4ERIA

Evidence for a dual role of an active site histidine in alpha-amino-beta-carboxymuconate-epsilon-semialdehyde decarboxylase
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
331
structure length
331
Chain Sequence
KPRIDMHSHFFPRISEQEAAKFDANHAPWLQVSAKGDTGSIMMGKNNFRPVYQALWDPAFRIEEMDAQGVDVQVTCATPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKVLAQVPLQDLDLACKEASRAVAAGHLGIQIGNHLGDKDLDDATLEAFLTHCANEDIPILVHPWDMMGGQRMKKWMLPWLVAMPAETQLAILSLILSGAFERIPKSLKICFGYGGGSFAFLLGRVDNAWRHRDIVREDCPRPPSEYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLGEQKIGGLVLSSNLGESAKDKIISGNASKFFNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
publication title Evidence for a Dual Role of an Active Site Histidine in alpha-Amino-beta-Carboxymuconate-epsilon-Semialdehyde Decarboxylase
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 123
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4eriA00
3ITCA 3EWCA 3DC8A 4B91A 1UMLA 4F0RA 4E3TA 3E2VA 3LU2A 4INFA 4ZSUA 2CZVA 4MUPA 2YZ5A 4XD6A 1EJSC 1E9ZB 3OQEA 1P1MA 4C6QA 4C6BA 1UBPC 3GU9A 4F0SA 1J79A 2HBVA 5E5CA 2GOKA 2UZ9A 3MPGA 3LS9A 2E1WA 1A5MC 3S2MA 2W9MA 2XIOA 1IE7C 3DUGA 3LA4A 4XAYA 1V51A 2VR2A 2Y1HA 3D6NA 4RDWA 3TN4A 3PAOA 2YXOA 3TN6A 4XD5A 2ADAA 4DYKA 4B90A 3RHGA 3FDKA 4C5YA 4IFKB 4IF2A 2DVXA 2EG8A 3F4CA 1FWEC 2GWGA 3IJ6A 1QXLA 3WZ0E 3PNZA 1I0BA 2GZXA 2YB4A 2ANUA 3LSCA 2GWNA 3HTWA 3GU1A 3ISIX 2QS8A 2Z29A 4G7EA 1R9YA 1FKXA 2FTYA 2OQLA 2Z25A 4LAKA 2PAJA 4EPDC 4CNUA 2WM1A 4H9VA 4GC3A 2Z24A 2KAUC 4H9UA 4AQLA 4PCNA 4KIRA 4L9XA 3IV8A 3CS2A 3KM8A 3PNUA 1FWJC 1NDZA 3S2JA 4DNMA 3QY7A 2UBPC 3O0FA 1XWYA 4PE8A 4LCRA 2FFIA 3GIQA 3JZEA 3LGDA 1J6OA 4C6FA 4GBDA 4EP8C 2R1PA 4QRNA 1DPMA 2AMXA 4LALA 3NQBA 2Z2BA 2HBXA 2EG6A 1ITUA 3PANA 4HA0A 4IFOA 1P6BA 1M65A 1A5NC 2QT3A 3URBA 4GOAA 2QPXA 3S2NA 1KRCC 2FVMA 4LCQA 1RJRA 2Z7GA 3LNPA 3GRIA 4KQNA 4R85A 1J6PA 3GTIA 1PSCA 1HZYA 4H9TA 4RDVA 4LH8A 4KEZA 1UIPA 2VC5A 5A6TC 4IG2B 4ERIA 1I0DA 4R7WA 3MJMA 3GG7A 1EF2A 3A3XA 4V1YA 3V7PA 1KRMA 3IRSA 1YBQA 4XAZA 1ONXA 3N2CA 4RZBA 5HMEA 1GKQA 3S2LA 1GKPA 3RCMA 4WHBA 4KEUA 3CJPA 3OODA 4H00A 1M68A 1YMYA 4DZHA 3TN3A 3UR2A 2R1KA 1GKRA 4GXWA 2VHLA 1NDVA 4C6EA 4RDZA 4KEVA 4H01A 1XRTA 4IQJA 1EZ2A 3QY6A 1WXZA 1EJWC 3T8LA 3BE7A 3K5XA 1V4YA 2Q09A 4C6LA 1EJVC 2HQAA 2P50A 4OFCA 1PB0A 1A5LC 1NDWA 3URNA 1POJA 4Z42C 3WYZA 3OOQA 4L6DA 1PTAA 2DVUA 2Z00A 2EG7A 2ZC1A 3FDGA 2F6KA 4GK8A 4ERAA 3LGGA 4C60A 4GY0A 4CEUC 4QSFA 1YRRA 4CQCA 4CQDA 2RAGA 4IGMA 1FWAC 1S3TC 4XAFA 5CH9A 4LFYA 1A5KC 2PGRA 4C65A 1O12A 1K70A 4GX9A 4C5ZA 4NI8A 5HMFA 4HK5A 4HJWA 2Z26A 2Z2AA 1M7JA 3RYSA 2P53A 1XRFA 3AU2A 3UBPC 3MVIA 4WVXA 4LCSA 3HM7A 3IGHX 1FWBC 4IGNA 2D2HA 3AU6A 1FWGC 3MSRA 4AC7C 4H9XA 3EWDA 2R1NA 5HMDA 1ONWA 1YIXA 4CNSA 1RK5A 3URAA 5FSDC 3LY0A 3T1GA 1A5OC 1POKA 3SFWA 3PBMA 4BY3A 3NURA 1BF6A 4KETA 1RAKA 4IFKA 1P6CA 1O5RA 3A4JA 5FSEC 3K4WA 4LANA 2FTWA 2PGFA 3OJGA 3GUWA 2E25A 2I5GA 4LAOA 4XD4A 2OB3A 4JOMA 4C6PA 4LAMA 4DIAA 3B0XA 3GTXA 1R9XA 2YB1A 4QS6A 3F2BA 3T81A 4C6JA 1FWCC 3B40A 2WJDA 4RDYA 2DVTA 2A3LA 3DCPA 4C6KA 4CQBA 4QS5A 1JGMA 1FWFC 4WGXA 2ICSA 4PBFA 2WJEA 4D8LA 1WXYA 4HK7A 4V1XA 1W1IE 3QY8A 4EPEC 4G2DA 1YNYA 2R1LA 2GSEA 2I9UA 4XAGA 3IARA 4C6DA 4BKNA 2IMRA 2OOFA 4DLFA 1FWDC 3B0YA 3MDUA 1EJRC 4LEFA 1RK6A 4B3ZA 1R9ZA 4QROA 2HPMA 2R1MA 2QVNA 4NG3A 3TN5A 4J5NA 3G77A 3SO7A 4GZ7A 3O7UA 4ICMA 3IPWA 4DLMA 1V77A 1K6WA 3ID7A 4GY7A 3E38A 1K1DA 3MVTA 2Z4GA 4GX8A 4KERA 4CEXC 4IG2A 3AUOA 4XD3A 4TQTA 3QGAC 4H9YA 3K2GA 2OODA 4R88A 4C6NA 3MTWA 4G7EB 4KF1A 4CNTA 2G3FA 3WMLA 3C86A 4J2MA 3ICJA 3UF9A 1A4MA 4UBPC 1EJTC 4BJHA 3UPMA 2OGJA 4ERGA 3QGKC 3UR5A 4DO7A 3FEQA 3F2DA 4NP7A 2AQOA 1PO9A 4J35A 2BB0A 1KRAC 4UB9A 2HNHA 2O4QA 4C6IA 3E0FA 4PCPA 2FVKA 3E0LA 1RJQA 1ADDA 5G4HC 4EPBC 3OU8A 4ZSTA 3ORWA 3E3HA 1QW7A 3GU2A 4B92A 3F4DA 4RE0A 2AQVA 3RN6A 1ZZMA 1EJXC 4I6KA 1RA5A 2PLMA 1E9YB 2VUNA 3IACA 4KESA 3TNBA 4HK6A 4PBEA 1UIOA 4H9MA 1NDYA 5AKQA 2D2GA 3URQA 4M51A 3A3WA 1V79A 4QTGA 2PUZA 3CAKA 5LXXA 3HPAA 1RJPA 4P5UA 3E74A 3S4TA 3NEHA 4C6OA 1YBQB 2Z27A 1V7AA 3MDWA 4I6VA 1XGEA 2VC7A 3GTHA 2HPIA 3LSBA 3F2CA 4IFRA 1FWHC 2BGNE 3EGJA 4C6MA 3GIPA 2Q01A 4EPKA 2VM8A 1ITQA 4DI9A 4IH3A 3R0DA 4F0LA 1A4LA 4YIWA 1FWIC 4C6CA 1EJUC 4DI8A 1J5SA 2O4MA 1VFLA 2WJFA 3GTFA 2D2JA 4DZIA 1EYWA 3MKVA 4GY1A 4H9ZA 1KCXA 1FKWA 1NFGA 1KRBC 4GYFA 3OVGA 1RA0A 2Z28A
chains in the Genus database with same CATH superfamily
