A 1J01A 1A4MA 3EA1A 4N9DA 1YBQB 1VBGA 3LCWA 3P7YA 3VDCA 1DPMA 3FA5A 2E6AA 3C2EA 4KF1A 1NFGA 4FR6A 3R12A 1CDGA 1LP6A 5DANA 1WOBA 1VLIA 1EP3A 1JCXA 3VFCA 1ZZMA 2V68A 1UWSA 4DX3A 4F40A 3EDFA 3SGZA 1PIFA 1HZYA 3T05A 4O57A 1O5QA 1TWSA 2V69A 7ENLA 4WXYA 1S2CA 1OGSA 4RE3A 4AD0A 4XZMX 4MFDA 3WQ4A 3R10A 1ME8A 1NM9A 1WDDA 4MKNA 4FF5A 4GY0A 5D9PA 4MIMA 2DT3A 3QHNA 3O0KA 5D04C 3UNTA 3BVJA 3PANA 1K9TA 5KZDA 4D6FA 2X42A 3HJZA 2XIBA 3VFLA 3NA8A 2JK2A 3KVKA 3DC8A 3MCMA 1YDVA 3PWGA 2PUZA 3NQMA 4UXDA 1IT8A 2D2OA 2VEIA 1JNDA 1OFEA 3W00A 3H4WA 3DFNA 5JH2A 4JEJA 3WLOA 1DXEA 2XGIA 3LRMA 4KCWA 2BXVA 3GZ3A 1VFHA 4UTJA 2D24A 4W8LA 4BQ4A 4C5YA 3VC5A 3N13A 2RKXA 2ZXDA 1G4EA 2J13A 3GSMA 2QVNA 3MUXA 4AX6A 1RJPA 2EPMX 3NAVA 3OA5A 3B97A 4U3CA 1AJZA 1OCNA 1B54A 2C91A 4H3DA 3W0KA 1UWRA 3EWXA 4S3AA 1YE4A 2PDPA 3DBPA 5K4ZA 4EPBC 1DE5A 4Q33A 1X1OA 3DG3A 3MTWA 2ZTJA 1ADOA 3VZZA 2OEJA 3VIGA 1DXFA 2TMDA 1W56A 2VD8A 5A6KA 1XIJA 1XW8A 2Z0IA 2Z4GA 3OLIA 3C0SA 4BF5A 3WBAA 3Q45A 3XINA 3OQ8A 1I2QA 2OB3A 1DVJA 4LVDA 3M5ZA 3KDNA 3M1ZA 1NDVA 4EANA 4MVAA 5U7SA 1D3GA 1OYCA 2E4TA 3SUSA 4TIMA 4Q4SA 4DF0A 3G1VA 2WMFA 3A5VA 4UTWC 5FJJA 2ISWA 1CYGA 4DZIA 2MANA 4H7VA 1DWJM 3ONCA 3QF0A 2R1NA 4GA8A 1YNYA 2W63A 4ZO6A 4K3ZA 1XD1A 2NV2A 3T81A 4J7RA 4Z42C 1D8CA 1SM9A 4AMAA 3MC5A 3A13A 4ZSTA 1ZBCA 1BGGA 4PCNA 4NJIA 4LCQA 1QW8A 3AWOA 1JZ3A 4MB3A 4G1KA 1MUCA 4UFKA 2XGBA 5HA7A 3LCLA 4AEEA 5K9DA 4IJCA 1MW1A 1QVBA 2ZA2A 5F2LA 3ZLHA 4O1FA 4MJ2A 4B5XA 2Y85A 1TCDA 4CQDA 4QX4A 3LSCA 3VOHA 3RRAA 4IGHA 4Q32A 4R9OA 2RFGA 3M46A 2TSYA 2V63A 2O92A 2PWEA 5H8PA 2OELA 2VQTA 4B5WA 8TIMA 1UQZA 1R87A 4UTMA 1XYCA 3MSRA 3UYCA 4ORIA 2D2HA 4PC8A 3MI3A 4Q7BA 3W2MA 2BHYA 2Z24A 2XINA 1B57A 4US6A 3QFEA 5DRIA 3W6LA 2POTA 3ZIZA 3G2GA 1XH0A 4GVFA 2KX9A 1EO5A 2WXDM 4NQ1A 4E2DA 2R9RA 3CHEA 1EA0A 2GQ3A 3IIVA 1TO3A 2P8CA 2J8TA 5TF0A 2V2HA 3A4WA 1UD5A 2WKJA 