4ERIA

Evidence for a dual role of an active site histidine in alpha-amino-beta-carboxymuconate-epsilon-semialdehyde decarboxylase
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
331
structure length
331
Chain Sequence
KPRIDMHSHFFPRISEQEAAKFDANHAPWLQVSAKGDTGSIMMGKNNFRPVYQALWDPAFRIEEMDAQGVDVQVTCATPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKVLAQVPLQDLDLACKEASRAVAAGHLGIQIGNHLGDKDLDDATLEAFLTHCANEDIPILVHPWDMMGGQRMKKWMLPWLVAMPAETQLAILSLILSGAFERIPKSLKICFGYGGGSFAFLLGRVDNAWRHRDIVREDCPRPPSEYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLGEQKIGGLVLSSNLGESAKDKIISGNASKFFNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
publication title Evidence for a Dual Role of an Active Site Histidine in alpha-Amino-beta-Carboxymuconate-epsilon-Semialdehyde Decarboxylase
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 123
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4eriA00
1XWYA 4DI8A 2WJFA 2OGJA 4IFOA 3HM7A 4KERA 1FKWA 4GY7A 4HA0A 1YIXA 4V1XA 3F4DA 2GSEA 4AC7C 4OFCA 3F2DA 3LS9A 2KAUC 3RCMA 2UBPC 4C6MA 1A5KC 3GTFA 3D6NA 1P6CA 4HK7A 3IACA 2WJEA 1S3TC 1A5MC 1PB0A 2ZC1A 4HK6A 3A3WA 1YMYA 4PBFA 2PGFA 2QS8A 1DPMA 4INFA 1ONXA 3DUGA 2FVMA 4GY0A 4GYFA 1RAKA 1V51A 2YB4A 4J35A 1POKA 4ZSTA 4EPDC 4HJWA 4HK5A 4IFRA 2GWGA 3LGGA 3GUWA 4C6KA 3AUOA 2D2HA 2RAGA 1EJUC 2VC7A 3EGJA 3OOQA 4C6NA 4I6VA 1A5LC 4KESA 1EJRC 4P5UA 1KRCC 1KRMA 4CEUC 3MSRA 3UBPC 1EJTC 1XRFA 3NQBA 3WMLA 4EPBC 4IG2B 1NDWA 3NURA 5FSEC 4H00A 4QS5A 4C65A 1K70A 2OB3A 1BF6A 2HBXA 4GK8A 2DVTA 2Z7GA 3E38A 3GU2A 3PANA 4H9UA 4BKNA 4C6QA 4ERIA 3OQEA 4G7EA 4H9XA 3EWCA 2HBVA 4DO7A 1PSCA 3GTIA 1YRRA 3OU8A 4B91A 2HPMA 4KEZA 2YZ5A 3TN4A 4IGMA 4H9MA 2OQLA 4DLFA 4GC3A 4DYKA 3RHGA 3URQA 3E0LA 2OODA 3N2CA 4LH8A 1PO9A 1EJVC 4PE8A 1R9ZA 1YNYA 4GZ7A 1UBPC 2O4MA 1UMLA 3HPAA 3A3XA 2P50A 2VR2A 4C6BA 2IMRA 4GY1A 4LCQA 4CNUA 1WXZA 1KRBC 4C6FA 3G77A 1M68A 2FVKA 1GKRA 3GTHA 3DC8A 5LXXA 3KM8A 4KEVA 4J5NA 3MJMA 4LFYA 4B92A 3IPWA 4WGXA 4PBEA 2Z28A 4QTGA 1M7JA 4XAZA 2G3FA 1XRTA 3GRIA 3GIQA 2DVXA 4D8LA 3MVIA 4XD6A 2OOFA 3DCPA 2AMXA 4I6KA 5A6TC 1P6BA 2QVNA 4QSFA 2Z29A 1IE7C 3K2GA 3CAKA 2UZ9A 4CQCA 2Q01A 4DZIA 1FKXA 3ICJA 4LALA 1J6PA 1I0DA 2FFIA 3EWDA 3O7UA 3E2VA 4AQLA 3FDKA 1ITUA 3A4JA 4EP8C 1FWBC 3K5XA 2DVUA 3UF9A 4IF2A 3UR2A 1R9XA 3BE7A 4C6PA 1YBQB 3URBA 4RZBA 4C6OA 3IARA 1FWCC 1R9YA 4L9XA 2QT3A 4C60A 1V79A 4LAKA 1GKPA 3B0XA 4LCSA 2YB1A 3WZ0E 4C6DA 4QS6A 1V4YA 1K6WA 4LAMA 4C6IA 3T8LA 1QXLA 2I9UA 1M65A 3E0FA 3HTWA 3ID7A 2R1MA 4QROA 5G4HC 5HMDA 2AQVA 4RE0A 1ONWA 4IGNA 4KQNA 2E25A 4RDWA 4WHBA 4DLMA 4B3ZA 3OODA 2EG7A 2GWNA 