1HKVA 2ZADA 4F79A 1QPOA 4FALA 3KBWA 1K8YA 3K46A 3P93A 1LYXA 1V3HA 6TIMA 4ZSUA 3UPBA 3OQEA 3KP0A 3IJLA 1OC7A 1F8MA 4CD8A 2ZRXA 4ILSA 1Z32X 4N4PA 4HP5A 1Q7QA 3WFZA 5DT7A 3AXHA 2CLIA 4WJEA 3S6OA 1XM3A 3FJ4A 1AQ0A 2Z6IA 4PTDA 4R3UA 1NWUA 2VKZG 3B05A 2HVNA 2OG9A 3LA4A 1GJUA 1RLCL 4IUOA 4ZXLA 1V02A 2FGZA 2VEMA 1DOSA 3HOJA 3V1PA 3WENA 1LRQA 3FSTA 2GDUA 3F4CA 4BQ2A 3T07A 1H60A 4P7QA 2XUCA 1OCJA 1JUEA 2W0UA 1VB9A 1HP4A 1H5YA 1QNVA 2JE8A 3H24A 3QMRA 3T9PA 4AHQA 3G1SA 5K9DA 1Q7MA 3TLQA 3HB9A 3V75A 4DF0A 1FWTA 5D9PA 3W02A 1JZ8A 3RMJA 1OIFA 3ZM8A 2FFIA 4JKKA 3DHPA 1H62A 4ZTYA 2JGYA 3L2MA 2R1PA 3H54A 1ECEA 4HHPA 1HJQA 1Q13A 4FLRA 4REQA 5CSRA 1XISA 3NL5A 4M19A 3EEZA 1YHTA 4Z0JA 4DHGA 1JQVA 4OKDA 5EKYA 4Q4SA 3S1WA 1MUMA 4MY9A 2PWHA 1B54A 1KQYA 3LM3A 1U5VA 1I0DA 1W9DM 1B3XA 3IRSA 4AG0A 4FNPA 3WUEA 1IEWA 2VRQA 2ZKMX 1QCWA 1VC4A 3G18A 5M1TA 2X7WA 2VFFA 3PWAA 2J78A 2DZVA 1XHGA 1DE5A 3RRXA 1W3NA 1CLXA 1B9BA 4DJFC 3CQJA 3BLOA 3CB3A 4OT7A 4K36A 2CLOA 2JALA 1C8XA 1E0WA 4I7WA 1X6UA 4NZFA 4XO7A 1X1NA 1JDDA 4QLJA 2QCHA 1DWAM 3AQUA 3DHFA 1OK6A 1TQXA 4GUJA 1ZBVA 4PZVA 3UWZA 3WH7A 4M56A 3KWSA 1QWGA 3FA4A 8RUCA 1O12A 4OV9A 3KDNA 2XVLA 5KZEA 1GORA 4WRHA 4E2BA 3W71A 3NR0A 4G5DA 5H8UA 2MNRA 2D2HA 2WNNA 3MS8A 3DHDA 4H9XA 4Y8EA 1MYRA 4W7UA 1DIEA 2C6QA 1J0IA 2XH4A 2OJPA 3VFCA 4XSMA 3GYCA 4PTXA 3TUUA 3M47A 3DOPA 1GNXA 2J24A 1X8CA 2DJXA 1ISWA 3GDRA 4BI7A 4L1WA 4E38A 2GDQA 4JXCA 1OG0A 4TMBA 5D2XA 2WHKA 4MB3A 1P7TA 4PULA 3JUGA 4IL0A 1FH7A 1LZOA 5CKSA 3PZMA 4CN1A 1IIHA 4JTLA 1CENA 4LVFA 3SUUA 4F2TA 3UWVA 3R0KA 3P8JA 4F4RA 3K4AA 4JFUA 2ATSA 4O54A 2PDPA 1KB3A 1PKLA 4LEFA 1RK6A 4B3ZA 1CGXA 4E4UA 2A7NA 3MZNA 4NJHA 5AOUA 1VFMA 1XIJA 3B9AA 2JKPA 1OZQA 3BCJA 4PRTA 5E6YA 2OMAA 3GNNA 1KBJA 2Z4GA 4M5PA 2PTYA 4IG2A 4XD3A 4TQTA 2OTDA 3W1LA 3UXLA 1TVLA 3P84A 4AFYA 1KGXA 2FDSA 3MUCA 3ICJA 3SUVA 3D5HA 4GH1A 3EDFA 1OY0A 3N4FA 1WDWA 7ODCA 4X0VA 3QQ1A 3NQVA 4M6UA 4WXZA 1XC6A 4GNVA 1UWTA 2P76A 4ICCX 3S1VA 3DESA 1Q7ZA 1GOWA 1IT0A 2YPIA 4KFNA 3AYVA 3EPMA 3WMBA 4REQB 4JFWA 3P0XA 3BCDA 4QDMA 1UKTA 1ZZMA 4F9DA 2UWFA 3VNJA 3CUXA 1RCQA 3QC3A 1Q3NA 2YBUA 3IACA 4U10A 3BG9A 4RNJA 4IP7A 4LX4A 4K8GA 3RM9A 1L6FA 3G1DA 2PPGA 3SCSA 3C3NA 4MKSA 4O53A 1PBGA 6A3HA 3V5OA 2AKZA 3KDOA 5EY5A 4MFDA 1JD9A 4QGCA 2CLMA 2G0WA 4B4HA 2XM1A 5L6UA 4K8HA 1DTUA 2DGAA 5I06A 5LXEA 1AQFA 1K8CA 2UY3A 3BLEA 4BS0A 5GQBA 2ZXAA 1RHCA 5IRPA 3ZIZA 4DX3A 1C7SA 4K1GA 5BRPA 3T2PA 1IHIA 3IIOA 1Q6LA 3WKZA 5G2WA 1KD0A 3W28A 2ZZ6A 4WJXA 2X42A 3PWGA 3PZNA 4DZ5A 3ITCA 4B91A 4NZ1A 3WK2A 2CBJA 2XVPA 1OFAA 1TV3A 4U33A 2O55A 4INFA 2V5JA 4QJ4B 2F7FA 1D3CA 5HULA 2BSLA 1R8LA 1JIBA 1W54A 2C14A 1FCQA 1T6MA 2EGZA 3A6OA 3ARWA 3S2MA 5IBXC 3GTNA 1OYCA 1US0A 2EKCA 4XAYA 3CHDA 2VR2A 1S39A 4YLWA 5E6ZA 4UTWA 4GD0A 5FOOA 4PCFA 3TLLA 1XCWA 2BG5A 2DH2A 4LXFA 1AQHA 1Q6FA 2BVWA 1JCJA 3LHUA 1ICSA 2PDCA 3BMWA 3VUPA 3RAOA 2DFAA 2E67A 4O1AA 1M1BA 3H7RA 2ZCGA 1P7TB 1XBXA 3SUTA 3EA3A 2UY2A 4ZQNA 2KAUC 4AMCA 3W86A 2BHYA 3IV8A 2V68A 3LRMA 5F4WA 3EX4A 2GVYA 3PY2A 5EMMA 2ZX5A 3M7SA 3LGDA 4JFTA 1QFEA 2VXNA 1TQJA 2HISA 5AYZA 4M3PA 2E8ZA 2QVHA 3IJDA 1L2UA 2R14A 1ZHAA 4WKHA 3LERA 4FI4A 4GUFA 2CLHA 3RO6A 1VCFA 2XSXA 2Z1VA 1M65A 1A5NC 3HO8A 4N9BA 1SZGA 3NOYA 3CPRA 2CIPA 3UGRA 3TTOA 3UW6A 2QPXA 3WEMA 2OGYA 4O11A 2INEA 2VENA 2WW5A 1RQEA 4IG2B 1S2VA 4R7WA 5H8PA 1J10A 4Y9AA 1AVAA 4O8AA 5HMEA 2DIKA 5TBOA 3NQMA 3W7EA 4H00A 2D0FA 1PE1A 1KFEA 2VGIA 3BV4A 2DV0A 1QNPA 2WSKA 2IS7A 3SW6A 1US2A 1EZ2A 1TE1A 3H12A 1ODUA 1Z69A 4RV3A 3UJ2A 2QDGA 1XBVA 1A3WA 2Q09A 3GR8A 3AFBA 3TV8A 4Z42C 1RXOB 1XIGA 1XDJA 4YCOA 3WD3A 1TPC1 3DBPA 2Z00A 5LHFA 4FEZA 5ABHA 2BVTA 1SZFA 2WNZA 1K8XA 3EX6A 3GW0A 1UJPA 1OSEA 4PYSA 3N3TA 4HCHA 4PUWA 5CH9A 3RLHA 1V93A 4ZGYA 5JU6A 4I9AA 4C5ZA 1JZ5A 4GFIA 4PCSA 1WOBA 1Y5VA 3SCUA 4PL1A 4M24A 5ECVA 2V5KA 4JHZA 3DZ1A 4UR7A 1TV2A 1R0MA 1FWGC 3UNDA 1AODA 4MKVA 1W3IA 3TAKA 2Y85A 1TPDA 4S3KA 1RK5A 4DB7A 3QOKA 3ABZA 1HJXA 2XFWA 3OYZA 5F2MA 2OOGA 3CH0A 2VYOA 3KL3A 1QK2A 4ZQOA 3LB0A 2PI6A 2I5GA 5G1MA 1QATA 3OLDA 1NFPA 1FWCC 2TSYA 4GCAA 3PPHA 1EPVA 2PC4A 3USZA 2C19A 1Z8AA 4TOQA 1Z89A 3N6HA 2VVNA 4HHHA 4RCXA 4CLMA 3UJEA 1TFVA 3HG4A 4CD5A 2ZUVA 3H2OA 1TTQA 3WDQA 1YNYA 1TUXA 3MT1A 3T05A 2JBMA 2BDQA 4L4LA 1DORA 3W2NA 4C6DA 1NQ6A 5DT5A 4GGBA 1O5QA 1WXJA 1S3HA 1U33A 1TE6A 5EPDA 2BX7A 1R86A 3PBYA 3IPWA 3N3MA 1I60A 3FVMA 4KERA 1RSCA 1R30A 2ZZ2A 1MSSA 1MW2A 4Y7EA 1OINA 3GWQA 1WZMA 1IXPA 4RW3A 4PODA 3OPSA 5J8LA 2WNWA 3AISA 6XIAA 2W3ZA 2E1DA 3VMNA 4ZB2A 4UBPC 3W2KA 3XISA 2GGHA 3MO7A 2DT2A 3R79A 3KBVA 4QAIA 1T8XA 1LQ0A 4GJJA 1OQFA 3VKBA 3VNLA 4EWJA 3HURA 4AZCA 1EEPA 1QUMA 3PZIA 4HA4A 4ZO8A 3DH7A 1FDJA 4A35A 1XLHA 3Q2DA 4NX0A 2F2KA 4U28A 4MWAA 2ZBTA 4HNVA 1S1PA 3HQOA 2FLIA 2QKFA 5FEPA 1R3SA 5I78A 2H8XA 3KTSA 4NAEA 3PAJA 5DCDA 4DRSA 3VZXA 3HPAA 1KCZA 4TTGA 2FB3A 2V69A 5A6MA 2ZXQA 4HJFA 5KTLA 4L4MA 3UZWA 4U5IA 2A7RA 2XTKA 3IK2A 1FWHC 3TQKA 1V3JA 4MDOA 2RJGA 3TTEA 2EPKX 2E8YA 4UTJA 1DJQA 3N9RA 4DI9A 3R0DA 4LB3A 1A4LA 3SN4A 1N8IA 1W8SA 3BZGA 2O4MA 1H4PA 4O17A 1DJGA 1UBSA 3FLUA 4BEUA 2BHUA 4DYEA 4QLKA 2JEPA 1XH1A 1LJYA 1GVFA 1T7LA 5DELA 3QOMA 4P61A 4FAMA 1VBRA 1ENUA 2Z28A 5C7HA 1AW1A 4L1XA 4OOUA 2PA6A 4AWEA 2BV9A 1FFRA 1W1ZA 3EX3A 4O19A 3B03A 3N15A 5DFAA 5T91A 4I7VA 3N13A 4PUMA 1CB2A 3FSUA 1OFQA 2NQJA 4LC6A 1XIEA 1V3IA 2HBVA 5D37A 3VOIA 1DBTA 4PMYA 4ATWA 1QBAA 5G4EA 4KRZA 3LX9A 4L64A 3W26A 1HL9A 1LCOA 3N2BA 1UC5A 4AISA 2WHLA 1VS1A 3WDPP 3DENA 1ZP4A 4GYKA 4XD5A 3E5PA 4RPPA 3IVSA 1J9YA 1UR1A 1Q8JA 3PJTA 3E2QA 3RHGA 4N9CA 1DYSA 2F38A 2DVXA 1FWEC 2GWGA 1VGAA 3GU1A 2QCCA 1WDRA 2OQLA 4LAKA 1I2QA 5I3IA 5K9XA 1CXKA 4GC3A 3EOOA 3WY1A 4H9UA 4EF9A 4KIRA 4DBWA 3GHRA 2BXZA 4M0XA 3BG5A 4WOQA 4DNMA 1PYMA 1ZBKA 1MUCA 4S3EA 4NNBA 2XZ9A 3GDBA 1KFWA 3MKCA 4QRNA 2MANA 2BHZA 1V6WA 3FHAA 2P5NA 3SQLA 1GEHA 