1MRQA 2JIEA 3QV9A 1QTWA 2E28A 4DNMA 4LVBA 1YPFA 4TXEA 1Q6RA 4G7EA 3SCVA 1JDDA 4N42A 3VMNA 3N9KA 3RRXA 4IMFA 3W1RA 2J4GA 2GGGA 2ACUA 1EF3A 3TR9A 1XDJA 1BTCA 1VB9A 1TR1A 4RE0A 1GPFA 4LC6A 1XBYA 3I10A 5A8QA 3CEUA 3AO0A 4NJGA 3WLPA 1OQFA 1F6PA 1ZNNA 4NRSA 2W61A 5I7GA 4AX7A 3WBYA 5CSYA 3BV4A 3R8GA 1N8IA 4J2MA 3RJXA 3LMYA 3CZJA 5AOUA 4MWAD 2Q01A 1YADA 3S2LA 3SGUA 5A6LA 3FGCB 4DXKA 4GNJA 2DEPA 1ALDA 2ZUSA 1WX0A 4G9PA 4LFYA 4MWAC 8XIAA 3E74A 1OT2A 2WZHA 3TJIA 2D3LA 1IZCA 2E8YA 4XSMA 5DN1A 2BHUA 3W7OA 2O0TA 2CLFA 3TAOA 2HS6A 2AL2A 1OG0A 4LVAA 4RV8A 4ZOBA 3VNKA 3G1YA 2XVLA 4ASTA 1MW2A 4YTSA 3NZGA 4JY9A 2WVVB 1RLCL 1CW2A 2CW6A 2XIOA 4IQEA 1XIGA 6REQA 3ZT7A 4MB5A 5IFTA 2XVPA 3UR8A 4CVWA 1S5VA 3TQKA 3VD5A 5G1MA 1F6YA 1PX8A 4HJFA 1CXIA 2J7EA 5EPDA 2XISA 1R46A 5CPTA 4JFWA 2X16A 4Q8WA 2ACSA 4W8BA 3VNDA 3K4AA 2XTKA 2GQ9A 4Z1CA 1W1A1 3E0IA 4LEFA 4DHGA 1R3VA 4HB7A 3M0LA 3RFAA 3GHSA 4NHVA 4LV4A 1LRNA 3KZPA 4DWDA 1FXPA 2H9AA 4HZ6A 1V6YA 4QGCA 1LOLA 4JIIX 4WCJA 4OU1A 4BS0A 4F0LA 4JICA 4QITA 5C9UA 1U1JA 2W6RA 4IPPA 2H3DA 1V6VA 4CU8A 4I8YA 1JD9A 3TC3A 3RO8A 1JQVA 3ZJ7A 1E0WA 3CIWA 3M44A 2IS7A 7TIMA 3GHUA 3OBKA 2PCQA 1W1IE 1V03A 4Q8PA 1BYDA 1CLXA 3IJ7A 1XYAA 1NP2A 3RLGA 2Y8UA 3QN3A 1BQGA 5KTLA 4N4QA 4G2DA 1E43A 2A85A 4H9TA 1M5WA 1EGVA 1KM6A 3ZZ1A 2Z00A 2OR2A 2FPTA 1EBHA 1UKQA 4JX5A 5JIWA 1IXOA 3G0XA 1PPIA 4GGHA 3QOKA 1PYFA 3LG3A 3ZJ6A 2CBVA 4IQLA 2VFIA 2WCAA 4LBRA 5HNUA 4LX4A 1HT6A 1M7JA 1AJ2A 1F73A 2DSUA 4Q4RA 3WL1A 3TJ4A 4GQBA 1UMLA 3SCTA 1S2UA 4FIQA 2YLLA 3LBMA 1HKJA 4Z08A 2NVCA 3RCNA 1DTNA 5JBDA 1G67A 1EWDA 2X2GA 1P48A 3UZJA 1O5XA 2P53A 4HHLA 3UXIA 5CPLA 3PVFA 1HKWA 1W3LA 5K9CA 1KB3A 1V3KA 5CJ5A 1QNVA 1KQZA 1HQTA 4H9XA 4ES4A 5F4SA 1W1B1 3TONA 1BRLA 2QT3A 1MVYA 1UROA 1W9BM 4AD2A 3GTIA 4YXGA 2ZX7A 3URNA 1LQ0A 3S5OA 3FJ4A 2PRHA 3GFXA 4GI6A 4MAZA 3WQWA 3MPGA 1O5KA 3SCOA 4HIBA 4A35A 