1LLWA 1LWHA 4HA0A 3WIJA 5GNZA 2OFJA 3R58A 4QXIA 2PDIA 5U4NA 1TPEA 1ZLPA 5JBDA 3T42A 3LYEA 2C79A 3MP5A 1XX1A 1VRDA 3GRIA 5D2WA 4H6EA 4GQBA 1UIPA 4ERIA 1BD0A 3VKAA 2QUVA 2YKKA 3AYRA 3V7PA 3RCNA 1VF8A 2QJIA 2D20A 5AC5A 3ATZA 3R25A 4E2DA 2OSXA 3AROA 3TA9A 3KEHA 4LBRA 3UVIA 3UR2A 2R1KA 4GXWA 1DWJM 1JCLA 4KEVA 3L2LA 2ZTJA 2Y8KA 3QM3A 5D2TA 4K8EA 3HG2A 4KFOA 1FBAA 4AZCB 2XH2A 2O7QA 4MZ8A 5HBFA 3AHYA 1X8FA 3VD9A 3SB0A 1PTAA 4PH6A 3UEQA 3WQFA 2F6KA 2D69A 4MWAB 4C60A 3V5CA 3DHUA 1EQPA 4Z1DA 2J7EA 4XBKA 3R8RA 1KKRA 1A5KC 3MCMA 4WDTA 5LNSA 4NAEB 3ZT7A 4HK5A 2I9EA 4DO5A 1M7JA 5CZKA 5FAGA 1U1UA 4C1NA 3CYVA 3I3BA 1U1HA 3GX9A 1GHSA 3B4UA 4LJ3A 1EQCA 4BWLC 1HW6A 1JD7A 3DG6A 1FH8A 4GJIA 2ZQ0A 4L9ZA 3H2NA 1XLCA 4GI8A 3O06A 1POKA 1W9VA 4O1DA 1L2QA 2G95A 1XYMA 4YCPA 4UTTA 4XKMA 1OADA 1VAHA 3PP7A 2PF0A 2PP1A 3GVRA 3MWCA 1PKNA 4GZJA 3OBAA 1N8FA 2G4FA 3GAYA 1TZZA 1TR1A 4C6JA 2DZAA 3COTA 4US6A 3W3OA 3O3RA 4FR6A 1RR2A 1V0LA 1QRQA 2GSHA 1XJBA 5C55A 4IXHA 3DC0A 3DU0A 5EL1A 3DFOA 1VFUA 5HR6A 4QISA 5CPLA 1YXCA 2GQ3A 4G2DA 2DSKA 3HGRA 5G1YA 2GSEA 2W5FA 4XAGA 1P0EA 2BP1A 3B8IA 3IARA 2PLKA 1GTHA 1XINA 3AI0A 2OX1A 2ZZ3A 1VR6A 2V3GA 5XIMA 4PMUA 2POTA 1CBGA 4LUJA 3W9ZA 3W73A 1W56A 1E51A 3FCPA 3MCNA 2EQDA 3E5BA 1D9EA 3AAMA 1LQ2A 4AD4A 3WX7A 2PWFA 3VILA 3LXCA 2W91A 3B0PA 1K1DA 3CU2A 4PEEA 3R43A 1GQNA 5I3DA 3VPLA 1YPFA 2ZX9A 4N6EA 1O95A 3WEZA 1IR1A 7REQA 1JRCA 3CUIA 3SCQA 4FZIA 1CXEA 3L9CA 1HKKA 4EACA 2BY1A 4GMEA 4HQVA 4GQGA 3SR7A 3THDA 1OG6A 3FA5A 3TSMA 1I45A 3QC0A 1ADDA 4HB7A 1BPLB 4E2VA 1Y5XA 4OUIA 4EVZA 4JQ3A 2ONEA 2PURA 3QVQA 2IXVA 2FVLA 2IQDA 3N2MA 3KBJA 1NDYA 3M0ZA 3CWOX 2D2GA 3BG3A 4X2PA 2GLKA 1XYZA 1RQBA 5AC8A 3C2RA 3BOLA 1UC4A 3MDWA 3A64A 3BJTA 1OYAA 3E9AA 4D8AA 1QO2A 5H6HA 4NRRA 2PTWA 1Y0EA 3L4YA 1XLKA 4F0LA 4YIWA 4LYQA 3OEXA 2F84A 1VFLA 2WZEA 3L0GA 1EHAA 3WNNA 2QNEA 3IJQA 4IWWA 4O1CA 2YCLA 3AUJA 3QPEA 1E3ZA 2VDGA 4MKNA 3G1AA 4B15A 3EWCA 3DC8A 7ENLA 2B81A 3MSDA 3BSGA 3KBMA 2DSVA 3VD3A 3LU2A 2XFFA 1H51A 3W7MA 1F05A 5D8WA 2Y0FA 2TAAA 3AMKA 4PEKA 4ZMGA 3TX9A 4C6QA 2OWXA 4J3ZA 1MW1A 5CAKA 4QE1A 5A8QA 1ZSXA 4C1NB 1K6AA 5IFTA 3CZLA 3K1GA 3T2QA 3MPGA 1REQA 4LPCA 4HMCA 3T0DA 3LPGA 3BAXA 5B7ZA 3HG5A 3W1RA 4Q4KA 1SW7A 1XFBA 4D6JA 1LLZA 3TYUA 4GKTA 1NY1A 1M9HA 3LHVA 3MKKA 4QCFA 2VDHA 3T0TA 1TIMA 5A5WA 1JYVA 3ZR5A 2ZUNA 3B0VC 3TZFA 4JHMA 2DZBA 4GYPA 4L80A 4I8DA 3WUGA 2YZRA 1TELA 3BARA 2QXWA 4YXGA 3QRHA 4DJDC 4HMDA 5EFDA 1ALDA 3ZLFA 5REQA 3C0QA 1C3FA 4XZBA 4R27A 3NPVA 1UA3A 5KMYA 1XRSA 3AHTA 3WD2A 4WSKA 5AECA 4Q32A 4AIOA 3LV5A 1UHVA 4L61A 5HAOA 1BXNA 3GQYA 1BWLA 3NZ1A 3QLDA 1ZCCA 4N42A 3KCLA 1RP8A 4NF7A 1KFBA 3P62A 4UTMA 1RLDA 3HQNA 3WLJA 2IXUA 2PU0A 3Q65A 4HCDA 1X97A 2YW3A 1XXXA 2QULA 1M41A 2ZRWA 2EJ1A 1VFFA 1J0HA 3PZTA 2WCGA 2Y61A 4W85A 2Y2WA 5K3VA 4F0HA 1WDSA 4PMJA 2FB2A 4H7ZA 4GC4A 3CT7A 2OR2A 1H63A 4HYWA 3BAWA 4MJ2A 2IPGA 3NSMA 3QBUA 3TN3A 7REQB 5CG0A 3RUBL 3VINA 3ME3A 3H22A 1M7XA 3CUFA 3OZMA 1EP1A 2QZRA 5A6JA 5E09A 4HN4A 1RBLA 1UR8A 3UWWA 5I23A 3TR2A 3G2GA 3TR9A 1POJA 4L6DA 3M0LA 2DVUA 3VIOA 1PVNA 2X0YA 1IZJA 2YSWA 5FJPA 2CLKA 4Q7NA 1K70A 4HPHA 5CGMA 3GHTA 4A6GA 1H7PA 1EF3A 2Z26A 4GCXA 2DZWA 1FOBA 3ARQA 3T0AA 1JPIA 1AL7A 3EXRA 4MLJA 1ODZA 2CPUA 2QEZA 4AD0A 4OOZA 1R5YA 3CPUA 2J77A 3EWDA 1VCVA 1VIWA 1JYWA 3VE9A 4TU1A 4C1KA 2V30A 2ACUA 4PB4A 3SFWA 3C5QA 3LBCA 1CW2A 1GVOA 3GB6A 3M4HA 4FB7A 3DYPA 2YCLB 4ZBCA 3VX1A 1HFBA 5AZ0A 2PGFA 4GE8A 4XVDA 2QDEA 4ORIA 1A0CA 1DHKA 1XP3A 3CMGA 5D9MA 4PUUA 3QH2A 4LWWA 3F2BA 4X61A 4EANA 4UNKA 2OT0A 2C7FA 3U0HA 3VNMA 1OIMA 5LIXX 4QFUA 4UWMA 1UR2A 5HWJA 3CAQA 1XW8A 2NUXA 3P14A 4GI4A 3V0TA 2PF8A 2R1LA 1DJIA 2D2OA 1H11A 1REQB 1O5KA 1T0OA 5KINA 2BBFA 3B0YA 1EOMA 1F4AA 5D2YA 2NX9A 2D3NA 4J5NA 3WEOA 2NVDA 3O7UA 4NIRA 3FA3A 1WDPA 3G0UA 1GYLA 1DP0A 2NQ9A 3STEA 4CEXC 1XUUA 3FKRA 1PAMA 3RG6A 1QMLA 4BQ4A 2C18A 1KFKA 4CNTA 2V2CA 3WMLA 1H1NA 3QR3A 3A5VA 1LF1A 4IGHA 1SU5A 5HJXA 5REQB 2X1SA 1KA9F 1FWSA 4YYCA 3QPZA 3MYOA 4TMCA 2J9ZA 3ARZA 3A22A 3QGKC 4Q8TA 3PJWA 7XIMA 3TXZA 1S1RA 4Z2GA 2Z1SA 1A50A 4PCPA 5E0KA 2YDRA 3PVFA 3C8FA 1TPVA 3W7PA 3F4WA 4JGDA 3W83A 4C91A 2C71A 2PSNA 3T4WA 3M5XA 3H23A 2NW0A 4NKCA 4JN8A 4HK6A 2ZUSA 1IGWA 4GISA 2JK2A 4MG4A 2WSQA 1XGZA 4W7WA 4LUIA 4ZE4A 1JNEA 4NX5A 3OP2A 3PZQA 3RLUA 3C56A 5IM51 3S5ZA 4WGHA 5I0DA 3NQCA 2VD9A 3R10A 1XLJA 1SO3A 4JIEA 3LRLA 1J11A 4IFRA 3NA8A 4TV6A 3I6EA 3QFEA 1I8JA 1EB3A 2BXVA 2WK2A 4O16A 2QMKA 2J25A 2X40A 4V27A 1DJYA 3IGXA 2E9MA 4YNGA 1NF0A 4AD1A 4H9ZA 4CQ9A 1KCXA 4AIUA 1KRBC 1K8ZA 4NU7A 4FXJA 4R33A 1RA0A 1YNQA 4E5TA 3W1UA 5BWFA 3MYPA 1MXDA 4DZAA 3E2VA 3GZ3A 1E0UA 4JTEA 4O0QA 1OFPA 2XVKA 3M0JA 1SJAA 3BV7A 4D2JA 2GOUA 1S46A 3OA3A 2XN0A 2XGIA 4I9MA 4HZMA 1UJQA 4CCDA 1U5JA 2RKXA 3KBSA 2XVGA 3EWYA 5DN1A 2NZLA 4O15A 4DXXA 4EXBA 1P6WA 3TEVA 5I3HA 4B5VA 2ALRA 3B9NA 1V51A 3EXTA 3U5UA 1LTDA 1NVMA 4LC8A 4OGZA 4HMNA 3VFLA 1JXJA 4C5YA 5A6AA 3NZPA 1PIFA 5C71A 2J7CA 1KR1A 1I0BA 1H7RA 1Q2RA 3WQDA 4G56A 2XFRA 1PWLA 1TZ7A 5KZDA 2Z29A 5HUPA 4J3UA 3K8LA 2VFEA 3AWNA 2OLAA 4HCLA 5IHSA 5BRBA 1W1TA 1VZWA 1FA2A 3S2JA 3H2AA 5J04A 2GGIA 3SUSA 1XR2A 4A3UA 5BNKA 3M5YA 1LP6A 1TJ0A 2EBNA 1RPKA 3NSNA 3NQBA 5D38A 4F8XA 3VDBA 2VMFA 4GVHA 3WF1A 3M0MA 1UA7A 4LS0A 3R1ZA 1F2JA 4XKYA 3BWWA 1KNWA 3PBGA 5CSUA 1B90A 4LCQA 4A3QA 3W38A 4M6QA 3B0UX 4R85A 3H55A 1E40A 5AVHA 4H6KA 5CAHA 2V9DA 2GGJA 4V1YA 1XLGA 1JULA 5AY7A 2FJUB 4OECA 4FNRA 1JYNA 4MSSA 4YTUA 5HQMA 3I7QA 3O2LA 4ZOAA 2NX1A 3PUGA 1WO2A 4HOZA 1E73M 3ABQA 4QP0A 1EX5A 1XYAA 2DT0A 3ZLGA 4IQJA 2AOSA 3GVGA 1SYTA 3CV7A 2ACRA 5DRCA 3EWBX 1Z3NA 1B0IA 4H2HA 4PCTA 3WYZA 3LI0A 2EG7A 4CU8A 5CCZA 4EXQA 2YCEA 1V3KA 4CQDA 2OKTA 3CO8A 3SDOA 2JIWA 1SGJA 3A4WA 1EGMA 2ZX7A 3CXOA 1MQRA 3IJ8A 5D05A 4C65A 1VEPA 1EH9A 3NO5A 1GJPA 4JEQA 4WCJA 4PTVA 5BU9A 1W31A 4FSAA 1FRBA 3WNOA 3EEGA 3UBPC 2WVUA 4R53A 2RDUA 1R6WA 4FS9A 3MV11 3SJ3A 1HVQA 2CZ5A 1EYEA 3C2YA 2QJNA 1TO3A 1RY0A 3PJXA 4MNMA 4RE3A 2OSWA 3ES7A 1VLIA 4ZEPA 1QHZA 1W1VA 5BXRA 2V5LA 1VEOA 1G4PA 4IFKA 3CL6A 5CPQA 4LNYA 3K4WA 1W9UA 3U2OA 3OJGA 4P8XA 2ISFA 1DJHA 4DIAA 3LPPA 3CIVA 1F8IA 2AAAA 4GPNA 4W8AA 2A3LA 1UR3M 5CSYA 5FJUA 4IHCA 1H2JA 3KX6A 1WUFA 1QNSA 3GXNA 1D7FA 5FEXA 4TTUA 3WBXA 4GVGA 5DY2A 4F0KA 4Q8OA 2ICSA 2E0PA 1M6JA 1HUVA 3EDJA 1TX0A 3GFXA 1D3HA 2EPLX 2OYLA 4KCWA 3EDEA 3CT2A 3RILA 3MMDA 3ALFA 1UP0A 2WLZA 2HXTA 1VRXA 1ZJIA 4BZYA 2ZXBA 4DLFA 3K30A 4GZEA 2XGBA 5BCAA 1IZCA 2WHJA 2CITA 2QUMA 4UQ9A 5BU6A 4KCUA 4GFSA 1PV8A 4NZ4A 4R34A 2Y4SA 4XZIA 4IM4A 3LG3A 3MBFA 2WPBA 2E68A 1O7AA 3QR1A 3FK4A 1W5QA 3VGFA 3OGVA 4PUKA 2GFTA 3O6DA 4JS3A 1W5PA 1JDCA 3MANA 4HOWA 1OF6A 5A8OA 1TJ1A 3G1FA 3WJSA 2O56A 3MP3A 1GVIA 2VI0A 1MEIA 3N73A 3P60A 3GNXA 1BHGA 1TWIA 2D23A 2E40A 3TW7A 3NZQA 2AQOA 1PO9A 2BB0A 1UKOA 3KCJA 1TA3A 5DY3A 1AD4A 3CUJA 2O4QA 4JIRA 4FXSA 3W7OA 1VBUA 1XSKA 2FH8A 1JEZA 3CC1A 1XIDA 2OCZA 4K7VA 3ARSA 1QNRA 3N4AA 3U5YA 4RE0A 2GJPA 5GPRA 1V02E 1W3KA 2VR5A 3C0SA 3PULA 2E6DA 1RA5A 4XKYB 3WLHA 1DJZA 3KOXA 4JY8A 4NT0A 3AYSA 5K4XA 2YDAA 2XN1A 2ZZ5A 2FZBA 4Y9MA 1W2VA 3APYA 4FK9A 2XFYA 2FTPA 1UD5A 1JCMP 3M16A 3OG2A 3S4TA 3NEHA 1JAEA 1P0NA 2WMHA 1TSIA 4J1OA 5I2UA 2PODA 3GTHA 4E8DA 4FR1A 3VOGA 1X98A 3EGJA 3W7GA 1H5VA 3C2FA 4S3AA 3MSGA 4NJIA 2J8TA 1DWHM 3BDKA 1E6ZA 3IIPA 1FP8A 1E56A 4F9JA 1AJ2A 3QW3A 4ZCWA 3LI1A 1HKWA 1SZRA 2GVLA 5LA2A 1TV4A 3CV2A 2PDFA 1CECA 4UMCA 2NVAA 3KFTA 2J7DA 1KFCA 4X9YA 1FKWA 1SMAA 3A9IA 4GWEA 2ISSA 3AALA 2VGFA 3HV8A 1WOAA 4N2YA 2ZX6A 3VGGA 2QPUA 5AHMA 4LQ1A 1JCXA 2FYMA 4MUPA 3DIPA 3GAKA 3LGEA 3CYJA 4ACYA 2XINA 5D9OA 4DBSA 1P1MA 4XZHA 3FYOA 3UXDA 2FGLA 1CYGA 4IPLA 1C90A 3ZWTA 1VJIA 1T99A 3NQFA 4F0SA 2PDQA 4W4QA 3B8SA 5JXQA 3LS9A 3T6CA 2DW7A 1ME9A 2WKGA 3HPFA 4HNCA 3UNTA 1NSJA 3TMLA 1WV2A 2ZA1A 4UFKA 1XV8A 1SW3A 1WX0A 2PWUA 4D6IA 2VNCA 2ADAA 3O9NA 4LVDA 2WMGA 5LHEA 3ABXA 4AU0A 5F7UA 4IFKB 4NILA 2OSYA 5D33A 2DSWA 3FN9A 2YB4A 2BOFX 2ZRYA 5AYYA 1R9YA 1FKXA 2PAJA 1IWBA 1IWPA 4NZ5A 3M0VA 3QTGA 4O18A 4AQLA 1NOUA 4W87A 1QTWA 3RM8A 1NDZA 2P8BA 1LOQA 1XICA 3FYYA 5JQ9A 3NQ7A 3GIQA 3M0HA 3ARVA 3RR4A 1K02A 5LNWA 4EP8C 1DPMA 3KRUA 1XLBA 4LALA 3LENA 1VJSA 3TK7A 4PTMA 3WQ4A 4A8LA 4EAMA 2I5QA 3DDMA 2FZMA 3URBA 4GOAA 1MMFA 1EXPA 1C8QA 3VM5A 1GOKA 1ZY9A 3KHJA 2CLFA 3SSJA 4QR6A 3IUDA 4HSHA 4LH8A 3GVVA 2P0IA 2QCMA 3A12A 2A4AA 1CGWA 1ONXA 1AUSL 1JFXA 8A3HA 1CTNA 1QI5A 3CQHA 4N9DA 3G8RA 2ZXDA 3IVTA 2VHLA 1XSIA 3WELA 5HQEA 3WDIA 3WL1A 3G1XA 4Z17A 3GG0A 1TA3B 3BICA 3D0CA 2VGBA 4JL1A 4UQEA 3NO1A 3AZRA 3TTYA 1W9PA 2P50A 1LWIA 2Z1KA 1O5XA 1QBBA 3EMZA 3UG8A 2GVEA 4Q3MA 1DE6A 3TA6A 3OVRA 3W53A 1P5BA 4CU7A 3I4EA 4H8HA 1F3WA 4NI3A 5DCBA 1J0JA 1XG3A 5ENLA 3B8WA 4LFYA 4U3CA 4CUCA 4GQRA 1X6LA 4GX9A 2PWGA 5FKYA 4LW7A 3OGRA 1BSIA 4Q33A 3N9KA 3UG4A 1DIKA 3NNTA 4A8RA 1V6TA 1E6XM 3V0SA 5A2BA 3N25A 3WH6A 3KVKA 4QJ5B 3QHNA 1MRQA 3OHMB 2NQ5A 1S5NA 3URAA 3GHSA 4G9PA 3VDGA 2O7SA 3SCTA 4JTSA 3W7CA 4MLRA 4UCFA 5AYBA 4S2CA 2QGHA 4DJED 1E70M 1EHNA 2FPYA 4O0KA 3EWXA 1K3UA 1V5XA 4B2DD 4XD4A 1DQUA 1M53A 3ARUA 3ARTA 3GC5A 3LUTA 4HNNA 5C9RA 3IV3A 2X30A 3RX2A 3M6YA 1EP2A 1UCWA 5DRIA 1VLWA 3S3GA 4AZ7A 1WXYA 3S6TA 2NXHA 4KWUA 2CZDA 3BW4A 1R7OA 1JCTA 4J4KA 2VRKA 4GIAA 4DPPA 2YA0A 4BKNA 1QR7A 1UR0A 2POZA 5CLTA 1JXKA 3F4VA 3W7KA 1OJXA 3CHEA 1JDAA 3D3FA 1C9WA 3OA5A 3W27A 4BA0A 2C1GA 5KZMA 3EOUA 4GINA 2YFNA 1E55A 4GX8A 1W37A 3K8KA 4TUFA 5BWAA 1AH4A 3WQ6A 3NXLA 1NH6A 2ZIDA 3AC0A 4IIGA 1SSGA 4KCTA 4BJHA 4CCZA 4UCGA 4X0NA 3BQ6A 1FDYA 3WF3A 2OYMA 3KS5A 4NZCA 1MFVA 3THCA 4WLCA 8CGTA 4UB9A 2I14A 4QJ1A 3HU7A 5F2IA 4JN6A 2CBVA 1DWFM 1WAUA 5AYIA 3GNOA 2XSBA 3DBNA 3FJLA 3GM8A 3F4DA 1LWJA 3HBLA 3GG8A 3RN6A 3WLLA 1CI1A 3LPOA 3MJYA 2A3EA 1WKDA 3O1NA 4KESA 2WCSA 1UIOA 1V0MA 3URQA 4M51A 1KTBA 2VD8A 2OELA 4HSOA 5LXXA 2VCBA 1U30A 1KV8A 1MWOA 1R3TA 4ZR8A 4HKPA 2YXGA 4RV8A 2RH9A 2P1FA 1RD6A 2PDUA 4LTSA 2DZTA 4I6VA 2V8ZA 3E6EA 3LSBA 4IX2A 4GA8A 4AB4A 1K9EA 3G22A 9XIAA 2VX6A 1C9DA 3W24A 2VM8A 1THFD 3I68A 2OO0A 3QHOA 4FNUA 1E9IA 1WBHA 3BUVA 2E7FA 4DUXA 2WJFA 3KRZA 4IUGA 3N29A 4BF9A 4FLQA 4ZODA 2A3HA 1RALA 1CXFA 3V16A 3DN5A 4JIHA 1OC5A 4URIA 4AC1X 4NHVA 3S83A 5BXTA 3B4YA 4Q8QA 3L0NA 2ZA3A 4F0RA 3A24A 2YLAA 1C8YA 4FPSA 1YPXA 4KT2A 5SWUA 1VH7A 1U5HA 1EOKA 1WBJA 1KBLA 2P3EA 1A3XA 3GUGA 4ZOBA 2INZA 1AJZA 1XYFA 4K1WA 1HO1A 3L4WA 4V28A 