4LUTA 2VFDA 3M4HA 4S2BA 3VKAA 3LHYA 2ZXQA 5E1QA 5C2CA 4J1OA 1TKKA 1DJNA 4WQ6A 3AISA 1CPUA 1CXLA 3NDYA 2ACRA 2E6FA 4JZ5A 1WXZA 2OU4A 1R2RA 2I7GA 4JY8A 1LZOA 1QW9A 4B4HA 4LU0A 3SCQA 4KESA 3S5YA 4CQAA 3F4CA 4HN8A 3PP7A 3ZWTA 2E9BA 3S1VA 3L65A 2GUBA 3BLPX 3H2NA 5TBOA 1U22A 4IL0A 4HHMA 5BNKA 4TMBA 3WJZA 3G5EA 5D32A 2YA2A 1PL9A 3EPNA 5DFAA 1UIOA 3TQVA 4E2BA 3SCUA 2X05A 5FF2A 4DO7A 3TTSA 5F7UA 1UKTA 3BLEA 3KCJA 3LM7A 1F05A 1TJ0A 3OIXA 1EF2A 2ZA3A 4C6IA 3UYIA 3IRDA 1JFXA 2QJMA 4HPJA 3VDBA 4QISA 3IJ6A 1KBIA 3HU7A 4D6CA 1JPHA 2YCJA 3MZNA 3VO0A 2FLIA 4L9ZA 4DB7A 1E9IA 3LGEA 4L6DA 5HR7A 5A8MA 1S5MA 3AIEA 3WNKA 3L12A 3WLLA 4KWVA 3ZMRA 4W9TA 1EDGA 3NQAA 2VXNA 1F4HA 4N9CA 2CZVA 3L4XA 1VD6A 1AH3A 4C6NA 1NDYA 4V33A 2PDLA 1GOMA 3GNPA 1SU5A 2WWDA 1F3WA 5I78A 4JTQA 4AD4A 1YKWA 3C56A 4GQQA 3VOCA 2DZTA 4AD1A 2WQPA 2GJLA 4F2BA 1J0HA 1JUEA 3GVWA 3TMLA 5D02A 2F6UA 2C14A 1W5MA 1JG9A 3DX5A 1P6BA 4B5VA 4DJDD 2VWTA 3WK3A 1YLVA 3TW6A 2Z2AA 3ZJKA 4DVOA 2RJGA 2FZ8A 4NXSA 3AHXA 3VIMA 2P50A 2FQIA 3BC9A 3LENA 3SCRA 2UY5A 1E6PA 1RBOB 4IQJA 5C2GA 3U6WA 2FZNA 3WH6A 2E0PA 5GNXA 4EX4A 4IF2A 4GBDA 1CWYA 5A95A 5I2UA 4N4PA 3EDJA 3AS1A 3MCOA 4XKYA 4XO6A 1SZRA 3EWCA 1EQCA 1MNZA 4IJRA 3NSNA 3LS9A 3H2OA 1V5XA 4O1CA 4EWJA 3VAVA 1CECA 3ORWA 2B7QA 5FSEC 3VCNA 2WZEA 4NZCA 3GG8A 4AEFA 1BYBA 3MYPA 2ZKMX 3POHA 4RPQA 3SAZA 6XIMA 2XWDA 5CZTA 1BYCA 4AXNA 1VBRA 4YTUA 3GNOA 3CAWA 2YL9A 4GY1A 2Y7GA 2NZLA 1POJA 1OIMA 4M6QA 2IPFA 3EX6A 5CXPA 3MKKA 5BRQA 3UPMA 4P61A 2IKHA 3S5SA 2E9LA 1JXKA 2E1DA 1SR0A 5REQA 2IKJA 3CPGA 2VUYA 5I24A 4QJ3B 3TFCA 3WK0A 4GXWA 1CIUA 2A21A 1JFHA 3B0YA 2ATSA 3CMJA 3WQFA 5I03A 1ECEA 2FDMA 4O10A 5A6AA 5A1AA 3CQ0A 2VT0A 2BX7A 1R3SA 1E9LA 2NUXA 4QR6A 1DQUA 2WC3A 1PDZA 4RUBA 1X6NA 3QV6A 1DJWA 4M56A 4Z2JA 2D0GA 4YVPA 2PDKA 4L6HA 5LA1A 1X6LA 3WQGA 2CHOA 4B3LA 4NIRA 2IKIA 2OYLA 3UERA 2BNJA 3TNOA 4QDMA 2LLEA 3TZFA 5HR6A 1QPOA 1QHPA 3WQEA 2BP1A 1NELA 2ZIDA 2OPJA 5D9MA 4JAWA 1KTBA 3MUY1 3QGKC 3UESA 1TJ1A 4IIHA 4UQAA 3UFYA 3MVIA 1JI2A 3BJSA 2QAPA 1OF8A 2PRMA 2AQOA 5EMLA 3ZT6A 2E25A 4GH1A 4HMCA 2WM1A 5G2WA 1F07A 3VC6A 5EB8A 1XD0A 3LPOA 4YIWA 1N8FA 1RD5A 1C8XA 1JD7A 5BXTA 2VURA 1PX3A 1E6RA 3VXGA 2QCDB 3DFYA 1MMFA 4C1KA 4L7ZA 3E5BA 5LNSA 1PKYA 3UJRA 4ZFMA 1HFBA 1B3VA 4L80A 2OFJA 3DAQA 3FNDA 3K5XA 4A3YA 1A5SA 1IGSA 4PUWA 1UWUA 4DZAA 1IF2A 4WUIA 1WKDA 3BW4A 3ES7A 1R2SA 2XVNA 2YCIX 4TMCA 2WKLA 3TN4A 3M43A 1CZ1A 5EBUA 4ATWA 4JKMA 1XPGA 2X1IA 1XC4A 3W2UA 4PE8A 1A5OC 4GMEA 1ZAIA 4HPXA 5AHMA 2C1IA 3GU1A 3NQ8A 3WNMA 1I2PA 1JPKA 1O5RA 2NV9A 2OSYA 4C91A 2Q3RA 5IFPA 1FWFC 2P10A 3HQNA 2B7OA 2NUYA 2V3DA 2EHHA 1BPLB 3HQ1A 3MMDA 4AZHA 4XD4A 3WELA 4GUJA 3VINA 1C8VA 8RUCA 3BLFA 4PB3A 4Z1DA 1S1PA 3ZVIA 1WDRA 3AICA 2YKKA 4IQDA 4NX5A 2E3ZA 3GH7A 2OKTA 1B9ZA 3CIVA 2V5DA 2ON3A 3BQ6A 2WC7A 1PZ0A 2QVHA 3EOLA 3P5ZA 4HTYA 4JYFA 4TO8A 1B4KA 3HV8A 4ZB5A 1X7IA 5XIAA 4NZ5A 3H6OA 3AIWA 4P7LA 1WB0A 2BV9A 1JCLA 5LIUX 1WDPA 3OODA 1S5NA 4C6LA 4HPHA 1EUAA 3MWCA 3P60A 2OO6A 5CC5A 3NL6A 3AXKA 2IPGA 3M6YA 5D2WA 2PF0A 4ONVA 1OX4A 4H7ZA 1GHRA 4DUVA 3HFYA 4AY8A 3NEHA 1C8YA 4BA0A 1F4AA 1QI2A 3VD9A 1AZ1A 2VX5A 2NV1A 3T42A 3NQVA 1Q7MA 2QGHA 2QKFA 4Z2LA 4OBSA 1ZPTA 4H04A 3TK7A 3V16A 4UZSA 3AS3A 2W62A 3UJSA 1UR9A 1V6WA 5A6MA 3NQFA 1Q4NX 2XUCA 2B0MA 3LA4A 3LNPA 5C9ZA 4YYFA 1VYRA 4O12A 3KX6A 4GGBA 2JBMA 5CC7A 5D05A 4JQ4A 3OJGA 4H6RA 5E0KA 4B3ZA 3BW2A 4GUFA 1VCFA 1VENA 1FWTA 3PAOA 1FCUA 1V0LA 1KV5A 3B0PA 1CXHA 1XIBA 4UNLA 4XVDA 1AUSL 3Q37A 2DVUA 4JQ3A 2VDHA 2QUVA 2HXTA 2VQUA 3MKCA 3HB9A 4ZEPA 1FWJC 4ZA0A 4WDXA 1L6FA 5KMYA 2OLHA 2OO0A 3UZYA 4JIQA 4GCXA 2QDDA 2XFRA 1RK6A 3N34A 3NPVA 4GIAA 4DBWA 3QHOA 4Q4OA 3G3DA 4HK5A 3SGGA 5J8LA 1H4PA 1KFLA 1QK0A 1IZJA 2OSXA 1KKOA 4UTTC 3ARTA 1A5NC 4PUMA 1TMLA 2VENA 4EAMA 3N2MA 