2WSPA 2V2DA 4H6QA 2RDTA 3SM0A 1SZNA 3TTQA 1TX2A 1B2YA 3BAJA 1A5MC 2XIOA 4IPPA 1XCXA 4CD7A 1XPYA 2IKIA 1KC7A 3WLKX 3QZAA 3O05A 2PTDA 1X6NA 5C9XA 2GUUA 1QNQA 3HMJG 4XBJA 1NP2A 4B90A 2VCAA 4QIUA 4MPKA 2UY5A 4R9OA 5K9CA 1TV7A 1ZENA 1EZWA 4DJEC 3LZ5A 1SVDA 1ZRQA 3LTYA 3SIZA 4AMAA 3VX0A 1P1XA 3TOPA 5A8PA 1FWRA 5CJMA 3GKFA 1UUQA 1S5VA 2A6LA 1K7XA 3W29A 3LMYA 3DFPA 4Y9NA 4JX4A 3C2EA 2PGEA 4NXKA 3NXFA 3OVQA 4FO4A 4Y6GA 2W66A 1J5TA 2JIEA 2UBPC 4GO8A 3AIBA 4J40A 5K2ZA 4Z2LA 3JZEA 3NTYA 3M43A 5CGTA 2HMCA 4CCEA 3CZ8A 3LQGA 2ALDA 1PWMA 4PMQA 1UD4A 2P8CA 2DZSA 1MNSA 2HBXA 4QAWA 3O07A 1V7YA 1Q6DA 2CEQA 4IFOA 1BQCA 1K4GA 1CZ1A 5BOFA 2OVLA 3GBEA 1VBGA 1E1EA 4U3AA 2VZTA 4A2RA 1V03A 1GYNA 3PZGA 2DQWA 1E4MM 4A2SA 4YTSA 3GG7A 1BKHA 1ZALA 4H6RA 2AQWA 1VIZA 4AY1A 1E4NA 4IIEA 4B5NA 1DV7A 3RF9A 2P88A 2RHGA 3UCCA 3UETA 3B8VA 2PD9A 1Q6OA 1NDVA 3L4UA 4O50A 4X3ZA 7TAAA 1PHQA 3L4TA 2NXIA 4EXAA 2TMDA 5T26A 1ISZA 3TSBA 4FLSA 4GACA 1EWEA 2Y7DA 2ZWZA 4QE5A 2G96A 2VT0A 1IIGA 4IOTA 2DJLA 3CMFA 5GNXA 3GY1A 1LDCA 2RAGA 1MXGA 3GLCA 4IGMA 1SQ7A 1DWIM 1FHDA 2AGTA 3P81A 3WLMA 3ZR6A 3H53A 3VKCA 2HS8A 4YMZA 3A3HA 3W74A 3I10A 1TWWA 2YYUA 3MUZ1 2NQLA 3IGHX 2WC7A 1ZNNA 2TODA 1VD6A 3MCOA 3OGSA 4TO8A 3MI2A 5MHBA 3I3DA 3VOCA 2BTMA 1F9CA 4HPNA 5C9ZA 4YHEA 1ZGDA 1BF6A 4W7VA 2AL1A 3MUAA 2V38A 2YYTA 4GIRA 1TMQA 3E0VA 2OWCA 4WDWA 2WZIA 3CWNA 3CZEA 2FTWA 1KWKA 1R2SA 3BL3A 4DBEA 2E25A 2F8QA 4MWAE 2HSAA 3RU6A 5FL1A 1RBAA 2ACSA 4HYRA 1P48A 3RNDA 1A0EA 3LTPA 2QIWA 1NIUA 1XDLA 3UZ5A 2WHMA 3AMGA 4K68A 3F03K 5CSSA 3NPWA 3PBVA 2J62A 4WGXA 3L0KA 3RX3A 3L4ZA 3LCLA 4OU1A 5EA9A 1W1IE 1QI0A 3WBWA 2BVDA 4L56A 4KCVA 4JTJA 4YVPA 3BOFA 2WQPA 3V35A 3KP1A 3BLPX 1P0DA 2XIBA 3ITYA 4GXPA 4PRRA 2XIMA 1JR1A 2V0TA 3PUDA 3V5FA 4NG3A 1K7FA 4AVNA 5LIYX 3UXKA 2BOEX 3ITTA 3EDKA 1EX1A 4L4OA 3WQEA 3TYCA 4R9XA 5CPSA 2VURA 1QO5A 2YDSA 1BAGA 4IMDA 4KPLA 1IQ8A 3VGHA 3MTWA 2FZNA 4XWUA 1FP9A 2CWXA 1RBOB 3HJZA 3QZEA 5I07A 3CQ0A 1TZ9A 2DEPA 4OZOA 3M1ZA 4LVGA 3MY9A 4P7NA 4TX9A 4ERGA 4GLEA 3IVUA 3VU2A 3SSZA 4F3HA 1K03A 4J35A 2YR1A 1R7AA 3WMSA 2NT1A 4ZO6A 2QCEA 1QHOA 1B3VA 5G4HC 1HJSA 1TB3A 1GQLA 3E3HA 3TMQA 4ADUA 4AHOA 1VPXA 4W5ZA 1G5AA 4Y2WA 1SJBA 3QEZA 1DJXA 1UH3A 2VUNA 4X2RA 2HK0A 4Q8UA 1H0GA 2QF7A 3EOSA 3QQWA 4DXVA 1O60A 3A3WA 2I57A 2XDFA 2PUZA 3WUFA 3V4BA 1JYXA 3AIQA 2XH0A 1X38A 1AH3A 4YJ5A 3GKAA 3JS3A 1CIUA 2YOCA 1XGEA 4UTFA 4ZL1A 1KFLA 3Q45A 1E6SM 1SM9A 5KEZA 3GO2A 4ZENA 3R94A 4IJCA 3VMPA 3W7LA 1JZ7A 4QEEA 3C61A 2CBUA 1UWSA 1CB7B 4AZBA 1B3YA 4WR3A 3GTFA 3U2EA 1FHLA 1MDRA 4JTDA 2ZUWA 5IHRA 3S5NA 2UV8G 1UR4A 4HIBA 5DO8A 3ARRA 1GVYA 2Y6ZA 3EX1A 4RW5A 3LK6A 2YZ5A 3NVTA 2E6AA 2X7VA 3CEPA 2PRLA 3WJXA 3E96A 2W92A 2ZOXA 3OG3A 1FTXA 4RNFA 2D24A 4UFIA 3AIUA 5HR7A 5HWNA 4MM1A 2XGZA 1R46A 3O8AA 3RGTA 5HANA 4AX7A 4M8UA 1LQAA 3AXIA 2W61A 5LNVA 4XZWA 5C6MA 3TTSA 3TN4A 3PAOA 5HWMA 4BCEA 2DP3A 5CPNA 4UQBA 2I7GA 3FDKA 1E5JA 3KTCA 4IF2A 3NPUA 4JDYA 4UTIA 3TXVA 1KLYA 3BLFA 3TZNA 2Z0IA 1PTGA 1TJRA 1OCNA 3ISIX 3W1QA 2A85A 2VUYA 3UXIA 1CNVA 1F6KA 2PDKA 3RPTA 3OYXA 2PWDA 3VIGA 3AYTA 1UPMB 1KGUA 3V18A 2OZTA 1LRTA 3FOKA 1EC9A 4N7QA 1BVNP 2B4GA 4ZE5A 2Y5SA 3O0FA 4AIEA 1KGWA 1XWYA 3EZ4A 5CG7A 3GXIA 4ZVJA 2D73A 4D6CA 1B4EA 4X9SA 1SW0A 3IEBA 4M29A 3H6OA 1F4HA 2H3BA 2WANA 1ICQA 2FQIA 3OHIA 3OB8A 2WVSA 4RNHA 3JR2A 3VKKA 5KZ6A 2QUNA 1FVPA 2C91A 3LNPA 3QPYA 2AL2A 3FKKA 3NL6A 3VYLA 3VCRA 2CCRA 5XIAA 4O10A 4CNNA 4CVWA 3OZYA 2GJXA 1PZ3A 2R6OA 4JIPA 3S2LA 3RCMA 2PTXA 3HZ3A 3ZLHA 3EXSA 4DWSD 3T08A 3U8GA 4NJGA 4US5D 1B3WA 4PL2A 4IMAA 1GKRA 5JMUA 8XIAA 1ZCOA 1JCNA 3SRFA 4DWSA 4US5A 2OT1A 3KBNA 3CLWA 3L66A 1PB0A 1A5LC 4Z2JA 3S2CA 3OOQA 1PX3A 1WA3A 2PMQA 3ELFA 4ERAA 2J8FA 1VBJA 3H70A 1A3HA 1PIIA 3TVAA 1S3TC 2TPSA 1WAWA 2EKGA 1XLAA 3LCXA 4PMXA 4I5RA 4NI8A 2V81A 5I79A 5A2AA 3EA2A 3SIMA 2HE5A 4QE4A 4WY0F 4UC5A 3TC7A 2Y7GA 1GG1A 3QV9A 3WLRA 3T4CA 5HMDA 1YIXA 3TP4A 3LY0A 1NWRA 4H83A 1JG9A 4HZ8A 3HF3A 3LXAA 2H90A 3NDZA 2HTMA 5C7VA 4JCMA 4KS0A 1AZ1A 3B3DA 4AZIA 2CNCA 4NZJA 4DUVA 1VYPX 1UWRA 4PRWA 5I00A 4WX2A 4OE7A 5FF7A 4AD2A 4JEJA 1N7KA 2Y89A 1EFZA 1UB3A 1WNOA 4RDYA 2QDDA 1W1B1 2DORA 4IIDA 4YYFA 3UERA 1GUVA 3TQPA 2ZX8A 4BHYA 4PBFA 1KXVA 3DI1A 3VO0A 5DF0A 4AZGA 1SO4A 1H50A 3BW3A 3L67A 4ZB5A 4UQCA 4FIQA 5IDZA 4LV9A 2DT3A 3CMJA 2OXNA 1EJRC 1LG1A 1W6TA 3W6LA 4RZ5A 4RZ6A 2FZ9A 3TN5A 4FNTA 4GUIA 2CLEA 2EEXA 3BK0A 2XG9A 4DM2A 2CZFA 1EJ7L 1NTHA 2ZRUA 4ZFMA 4IQDA 3WFLA 3ZXWA 1OWQA 4J2PA 1XC4A 3FX4A 2I56A 1YTEA 2Y5JA 3STPA 3KAOA 2QDHA 2G3FA 4UXDA 3KOYA 1GZ1A 2E4TA 5C2XA 4LS1A 2X16A 3MC5A 4HZ7A 1ZAJA 2Y5EA 3VOJA 1DKWA 1O66A 4GJ1A 3KLKA 4H3DA 4H04A 4A3RA 4MIMA 4AYGA 4CVUA 2Z7KA 4DO7A 4C7GA 4JTGA 3F5LA 1R85A 2PS2A 3LN3A 1LBLA 2VO5A 3E0LA 4IP4A 1W3JA 2D22A 2FHCA 4ZSTA 3RLGA 3NQ2A 5EGRA 3OIHA 4Y90A 3THUA 3CUZA 2AQVA 2OZ8A 1JF5A 3SY8A 3W7RA 2PLMA 1KM3A 3TNBA 5KITA 2P3ZA 3CQKA 1TJPA 1TIWA 5FD0A 1Z41A 5AKQA 3LCHA 2X2GA 1RH9A 2AL2B 3ES8A 4GNKB 1ZB5A 2ODOA 3VNYA 4RKAA 2O9TA 2X2YA 3OZOA 3B04A 2GJXB 2C8NA 4L7ZA 4GH3A 2ZE3A 3KVMA 2VFDA 3GNDA 5AHLA 4FF7A 6XIMA 1LOSA 3UT0A 4DI8A 1NU5A 1EDQA 4DWSB 2R82A 3SJNA 4DZIA 5G1TA 5A6LA 4I7UA 1YKWA 1OFEA 1FH9A 5EB8A 3STGA 3VA8A 1F61A 1TV8A 4HD5A 3RIKA 2WQDA 4ES4A 1PKYA 3DFQA 1C7TA 2CZVA 4UQDA 2C0HA 4DUOA 4RR4A 3S1XA 1B31A 1TYGA 2PDJA 2DUZA 2Y63A 3P3BA 1RQHA 1UH2A 1KM2A 2GPTA 1A5SA 4C6BA 2H8ZA 3WBYA 5DBTA 2QV5A 1IT8A 2VC6A 5J5DA 4YTRA 1UZ1A 3A4AA 4LUYA 1HTIA 3QSRA 1OZMA 3I3EA 2BVYA 2Y1HA 4MAZA 3LOTA 3QLLA 3AXXA 1SJCA 4PA8A 3WQWA 3M7WA 2D0HA 3UZXA 4AEFA 3EOEA 3FY1A 1W1YA 4GVFA 2GZXA 2O92A 4MOZA 3S1GA 3LSCA 3G24A 1GVSA 4IMCA 2CETA 4RE2A 2QS8A 2Z25A 3CUGA 4EPDC 5DQPA 4K7YA 3AIWA 3L7RA 4TX6A 1FWJC 3N04A 2OQHA 3GR7A 5GJNA 3V3WA 4JFVA 1GOOA 1ML1A 2HDJA 1PTDA 2VR4A 5ABGA 1HIZA 4PFMA 2E28A 4RLIA 3WNLA 2NVCA 1ITUA 3T8QA 2XH7A 1PDZA 1W8GA 4EOUA 2WKLA 3QR0A 7A3HA 2EHHA 4HNTA 3WNPA 3GG1A 1O6IA 1X96A 1F3EA 4K6AA 1K4HA 2CYGA 3PTQA 2NT0A 3W1MA 4K39A 4WQ6A 3QMTA 1BRLA 2IKHA 4QNEA 1EF2A 1YBQA 1V0KA 4TR9A 5MKGA 1ADSA 2QLYA 1BTCA 2Z1BA 3TYZA 1GKPA 5D09A 2J7HA 4XTDA 4UTWC 1VP5A 3WBEA 1LRNA 1BYAA 3N1AA 4Q6XA 1GHRA 3CGTA 2ZUMA 4Y96A 3BJSA 3BGGA 3CQIA 1NM9A 3BE7A 4CKQA 3I6RA 1F3XA 4OFCA 3TWBA 5D02A 1UD6A 1JZ6A 4RJEA 3II1A 3WF0A 3OO2A 3WCZA 3L12A 4CQCA 3EKLA 3OBEA 3ARXA 1A5UA 3TONA 3SY1A 1XLFA 1US3A 2J4GA 3EWZA 2CW6A 4HJWA 1QASA 5AC7A 1HGYA 4IIBA 1G69A 1XRFA 3WH9A 4TX8A 1N55A 4OBTA 4PR4A 1B1YA 3C0JA 4MWAD 1N2VA 2YBTA 1B3ZA 4D6GA 3AU6A 3S5YA 3GD6A 5FACA 4O57A 4PMNA 1UYQA 1GYMA 2ZTKA 1I2RA 2INFA 4KETA 2ZUUA 3OZPA 5FI8A 4QM1A 5G4WA 2PCQA 3CTLA 4JTUA 4LANA 1TV5A 1GK8A 1EP3A 4LAOA 1K9FA 1GQJA 2O9PA 4B9ZA 3M46A 2GJNA 1EPXA 3A23A 2X0HA 4S3FA 3MUXA 3TU9A 5E9XA 5C9UA 3B9DA 4HU0A 1E0TA 2GQAA 2VZUA 1KM4A 1R47A 3FJ6A 3DI0A 3RJYA 3AHZA 3AS2A 3VK5A 3RM4A 3GNRA 2REQA 3DKLA 4E4PA 1VPQA 2ZRVA 4MFEA 1R9ZA 4QROA 3OTRA 2HPMA 3TOYA 4RNIA 2PDYA 4JYDA 4RPQA 4GKLA 3U57A 4UNLA 1GOXA 2V6AA 4AD5A 2PDXA 4AWTA 1IEXA 3BQ5A 1QI4A 1W5MA 2TYSA 3QGAC 5C8BB 4R88A 3UU0A 4J2MA 4P7OA 4EX4A 1M01A 1EC7A 2L5HA 3ABOA 1A4MA 2FPVA 1G01A 4GXMA 2UY4A 4TVDA 1GG0A 2GGEA 3CPGA 1F07A 3UG5A 1XYBA 3WK1A 2J47A 4MB4A 3BPWA 3BOXA 4A3HA 4RX0A 4K2SA 1RJQA 3VD7A 1EL3A 1Q4WA 4D6HA 3SN1A 3TROA 4KGLA 4NY2A 5DANA 2PD5A 2FMNA 6ALDA 4AAJA 1ZBCA 3WQ8A 3DKJA 1DJNA 1QOQA 3S1UA 4C1LA 3E0IA 3U6WA 3GXTA 1V79A 2QJJA 3P67A 2V5DA 3GNPA 1BRLB 2YCKX 1YBQB 2VOMA 4Y9OA 5C0QA 5MKGB 3HQ1A 5I77A 4AZHA 2QJMA 4QHRA 3F2CA 2X05A 1F5ZA 4GABA 3VC6A 1JDFA 2WWDA 1XD1A 1C93A 3CZKA 5F4XA 5I3KA 2Q3RA 3NGJA 2G37A 1FWIC 4WKAA 3UQNA 1WPCA 3DEQA 4D9PA 4GZIA 1E72M 4EE9A 3CAVA 4YPJA 4M7TA 2W79A 1EYWA 1TMLA 5G5IA 3AS1A 1TKKA 3TCEA 3G1YA 3GXPA 3WQOA 1IXNA 1GW9A 4B5SA 5DMMA 4AD3A 4JQ1A 5MF5A 1PPIA 1WZAA 2J9YA 4H2CA 1ECQA 1BKSA 4J3SA 2XM2A 2B7QA 3Q37A 3CL8A 4AZ5A 1ZL1A 1SR9A 3ZJ8A 1E9ZB 3IIZA 4W5UA 3ZT5A 1V0NA 2VWSA 4QG6A 3T7VA 2WAGA 1JF6A 4HMEA 1ZQ5A 3M5VA 4W86A 5A94A 4MWAC 2WSYA 4JKMA 3GC4A 5HOSA 1IE7C 1LT8A 3DGBA 1CXIA 1BYBA 4H4IA 3BMVA 1Y7VA 1IF2A 3E49A 3HV9A 1UKSA 3WQCA 3GFYA 4DJFD 1W2PA 4IIHA 2ZZ4A 3VE7A 2WZMA 2EG8A 5H91A 1QXLA 1KTCA 1DJWA 3KZPA 2W4XA 3PR2A 3PZVA 3IJIA 1UW9A 1JAKA 4DJFA 3SURA 1ZJBA 3RDKA 1UWUA 2DW6A 4H9VA 5I02A 1HNYA 4LUTA 2CHRA 2WZHA 4ENLA 1HP5A 2FJKA 1UWQA 1NELA 2GQ8A 1QI3A 3JRKA 2HVMA 5C2CA 1PZ2A 1E0XA 4C6FA 1YDOA 5C9WA 3IAQA 4IXXA 4QDWA 1S2AA 3IIVA 4GNJA 4P8WA 2Q8LA 2REQB 2O0TA 3NM1A 4MNLA 4V33A 2PGWA 3WLNA 2Z6JA 5CPTA 3HJEA 2W63A 6ENLA 5HNUA 1M5WA 3AMLA 3A4XA 4JHOA 2ZUTA 2A0NA 4D72A 1PSCA 3GS6A 2YX0A 1L6SA 4KEZA 1PUDA 3TQ0A 5KSWA 2PBOA 3N2CA 1JQXA 1E1FA 4HZ6A 4JZ5A 4JIIX 3SUWA 4HPXA 4UZSA 4KEUA 4MTVA 3S6DA 3NUKA 1MW0A 3VZZA 4MGGA 3LTSA 3W7QA 2YL9A 2CLPA 3RITA 3H7VA 1WXZA 2EF9A 5HJYA 4Q22A 3T8LA 2CWNA 2AMGA 2YCJA 1W1PA 1NOWA 4LUSA 1MO0A 2R9RA 3ZJKA 3FV9A 1XL9A 3BGJA 2ABAA 5DEZA 3UP8A 4GK8A 4AEOA 3SRKA 1PZ0A 2Q8XA 3CIXA 3PB0A 2I1OA 2WBGA 3AS0A 4CEUC 1GT8A 1VHNA 4NSBA 2FH6A 3KW3A 3GZAA 1MZHA 1J01A 3IJ7A 3HIJA 5HMFA 1F3TA 3Q58A 4A4AA 4Q8VA 3R8GA 1RZMA 2P53A 1GONA 4S38A 4WVXA 1DL3A 3HM7A 5CZTA 1KKOA 2DQXA 3VABA 1FCUA 1T40A 4Z1YA 3UZYA 3S9YA 2EPNA 1Z42A 4I9JA 3GXDA 5C70A 1BLIA 4CNSA 1TCDA 4Q8PA 1OT1A 1BVZA 1PYFA 3DG7A 3NEVA 4KKXA 1G1YA 4UUIA 4ROPA 3I65A 3QYQA 4NXSA 4CU6A 2VQTA 4C6PA 5TD4A 3WSUA 3APTA 4IPIA 3S5SA 1R9XA 4D71A 2WB5A 2YB1A 1VPYA 8XIMA 4CD4A 7TIMA 1HXJA 3B40A 2OPJA 1XDMA 4O14A 4S2BA 3BW2A 3QTPA 3NAVA 5FL0A 4M82A 4NASA 3GDKA 4Q4OA 3VC5A 3LMZA 1RCOB 2I9UA 4JQ2A 1YEYA 2IMRA 5DXXA 1EXBA 2BLEA 4MY8A 4JN7A 4RK8A 3KZSA 1T5AA 3V1HA 4GZ7A 1S2TA 3CEUA 3MVTA 2W6RA 2BASA 5BW6A 1UG6A 4H8NA 3BLLA 3AIRA 1DEDA 1VJZA 5LNUA 2ATMA 2H9AA 1R3RA 2OODA 2QUUA 3ITLA 2NSOA 2YL5A 3PWIA 3AMDA 5DMNA 2DH3A 4G8TA 2YJQA 3MI6A 4BK9A 5LNRA 1HGWA 5EU9A 4LUTB 5PTDA 4UIOA 3M9YA 1HKIA 2ZYFA 3GR4A 3CV1A 2C1IA 4UTTC 3STFA 3BTNA 3G1RA 3KS6A 1Y65A 6REQA 1GZJA 1F6PA 1GPWA 3QKEA 3GIYA 1L0PA 1LORA 3KL0A 1I75A 4G1KA 4Q4RA 2OEMA 1FCBA 3S9ZA 3B8TA 1XLIA 3MW7A 4JX5A 4EPBC 3OU8A 3L4VA 3GU2A 3TW6A 4XO6A 5IBXA 4JTFA 4U31A 3NIYA 2AGKA 2JKEA 3W88A 4PUDA 3F5KA 2W27A 3JVAA 2OZ3A 3W1NA 3L21A 5CXPA 2VFHA 3CAKA 1F74A 5FF2A 2DUXA 3JZUA 3RX4A 5FEWA 3TIMA 3TSDA 3UFYA 1J0YA 3M0XA 5ABTA 2VC7A 2OU4A 4WKFA 2CERA 3O15A 2NV2A 4YWSA 5BXSA 3IUIA 3C3UA 1O94A 2G97A 4LF1A 3NWRA 3HPXA 2WPGA 3ITGA 2W67A 1YLVA 3WLOA 4DAFA 3UPWA 