2NX1A 3OGRA 5HMDA 2GJRA 3SBFA 4WOQA 4ECLA 2YFNA 5JU6A 1O12A 1TMQA 1TPB1 5RUBA 2GVYA 1X97A 1QI5A 1DTUA 4QG6A 2NT0A 1YPIA 5PTDA 4BFAA 3LI1A 4C6CA 3OEXA 4MKVA 1SJCA 1UD8A 2CHNA 2Q8LA 1TPVA 3WD1A 3BCDA 3NEVA 4Q8TA 2VFEA 3SIMA 2DUZA 5JQ9A 3BSHA 1HL2A 2C6QA 3WNLA 4WDUA 1TIWA 1QNOA 3V0UA 3BUVA 1UCWA 1MDLA 4WLCA 2AGTA 1LWIA 3TYCA 1H0GA 1CGVA 3UG4A 1HJVA 2EQDA 2PS2A 4E8GA 4DPQA 2Q71A 1QWGA 4MZ8A 3NOEA 2Y62A 3L4ZA 2ZQ0A 4U5IA 1T99A 2RDUA 3FYOA 3PN8A 2OZ0A 3R8RA 4ZE5A 1P0DA 4N9BA 3ARZA 1NH6A 4UMCA 4UUIA 1C9DA 1R38A 2H9AB 2PGRA 4NUWA 2VTFA 1VGAA 4JL2A 2YXOA 2RGLA 3T09A 2GGIA 3S9ZA 2J7FA 3WUEA 3F2DA 1RA5A 3N2CA 4LRTA 1UA7A 1XX1A 5G4WA 2TYSA 3OHMB 3WLSA 1CGWA 1RP8A 5EYWA 3U2CA 3HG2A 1WKYA 3QTGA 3DOPA 3W7KA 1UZDA 8CGTA 1MZHA 2HDJA 3LHVA 3TYAA 4AAJA 1CXKA 1FKWA 4P8XA 3N25A 3LRKA 2P76A 1JCYA 3B8IA 4TV6A 4JR5A 1F8MA 1FUYA 3TZNA 1Q5MA 3H2AA 3FSTA 1EUNA 2BOFX 1NQ6A 1TWWA 3SCWA 1X39A 4CU7A 1LG2A 5FAJA 3BL3A 4NY2A 4Z2IA 1LUCA 1VFUA 3FOKA 4JEQA 4AISA 1Q6GA 4HYVA 4NXKA 1TV2A 1MFVA 2XSAA 4GC4A 3SJ3A 3S2MA 2YBVA 2GSEA 3TNBA 3L66A 5HMEA 1BF6A 3T8LA 4XBKA 3JZEA 1EIBA 4FLRA 1K8ZA 4I6VA 2VRQA 3DGBA 1TPC1 3GH4A 3HN3A 3N73A 5H6HA 1K02A 1MUMA 3K1DA 5EBAA 1JYXA 1H0IA 4WJ8A 2HWGA 3W22A 1MRAA 1NF0A 4WSKA 2G3IA 4RNJA 3LV5A 1RCQA 3W1MA 1EDTA 3B9AA 4LS2A 2WV8A 3LHWA 1YYAA 3ZLFA 2C8NA 1R30A 3MUCA 2PD5A 3CAKA 2J78A 4K7VA 4LUSB 5D4YA 2ZX8A 5AHEA 2WK2A 1KTCA 4Y96A 3BJTA 3NM3A 1XCXA 4OOUA 2HNHA 3USZA 4PMOA 1OFPA 3T0TA 3TLQA 1KM0A 1YDNA 3W7NA 3E12A 4GCAA 2A6NA 2ZZ2A 2Z28A 2ZX5A 4W85A 4JS3A 3H2FA 3R94A 2VDIA 4FO4A 4LTSA 3VTRA 3HM7A 2VFGA 3L4VA 2HXUA 3CL7A 2D1ZA 4N0RA 1M04A 4JOMA 5A69A 3GC4A 1WZLA 1UH3A 4JNMA 2OWWA 4MUZA 1R0MA 2GSJA 3HURA 6PTDA 4IL2A 4U5KA 4AHPA 2DSZA 3HMCA 2PLJA 4QE4A 2V3FA 1SJBA 5A8NA 1UHVA 1RBLA 4LS0A 4G6CA 1RP9A 2ZX6A 1J2WA 3OU8A 3MP5A 4HZMA 4B5TA 1O1HA 1M3UA 3KTXA 1ZBVA 4A8RA 4GWEA 5EA9A 2DPEA 3ERPA 3NQ7A 4JKLA 3ECQA 1HJWA 2EPLX 1FWBC 2GUUA 4JDBA 4CKQA 1W5QA 2JGQA 4L9XA 3TC7A 4YN5A 3E9AA 1RSCA 5DBTA 3SQSA 3K46A 2WHJA 3GDRA 5TQLA 1A5AA 3H70A 1UP2A 4UFHA 2CITA 4HCHA 3W73A 1GVOA 4YCPA 3E6EA 3UG8A 2I5GA 1VBHA 4A2SA 4AVFA 3T2PA 2QULA 2HS8A 3MS8A 1DE6A 5DF0A 2ZUMA 2ALRA 4Q6XA 3W7DA 5DT7A 3XIMA 4HYWA 1AMYA 3E2SA 1K8XA 3EDDA 5A6JA 1D3HA 1RY0A 1E9ZB 4OHQA 1DWFM 4YHGA 2GL5A 4J3ZA 3U8GA 5BOEA 4UTHA 4EPDC 2GVLA 5K3VA 1OZQA 2FJKA 3KBNA 4GBUA 1XLEA 1HF6A 2HVMA 1BGAA 1BWKA 5BCAA 1YX1A 4X60A 5U4NA 5CG0A 2F6XA 3IPWA 4Z0SA 1EGZA 4MTVA 1T0OA 4O19A 1XV8A 1EEXA 1DIKA 3CZLA 2GVJA 4PCTA 4QAIA 4YWSA 3TTEA 2GYIA 3D5HA 4EPEC 1E6SM 2Z29A 1M65A 1SZFA 1QO5A 4UTIA 3VGFA 5LNWA 5DO8A 2Q6ZA 1J2BA 4B9ZA 4U2YA 3STGA 2PC8A 1BXNA 4HPGA 3VD7A 2QCCA 3NZ1A 5C71A 3SADA 4DUWA 4AF0A 3O2LA 3VIOA 2QDGA 4R27A 5AKQA 3U3HA 3DG6A 2WYSA 4AC7C 3GR4A 1QHOA 2FHCA 1NOUA 4C60A 1P0NA 1VEOA 1EB3A 4G1NA 2YXXA 3P67A 1J0IA 4D72A 2YIHA 2EAWA 1FHLA 3W1TA 1KM4A 2E40A 2VD9A 3MA8A 1XLCA 4A8NA 3N6QA 5CPNA 3IWPA 5HWJA 4QJ1A 3MSYA 2YX0A 3BPWA 3I7SA 5C0QA 1H7PA 1H3GA 1M6JA 5CGMA 1J5TA 2J74A 1JJKA 1EH9A 1R9ZA 1XRVA 4HZ7A 5LZLA 1A0EA 5FSDC 1PKLA 3OGVA 1GYLA 3AOFA 4JPGA 3EKLA 3W1LA 3TXVA 1E1EA 1HJXA 2OYMA 3WMCA 1XF0A 1QNSA 7XIMA 3QMRA 4ACZA 2VELA 2ZWZA 4A3QA 1XLDA 4PCSA 3E2QA 2BY2A 4FXJA 1HNYA 3W1UA 4FNSA 4PN2A 3PULA 3M0MA 3UNDA 3QJAA 3FFSA 2CBJA 3PBMA 2YA1A 3OIHA 4D8LA 1ICSA 3PPGA 4AF0B 4L1XA 3PJWA 3LPPA 4D6JA 3T44A 2QIWA 3L5LA 2GK1B 1K70A 3WBWA 5A6BA 4WSJA 4PMRA 4F48A 3UCQA 3MDWA 2Z1SA 4PR4A 4DJED 3WBEA 4B5SA 2ODOA 3NYDA 3VIKA 3ME3A 3PUOA 1ZBWA 4O54A 3WLKX 1IYXA 4LBUA 1K7FA 2JF6A 4NYYA 2YPIA 3N04A 1FWAC 2PTYA 3WY1A 1WUFA 3UEQA 2BG5A 4J40A 3K8KA 1OGBA 4IMCA 2REQA 4Y9AA 1QWKA 2ISVA 4NRRA 4PGLA 5AC6A 4P7QA 3S1GA 1OVDA 3KUMA 3LK6A 2Y8KA 3FV9A 4F0MA 5HANA 3M0KA 4IMAA 3BMWA 3MW7A 3E2RA 3GDLA 1JUKA 4OZOA 4JN7A 1LYXA 