3XINA 3R13A 5DLCA 3U7VA 4KWSA 1UASA 4FXRA 2WZTA 3MKVA 4LY8A 4LUSB 1MRAA 1B57A 3UWQA 4ZO7A 3U3HA 1Q5MA 3QJAA 4QJ3B 1XIBA 3B9OA 1E3XA 3L5MA 5M2FX 1OM0A 1H49A 1ONRA 3IJ9A 4Z1CA 3C2OA 4G7FA 4LS2A 2I5IA 1UBPC 2BMBA 3RU8X 1E43A 1OGGA 3IANA 4M1BA 1J79A 2WLYA 1J4EA 1G94A 3SCOA 5E5CA 1W9BM 2GOKA 4YWIA 1Q8AA 1XG4A 1W5OA 2WVVA 2G3MA 3ZFHA 1PS9A 3FIGA 4GHRA 4JL2A 3WQVA 4MUZA 4DWDA 1WKYA 3NQ6A 5BZAA 3FFSA 4G6CA 4S23A 1MVYA 1V3MA 4DYKA 1IWAA 4LU0A 5E93A 3UY7A 1W3TA 1TPWA 2ANUA 1JZ4A 1OEPA 3SGUA 2GWNA 3LHYA 1WDQA 4E6MA 3VI2A 1O1HA 2A7PA 3DG3A 3WF4A 3EPNA 1WCGA 3K1DA 2YDQA 1LUCA 2IQ0A 5BOEA 2QIIA 5H2ZA 3MV01 2QJGA 2EJAA 4JNYA 1XGDA 3QY7A 1OFBA 3UZZA 1UUOA 3DFNA 1ICPA 2GYIA 3UCQA 5FF0A 1PIGA 2CXEA 4ZOEA 3WN6A 2GGGA 4JTCA 2BFGA 3QYSA 3H2CA 1DTNA 2HK1A 4MYAA 3LPFA 5HNNA 4HPJA 3IGUA 1XYLA 3H7UA 4W89A 1TMHA 3WG6A 1V08A 4POCA 4RDVA 3WQ5A 4AWSA 1FHUA 2H9AB 4UMBA 3PZUA 1BG4A 1GKQA 4IQLA 2J7BA 2HJPA 3KL5A 1YMYA 1NP0A 4JFSA 4DF2A 4LYKA 5TAOA 3NL3A 4DBDA 1QJWA 4C6EA 2FMOA 6REQB 2GL5A 1B30A 1XH0A 3NGFA 3QY6A 4GYPC 1WQ5A 1QWKA 1YDYA 1V8EA 1EJVC 2NV9A 2ASHA 2Y7EA 2YL8A 5A8GA 3R0UA 5LA0A 2WMIA 4MB1A 3I7SA 2WKJA 4CQ8A 5HXMA 4B5UA 1I6NA 1XLDA 1JGIA 4W8BA 1GWJA 5JBEA 1OX5A 4J28A 2DIJA 3KOFA 2Z2AA 3UXAA 1E71M 1HKMA 3UCDA 4JYEA 3WDJA 1QDSA 3AU2A 1B4KA 3SADA 3AJ7A 3TYEA 2Y8UA 3VD4A 4B5TA 1I1WA 4B5XA 1EKOA 3N6QA 5I24A 1V6YA 3T1GA 4HPGA 2LLEA 1U1JA 3PTDA 3RXZA 3HMCA 4BY3A 4HNLA 2DSZA 1AJ0A 2JQXA 1AK5A 3N18A 1G6CA 1P6CA 4UR8A 4JY9A 5EMJA 4F66A 5FSEC 2ZICA 2ISWA 3SY5A 3W85A 4D1IA 4KIEA 3UA4A 3RR1A 2PWVA 1SFSA 4XX6A 2J66A 3VIJA 2B7NA 1NOFA 1J2WA 2V63A 4LVBA 1JI2A 1HX0A 3BLIA 4QS5A 2V3FA 3W0KA 4IJRA 4N9EA 2H3DA 1SMDA 4UNIA 3S5OA 3W00A 3KE0A 4OIFA 2ZA2A 1C91A 3VDCA 1KLZA 3ITVA 3O6CA 3R4IA 4Q8WA 1FWWA 3NO3A 3IK4A 2WVVB 1OF8A 1CXLA 3LEPA 4LGXA 3CUHA 3DERA 1KBIA 5CC3A 3P0WA 2QCGA 2IW0A 4YU1A 3W25A 1VFSA 3EWWA 4UTUA 4ACZA 4QX4A 3QQ0A 1EA0A 4V15A 1OBAA 3PK7A 3MSYA 3KTXA 3W87A 4IPJA 3H2FA 4YN5A 3C86A 3UF9A 4DEFA 1J2BA 5BROA 1P43A 3H2MA 1LUCB 4L6HA 1XD0A 2CESA 4UFJA 3P5YA 3VM7A 1J96A 1P0BA 2ZE0A 3UR5A 3SEPA 3IAPA 2VFGA 3AJXA 1UQYA 2GVGA 1BFNA 3WNKA 1BXBA 4HSNA 4DYJA 2Q71A 5C5YA 2IUZA 3W6MA 4AUBA 1TPUA 3EKZA 4JTAA 3PPCA 2R94A 4HHMA 4I9TA 3FW6A 4HGXA 3ORWA 4D6FA 3UZJA 5L9FA 3TJIA 4AY7A 4ZTXA 1EJXC 2A2IA 5HATA 1I1XA 5AHEA 3QZ6A 4H19A 2PCEA 3VIPA 4H9MA 1CWYA 3U4AA 1E9LA 4NJKA 3NSXA 4N02A 1WE5A 4JNMA 4S39A 3DECA 5CLWA 3ANVA 1JJKA 4MZYA 4EAYA 1GGOA 4Q8MA 1V7AA 3A13A 1K77A 3FXGA 3T44A 3ZSTA 4ORMA 1G4TA 2HPIA 1WZLA 5TIMA 2J9XA 1AA1B 1UUMA 3W72A 3LQLA 4FOUA 1ZFJA 1KXQA 3CBWA 3PFMA 5TNVA 5AVNA 3KUMA 3HFTA 3KVJA 7CGTA 4JTKA 1ME7A 1ZU8A 3T40A 1XI3A 1IEIA 3R11A 4JYFA 3RFAA 1ZBWA 1XYCA 2B0MA 2FZ8A 2VJXA 1NFGA 2PDGA 3O16A 5A69A 3CHCA 2PTZA 2WMIB 4MMWA 2PDMA 3W07A 3CASA 3CIWA 3ITOA 1X1ZA 3WMCA 4NNAA 4KRUA 3W37A 2G50A 1SPQA 2XWEA 2KZHA 3SECA 2F61A 3SGGA 1H7XA 3HGSA 4UMAA 3U2CA 4A22A 3ENLA 1NF7A 4O1EA 1ZPTA 1CLKA 1UOKA 4CQAA 1LM1A 1KTNA 1T96A 2F9RA 2UZ9A 2WYSA 2E1WA 3F5JA 4HN8A 4DVOA 1EBGA 3MMUA 3WK0A 1Q45A 5AC4A 4QDPA 4TXEA 4XISA 3WZ0E 4XZNX 2ZDRA 4S3GA 4HA3A 1ZAIA 4FP1A 4Z2HA 4MJMA 3W7HA 3P7YA 4IL2A 1CGVA 1G7UA 1ONEA 1EC8A 3H4XA 1E6PA 3WH8A 2PB1A 2G41A 3WLIA 1OB0A 4L9XA 4C90A 1BVWA 3ATYA 3EDDA 3N12A 3VTRA 5HNTA 1EIBA 4O13A 1J12A 2MUCA 5M17A 4OTKA 4NAFA 4IMEA 4D6EA 1TPH1 2OZ0A 2ACQA 1UH4A 5C54A 3RK8A 3OLEA 1WKEA 4ICNA 3PJUA 5LGZA 3BO9A 1V6UA 4W8LA 2VZVA 4MNKA 4QNWA 3DYMA 3NJ3A 3NVDA 3QFWA 4BWLA 1DXFA 1YDVA 1MW3A 4H8VA 1GZGA 3LHWA 4C7FA 2V2HA 4ACZB 1YNPA 1GOQA 2G4JA 3GTIA 4HBKA 4A3YA 1SFJA 4PUNA 4J3VA 5JH1A 1IXOA 3T55A 3MJMA 1TG7A 1N82A 1KM6A 3EPOA 4FNSA 1K9DA 4NL1A 1D7KA 2DZUA 3C0LA 2QHAA 1EUAA 3OODA 1D8CA 5CC6A 2GJLA 1SFTA 4RDZA 4JBRA 8TIMA 5GJPA 2BY2A 3WD4A 1KFJA 3BSMA 2GVJA 2YA2A 2Y62A 5D4YA 2ZC8A 3E02A 3K5XA 5HPOA 1X39A 1V4YA 1PL9A 5F2GA 3B06A 4XQ6A 1QHPA 1BEUA 1R3VA 1BQGA 1E4LA 1PKMA 4Z1BA 3URNA 1RP9A 4UR9A 1GVQA 3TJ4A 5LIWX 3FDGA 1D2KA 1JDEA 1H61A 4GY0A 3QXBA 4HNOA 2J79A 1YRRA 1Q6EA 4QG9A 2Q02A 1BF2A 6PTDA 1NARA 2PDWA 3FAXA 1XIFA 3MU7A 3FGCA 3QV6A 3HGOA 3MHGA 4HA1A 1ZAHA 5CPMA 3MP4A 4B9YA 3UD6A 2VVSA 4IGNA 3BAIA 3WQGA 3O6YX 3TNOA 4AC7C 3EB2A 4PTWA 4Z2IA 1ONWA 3GDMA 3OIXA 1A5OC 4RUBA 3VGDA 1EGVA 3AWOA 3BJFA 2XU2A 3UWEA 3TYAA 1H1ZA 1O5RA 4LVAA 3N2OA 3LCIA 4FX8A 1UZ4A 1MI3A 3VOFA 1H1YA 3PTKA 1NWSA 2ZVRA 1PX8A 3GTXA 2CXGA 1L6YA 1QT1A 3P2VA 2VQUA 1F76A 1I4NA 2VEKA 3OW1A 1DHPA 1XRVA 3ZJ6A 4Q6JA 4O8RA 5A6KA 4FHAA 2HE8A 3W01A 2J6VA 3UJSA 2XISA 3NQ8A 4QITA 1RY8A 3NL2A 3QY8A 4LF2A 1B5TA 1FWDC 2RDWA 3NYDA 1GQKA 2HV5A 2QVNA 4EF8A 3AS3A 1UKQA 1F6YA 4D6DA 2X1RA 1GW1A 2PLCA 4YHGA 1V77A 3LLDA 1K6WA 5I03A 2P10A 2QAPA 2RFGA 1GTEA 4BEQA 3AUOA 5FEZA 2VFIA 3P6LA 4CCCA 2AKMA 4QQUA 2DZXA 3FXYA 3TFXA 3ONCA 3PTMA 3LHZA 5A1AA 2XSAA 4JTIA 2HS6A 1W9XA 5HNRA 1BYCA 1G4SA 3AZTA 1E6NA 3Q4DA 3QF0A 4LYRA 4BF7A 4NAFB 4XSLA 2IPJA 4GIYA 3SQSA 5RUBA 3F2DA 3PM6A 3G6MA 5LA1A 1SO5A 2DSUA 3E0FA 4FMVA 1ISYA 2FVKA 3DFSA 3I4KA 4MYXA 1TVNA 3EMCA 4B3KA 1J93A 2D3LA 4K3ZA 5BYWA 1AMKA 3MO4A 1SZEA 1QVBA 1RVGA 3WDRA 1FWNA 3GSMA 4OUEA 5LGXA 2NSXA 3N34A 2J27A 4B3LA 2QV4A 3FJNA 3B97A 3IWPA 3BURA 3RJXA 3E12A 3E74A 4A8IA 2RGLA 2DT1A 4DJDD 1UWAA 1EWDA 3CTTA 1NEYA 2TRSA 1E4IA 4DXKA 2OKOA 4J9JA 1WP6A 4H8UA 4C6MA 1MZRA 3GIPA 6TAAA 1WUEA 2QMJA 4JIQA 4DJDA 1SJDA 3CLMA 2X1IA 3M64A 5I7GA 4O4VA 3SCWA 3VNKA 3L68A 3KRSA 3PN8A 3G8EA 4H1ZA 5DMLA 2D2JA 1A5CA 1ME8A 2B7OA 1QW9A 4FNQA 1E5NA 3N2XA 3WF2A 4LEQA 3CL7A 3PFRA 4IMGA 4OHQA 3QN3A 2G3NA 2Q6ZA 2XIQA 3R8HA 1TPB1 1LBFA 2V5CA 3PPGA 4F0MA 5E0CA 1PCWA 1LT7A 3XIMA 4MZ1A 4OBRA 1EJSC 1OFRA 1OX4A 2Z1XA 3T0CA 4JDBA 1A49A 3WNMA 3STCA 2F6XA 3ZS4A 2WC3A 3FGCB 3SCVA 5BOOA 3W75A 4PN2A 4B5WA 3GH7A 5JIWA 1YPIA 5CEWA 1FY6A 3TDFA 3S8HA 3AHXA 1QNOA 1TTPA 4CN6A 3P82A 3ERPA 4OBSA 1UPPA 2A1YA 3P74A 3BVJA 3BXWA 2YXOA 5FJTA 1F73A 2YL6A 4PMVA 4XV0A 1PEZA 2V3DA 5CPOA 4D1JA 9CGTA 4WK9A 1JVNA 3VIMA 2XPKA 1AW2A 5I3FA 3HTWA 1Q6QA 3BCFA 2PU1A 3PG8A 5T9BG 4XUYA 4AVFA 5AHNA 4MHBA 2C3ZA 3GW3A 3CS2A 4EK7A 3KM8A 1Q2SA 3D47A 3PNUA 2NX3A 4ATDA 3K4DA 1S2WA 1SR0A 3QW4B 3PUOA 3W1TA 3KOZA 1PXGA 2X41A 1OD8A 3S47A 5A8NA 4WZHA 1JNDA 3WLQA 1FCVA 1W3HA 3W7DA 3MWAA 4M80A 2EG6A 1TR9A 1TWDA 1DVJA 3VVGA 3M44A 1C29A 3PZ9A 4PTNA 1XCFA 3S2NA 1KRCC 2FVMA 3PHAA 1RJRA 2Z7GA 1UP2A 4XBSA 3H4WA 1W0MA 2BZNA 5AFDA 2EPOA 3QV8A 1D8WA 3A3XA 5JH2A 1V3LA 4QLLA 4XAZA 1JPMA 4ZZ9A 4PC8A 3W4RA 4WHBA 3CJPA 3W1AA 1EDGA 3L23A 1H7NA 3ZSSA 2VX7A 3W76A 3S46A 2VEFA 4FX6M 2P0OA 3R5EA 2QW5A 2O9RA 4AXNA 4I90A 5AC6A 3ALGA 5HUOA 4C6LA 1X7FA 3K8MA 2EAWA 4KGJA 1NDWA 1H0IA 1MQQA 2ON3A 1RVKA 3W2UA 4NYYA 4IZGA 3CZJA 3LGGA 1TUFA 3TYBA 4NYUA 4LOCA 4P2VA 4XAFA 1IR2A 3UVAA 4HHLA 1KO0A 2B7PA 5D30A 2E6YA 1G4EA 3B9EA 1MQPA 5CGQA 5J5RA 3AZSA 3JW7A 4JTTA 3P61A 3BLDA 3TFCA 4LAZA 1C92A 3LD5A 2J6XA 3GVQA 3MQTA 3VGEA 1R3QA 4PFHA 4QCEA 3MSRA 4NUWA 2NUYA 3T0BA 1E0VA 1UD2A 5GVJA 2PEVA 3ARYA 3G3DA 4BI5A 5FSDC 2NV1A 3ZJ7A 3VOHA 1HVXA 2EO7A 4O4WA 1Z6KA 3NURA 1XLLA 3CK5A 1UWIA 3GDTA 4XZLX 3SFKA 5FESA 2Q3OA 3W82A 4HVXA 3F1QA 2BNJA 3DFTA 4B16A 3MA8A 3DAQA 3B0XA 3V0UA 2ESCA 5CBIA 2RUSA 4QS6A 5FIPA 2QCFA 3M0YA 4MDPA 1FUYA 3PC0A 4DY1A 4UQAA 3W22A 1ESWA 3VDAA 4M7SA 4PMRA 3EB4A 1OX4B 4ZQCA 3RMEA 4WJ8A 1T8QA 1E15A 2J74A 3SCRA 4DAIA 3BZJA 4UZUA 1WZKA 4L1GA 5H8MA 3O0KA 4WEVX 1YTDA 4XVEA 4U4MA 3G77A 2E9LA 3SO7A 1EGZA 5AYXA 3GXMA 4DLMA 4GI9A 4D8ZA 1CDGA 4GY7A 3W2MA 1W1A1 4S1FA 2FKPA 2HCVA 4H9YA 3K2GA 4AIBA 4I3GA 4GYJA 2EPHA 4F2BA 1AL8A 3WJYA 3UR7A 2CFFA 4RE4A 3UR8A 1N8WA 2QF8A 3OLGA 5AN7A 1JPHA 4O1BA 2A79A 1MXSA 1IGSA 4XZ9A 2PRHA 2EPMX 3IIXA 1JFHA 1B9ZA 2QCLA 3EWUA 2ZZ7A 3ZYZA 4CNPA 4S3BA 2BGSA 3LM7A 4B92A 1IYXA 4IX0A 4CGTA 1WKFA 1XFCA 3NCOA 3R7MA 5FF3A 3AO0A 1W91A 1P4CA 2IPFA 2RDXA 2C16A 2YGYA 3CB8A 3PSWA 1KBBA 3A21A 1ZP3A 2WOQA 3APGA 4PB3A 1Q63A 4UFLA 4R5EA 1GCYA 2PZ0A 1AG1O 4XG1A 4AW7A 2PC8A 3WJWA 2Z27A 3W2JA 1YDNA 3C52A 4HTBA 4H7CA 4GRSA 4QG8A 5DX7A 2Q8ZA 1TWSA 2V5BA 1BTMA 1XF0A 1LOLA 1ITQA 4PMDA 5EMKA 4IH3A 4K38A 4LT9A 1PX4A 2BWGA 4PSRA 1CCWB 3EYPA 3G3MA 4LY4A 1YX1A 3TJLA 3BSHA 2OEKA 3MHFA 4K37A 1XLMA 2ZDSA 3SQMA 3HG3A 1S2CA 1UOZA 2JGQA 2A3AA 2NLYA 4AHPA 4W88A 3GH4A 4FIRA 3NZGA 4EKJA 4OJYA 3ZVIA 4JNZA 1Z44A 4HTYA 1KCLA 4DF1A 1FXQA 4GI6A 3S9IA 2YFOA 3LDVA 4XD6A 5FCZA 1OGSA 2I17A 4KWWA 4JPGA 1RV8A 3MMTA 4PBGA 4YS1A 1C8VA 2GSJA 1FDZA 3FHQA 3NM3A 3LLFA 1U83A 4GGHA 4IICA 2Y8VA 2CC0A 3ABSA 1SFLA 1BYDA 2IQTA 4MPQA 1A80A 2OX4A 2W9MA 1XH2A 1UROA 1XSJA 4LBSA 5HMSA 3D6NA 4RDWA 3N17A 4Q4MA 3TN6A 1JPKA 4UFMA 3LLXA 5D9NA 4YVXA 4DO4A 4E8CA 5BXPA 1JI1A 7PTDA 5I5RA 4JQ4A 4E0CA 3BMXA 4WUIA 4WF7A 4F40A 1JUBA 4MJ4A 3TCSA 3EA1A 2B31A 2PDNA 1MUWA 1FXPA 2WO5A 4PCNA 4XIMA 3HFYA 4FX7A 5A6SA 1XKJA 3W84A 3VKDA 5BMWA 1KCKA 3WUBA 1JL8A 1ZTVA 4PE8A 2OYKA 5HINA 1XQLA 2R91A 1R87A 3PSVA 2VWTA 4YTQA 3LBMA 4BFAA 1W5NA 4KEMA 1G67A 3PANA 2CKSA 1BSLA 1X1OA 3O63A 2WJZA 3LNMA 4LRTA 2VL4A 3LXBA 2QT3A 3ZO9A 1G0CA 1YE4A 2FFCA 1UR9A 4O52A 5FJRA 4F48A 3D46A 1A47A 3N11A 4WDXA 2Y24A 3LCFA 1OHLA 3ABRA 3E2RA 4KQNA 4KBXA 4DUWA 1I2PA 4X22A 4PUJA 4PMZA 2VC5A 5TF0A 1JZ3A 1KRMA 2C13A 2X09A 2ZZ1A 3D3AA 1M68A 4DZHA 4S3DA 1MDLA 2VC9A 3CZGA 3RO8A 2PE4A 5H1WA 4M6PA 1XRTA 2RGMA 4YL2A 2JEQA 1EJWC 4DBUA 1WB0A 3QV7A 2F2HA 1E6RA 1XBZA 2D0GA 2YBVA 3P8IA 2A3CA 4W84A 4GQ0A 3HA1A 2VEPA 1EUNA 3WLSA 2BY3A 1CGUA 2VEIA 2VGGA 4UTLA 4BI6A 5HQLA 3QHMA 1UMYA 1Y5WA 4HYVA 3UWUA 2BGQA 3VMOA 5G2IA 4QSFA 2WNQA 1ADOA 2J7GA 1FWAC 1QW8A 2PDLA 4JX6A 5IXEA 3RLVA 4MF4A 3MI3A 2PGRA 3G0SA 4JICA 4L9YA 3UJRA 3KRBA 1BG9A 1KM0A 2PZNA 1V6XA 3QGVA 3TC3A 3WBAA 3RYSA 3M41A 3THQA 1IZKA 4XZMX 3VGBA 2VELA 3WL0A 4LCSA 1FWBC 2OLHA 1BWVA 2VZOA 6CGTA 1DWGM 3R6IA 4O1FA 4X63A 3T09A 2R1NA 1XS2A 1ITCA 1LROA 1YADA 2ZFAA 1GOIA 4ZO9A 1QI2A 2GDVA 3USBA 2XIIA 3CNYA 4A29A 5I09A 1GOMA 1RAKA 2VEGA 2YIHA 1PDYA 4DM1A 3U48A 3A4JA 4RXGA 3TW9A 3VIKA 4IJBA 4WY0A 3GUWA 3IRDA 5GNYA 4PSPA 1QOXA 3OBKA 3INPA 1YYAA 1L6WA 5JVLA 1Q6RA 3DX5A 4JTRA 5F2LA 4CQBA 2WM0A 5U7SA 4J3TA 1A5BA 1FWFC 3FEMA 3ANUA 1TVPA 2WJEA 3W70A 3NQGA 5LIUX 2CLLA 2OEJA 3VIHA 4HK7A 4V1XA 4U2YA 2JFEX 3TH6A 5AHIA 4IISA 5HJLA 5EMYA 4DNHA 2G8ZA 2H6RA 3PB2A 1KXTA 4MNJA 4V2XA 2FDMA 4S3JA 3RPDA 5BMXA 3E38A 3VDHA 1OFDA 4E2OA 1XIMA 1Q66A 3JU2A 4NQ1A 4BF5A 3VNIA 4E4FA 4GO9A 1R2RA 1CT5A 1XLEA 1QPRA