1TQXA 4OJYA 1HP4A 3MY9A 3GKFA 1ZSXA 4H00A 3QKZA 1HJQA 3BURA 4ZMGA 4C65A 2XFYA 4EK7A 4QG9A 2G0WA 2NVDA 2OKOA 3WD3A 3S9YA 3E1F1 3BMVA 4IIGA 3GTXA 3LYEA 3H21A 2RDXA 2G5WA 3B8WA 4JFUA 3V5OA 3CXOA 1KFKA 3O0FA 4NI3A 5KZEA 1BWLA 4MYXA 4O4VA 1KO0A 4U10A 3LHTA 1PCKA 2WW5A 1QR7A 3L0NA 3R0KA 1B5TA 2C71A 2PI6A 4QROA 4IGNA 3ABOA 4H6KA 3WH9A 3CH0A 1EIXA 4UCGA 3MV01 3ZVHA 2ISSA 3KXQA 2YBUA 4B3KA 4DO6A 1BFNA 4DPPA 1MW0A 5EU9A 1ME9A 2BBFA 2VZVA 4EWND 4GZEA 1DJQA 4WR3A 3ZR6A 1VJIA 3CUJA 4W7UA 1EHNA 3N17A 2OTDA 5DY3A 4DXXA 3A4JA 1ZHAA 2OX1A 9XIMA 1XIDA 1E0VA 4HU8A 3GXTA 3B9EA 1FWSA 2GDUA 1NIUA 4M80A 5JVLA 4W88A 2FHFA 1EOMA 3GTFA 4UOZA 4KEVA 1WO2A 2Z1WA 2J8GA 2PP0A 4LQ1A 3VKJA 4R34A 4RXFA 1S39A 1XS2A 1XIMA 1A5LC 3FDGA 1GW9A 1GZGA 5LGXA 3C4UA 1SFTA 4I3GA 1E3XA 2D2GA 3PTMA 3KFTA 4PFMA 4DJEA 3UWEA 3FN9A 4ERGA 2BASA 4D6HA 4QP0A 4PZVA 1OC5A 4WDWA 5AZ1A 4IIBA 1J4EA 3BAJA 4KWOA 3LLDA 2AKZA 3ALGA 3BAXA 3WL0A 3LHZA 1KRCC 2VR5A 3SRKA 2PLMA 1W37A 2Z6IA 2EJAA 3HOJA 4BQ3A 3TJLA 5HPOA 1WBJA 3UWZA 1XWYA 4ROPA 1EKOA 1EJUC 4E8DA 2YDAA 1P7TB 4YPJA 3N29A 5AVNA 1EPXA 2CERA 3F2BA 1KXHA 1OFAA 1R86A 1DYSA 4N6FA 2O9OA 2PGWA 2PODA 2VZOA 4O4WA 3NNTA 3Q58A 3G3MA 3DFTA 3PY2A 1WDWA 4US5D 3T4CA 4O1BA 3A3XA 3EWDA 3VGEA 1I2OA 2R82A 1I0BA 2ZA1A 3NVTA 1LLZA 4QAWA 4UMAA 4W4QA 3KVLA 4H41A 4C6MA 3IANA 4ZL1A 4V15A 3OVRA 4ALDA 2P3ZA 2YDQA 3ANUA 3FEMA 1BRLB 4BQ2A 4UBPC 1Y65A 4K6AA 2OWCA 3VU2A 4Q4KA 2FZDA 3BANA 3I65A 2VR4A 4KERA 1LL4A 2E8ZA 3BGGA 1ISZA 1E6XM 1JDEA 1ENUA 3EX2A 1OC7A 5DCBA 3P2VA 4ML4A 3NJ3A 1BQCA 2EEXA 4XD6A 2J24A 4LAZA 3P61A 3LM3A 4FOKA 2IMRA 1W1VA 1Q6EA 4TV5A 4F9DA 1TQJA 1UD6A 2OT0A 1DJHA 4L56A 4QS5A 2I5IA 3Q4DA 3GRIA 2PDYA 2UY2A 3IUDA 4LOCA 1A3WA 1RH9A 1EFZA 1TPWA 1UJQA 1Y5WA 2VVSA 3W87A 5H1WA 4K39A 3NPWA 3CHVA 3M41A 1YBQA 4KIRA 3W01A 4DI8A 2X8RA 2EBNA 3V7PA 1Y8BA 4W84A 3B0XA 1IEXA 3VKDA 3KL0A 4IPIA 4TU1A 2PDNA 1LT8A 3PJTA 1J9YA 2XH4A 4GVGA 3TN6A 1JCNA 2CWNA 2XZ9A 5HWNA 4CCCA 1FOBA 3KRUA 1B3WA 3DHDA 3M0HA 4GY7A 3THUA 1K6WA 1ODZA 3B8VA 4B5NA 3SN0A 1DJIA 1HW6A 5BOFA 5A8OA 4R85A 4ZZ9A 4R33A 3K4WA 5LA0A 4F0HA 1DORA 1KQYA 1GVYA 4P7NA 3VE7A 4KWWA 2UBPC 1R3WA 2X2YA 2VCBA 1X1NA 4YL2A 3I7QA 4RL3A 2A5HA 1XIEA 3W2KA 3PFRA 4L1GA 3NQGA 4RK8A 1LOSA 5HUOA 3L7RA 3NIYA 1PZ3A 3I7RA 4GC3A 1R3QA 2DT2A 1W5OA 4S23A 4C6PA 3H26A 3EZ4A 3MI2A 3AMGA 1F76A 1AL8A 1ICQA 3ITXA 3O16A 2XIMA 2FVKA 3VOIA 4B4FA 2NQ9A 2DQWA 2WVVA 1UKOA 4QEHA 5A2BA 5KINA 1C91A 4LS1A 2FGZA 2R91A 4MGGA 2XH0A 2HBVA 4HNNA 2VWSA 5FJPA 3S6OA 3FHAA 1EYEA 3RG6A 3FKKA 2OSWA 3UCDA 5T26A 3G6MA 5MKGB 1W17A 2XYLA 4IUGA 2F84A 2CLPA 4NZ4A 3POCA 3OBEA 2G96A 1SSGA 2HISA 4GRSA 4ZE4A 2C1GA 1EGMA 3SQMA 4CD7A 4WDTA 5IXEA 5GJPA 4M6VA 2D20A 4H19A 2YL5A 1XI3A 1M01A 1ISYA 1KWGA 2J7BA 1KKRA 1RCOB 5CLWA 4JX6A 1QOXA 3IGSA 3M16A 2DW6A 3NXFA 4ZTXA 3SJNA 2G3MA 1GEHA 1UBSA 2O9RA 2CEQA 3EWWA 4OT7A 2DW7A 2O4QA 4OGZA 3F03K 3FKRA 3UZZA 5IOBA 3SB0A 3FLUA 4IZGA 3R11A 3VABA 1EP2A 3GVVA 4GUIA 2HSAA 3H2EA 5J5DA 5LNRA 3TW9A 5G2HA 2C18A 2QCNA 2D0FA 1LOQA 1WNOA 3MZ2A 4FR1A 3AIBA 3W38A 2Z2BA 5IRPA 5E09A 8XIMA 3GS6A 3U5UA 2DZWA 4GPNA 4IX2A 2XU2A 3HGOA 1W3IA 4C7DA 1ECQA 4E6MA 3V4BA 4C5ZA 1BLIA 3B03A 2VZUA 1H7RA 3E2VA 2ZZ1A 1Y5XA 1A3HA 4NX0A 4CNOA 3QY7A 5FOOA 4UFIA 4JHOA 4AWTA 2WLYA 3IJIA 2NX9A 3C2FA 1IWPA 1ZAHA 3B4YA 2ZRYA 3UA3A 3C6CA 4MUPA 3QR3A 1US2A 3IVTA 4C6DA 2J88A 3MT1A 3N14A 2ZUVA 1JQXA 3PTDA 3WIJA 1EJVC 2WNNA 1ADDA 4L4LA 6XIAA 1WYIA 3NWRA 1PDYA 4IXHA 3L2IA 3IUIA 1HL8A 3QY8A 4FXFA 2QEZA 3CQIA 4WD0A 2FDSA 2WJDA 3TV8A 3QFWA 5FEZA 1OABA 4KW2A 5ABEA 1IGWA 2PDXA 3V0TA 2FPYA 3IS4A 2X1UA 4AY7A 1RHCA 3F1QA 4OE7A 4PB4A 1UW9A 1ZB5A 2WBGA 4LY8A 3WF1A 3E0VA 1IEQA 1ONXA 3TUUA 1LG1A 6TIMA 3GYEA 4JTRA 3VNIA 1WBHA 3W86A 1E1CA 2X41A 2OZ3A 3CTLA 4PUKA 1VYPX 2GJPA