4XD4A 4NP7A 3WYZA 4B90A 4IFKB 2W9MA 1RA5A 2PLMA 4XAFA 1O12A 4G2DA 2D2JA 1XGEA 3K4WA 4V1YA 3GG7A 4C6CA 2WM1A 4C6JA 3MTWA 3UPMA 5CH9A 4E3TA 1FWFC 3QY7A 3GU1A 1E9ZB 3IJ6A 4LANA 2ICSA 3CS2A 1PTAA 4NI8A 4TQTA 2WJDA 3UR5A 4IG2A 1QW7A 2Z25A 4DZHA 3AU2A 3MKVA 2Z00A 1RJPA 4JOMA 4KEUA 1FWGC 3LU2A 3FEQA 3NEHA 3CJPA 4UBPC 2I5GA 4C5ZA 3TN5A 2Q09A 3RYSA 1JGMA 3SFWA 3R0DA 3S2JA 2ANUA 3B40A 2XIOA 1A5OC 1VFLA 3E3HA 1ZZMA 3RN6A 1NFGA 3IRSA 3MDUA 4QRNA 2HPIA 3OJGA 4R88A 1V77A 4XAGA 3S2LA 2QPXA 3QY6A 3LGDA 4NG3A 4GBDA 4KIRA 3LY0A 4ICMA 3LSCA 1W1IE 2VM8A 2ADAA 5HMFA 4EPKA 4Z42C 3F2BA 3IGHX 4GXWA 1E9YB 3ISIX 4ERGA 1ITQA 4H9VA 1KCXA 4ZSUA 3MDWA 1J6OA 3URNA 3PAOA 1RK5A 5AKQA 1RK6A 1EF2A 4WVXA 1A4MA 3SO7A 3C86A 1RA0A 5HMEA 4XAYA 3GTXA 3QGKC 4MUPA 1J79A 2GZXA 2D2GA 4LEFA 4H9YA 4CQBA 1UIOA 3F4CA 2GOKA 2VC5A 2E1WA 2R1LA 2FTWA 4LCRA 1FWJC 4BY3A 4DI9A 4RDVA 2R1KA 4GX9A 1NDZA 4PCNA 2Z4GA 3PBMA 4PCPA 4L6DA 3GIPA 3GU9A 1UIPA 4J2MA 4IQJA 4DIAA 3E74A 3LA4A 1A5NC 3FDGA 3T1GA 2F6KA 3TNBA 4G7EB 1YBQA 4CQDA 1WXYA 3ORWA 3AU6A 4R85A 2PUZA 4IH3A 1FWDC 4CNTA 3TN6A 1RJRA 4DNMA 3B0YA 2BB0A 1FWAC 4EPEC 3O0FA 3ITCA 1ADDA 2VUNA 2Z2BA 5E5CA 4YIWA 2HQAA 1V7AA 1EJWC 4C5YA 2P53A 4XD3A 1NDYA 4H01A 3T81A 2Z26A 2O4QA 3URAA 2Z2AA 2Z24A 1FWIC 4RDYA 4BJHA 1EYWA 2FTYA 2VHLA 3S4TA 2EG6A 2PGRA 4CEXC 4H9ZA 1KRAC 4LAOA 4IFKA 3IV8A 5FSDC 3OVGA 4F0LA 1EJXC 3MVTA 2R1NA 1EZ2A 1POJA 1O5RA 1K1DA 4RDZA 1NDVA 1J5SA 4R7WA 2YXOA 2EG8A 1GKQA 3S2NA 4KETA 3PNZA 3S2MA 4C6LA 3QGAC 4M51A 4F0RA 3LSBA 3V7PA 1A4LA 4GOAA 4C6EA 1FWEC 4F0SA 2R1PA 4H9TA 1RJQA 1HZYA 3TN3A 2Z27A 3F2CA 4KF1A 2AQOA 1I0BA 1EJSC 1P1MA 2PAJA 4CNSA 1FWHC 2A3LA 2BGNE 2HNHA 3MPGA 2CZVA 4XD5A 4ERAA 3PNUA 3QY8A 4UB9A 3JZEA 3LNPA 2Y1HA 4GX8A
chains in the Genus database with same CATH superfamily
1SZGA 3PC0A 1EQCA 1TRIA 2ZZ7A 1PS9A 4S3GA 1K6AA 3OLIA 3EXTA 2P3ZA 3GZAA 3VIGA 1CXKA 1DL3A 1B5TA 1NU5A 3GTFA 1NELA 2WJEA 3SIMA 3BMXA 1WUEA 1OGBA 2PD9A 3S6DA 2G8ZA 4UCGA 4M1BA 3VCRA 1VH7A 3TLQA 3CZJA 2QIWA 3BQ5A 3L4XA 1J96A 3UXLA 5AC4A 4F0KA 3B8SA 1UP3A 2BXVA 5I3HA 2I56A 3OZPA 1POKA 1XINA 4Q4SA 4MG4A 1DYSA 5E09A 3WLNA 4ZO8A 4PFMA 3TC7A 3BG9A 4C6KA 3QEZA 4YHEA 3H4GA 1C29A 1TQJA 3DDMA 3EWWA 3T0CA 2O9PA 4GYJA 4MKVA 3D46A 2CWNA 4H2HA 5CPOA 2YW3A 3RLGA 4FA3A 2G97A 1LWIA 4FXRA 4G9PA 3DG6A 2V68A 4F48A 2DSWA 4ML4A 4W7VA 2PDIA 3T2PA 1VHNA 4HSHA 5JH1A 1C3FA 2XIQA 3KAOA 3CZGA 4AZ6A 1TR9A 3NZPA 1ZALA 2UWFA 3HOJA 4IJRA 2WNZA 4DF2A 4DN1A 3DFHA 1QOQA 3DECA 1FX6A 3SSZA 5LYRA 3VOIA 2FZMA 5D9NA 4LF2A 3BVJA 3CM4A 3SRDA 4D2JA 3RRXA 1IIGA 5A2BA 4LCQA 1HX0A 4B5XA 1E6ZA 2VCAA 3AROA 2GSJA 4WOQA 4ZB0A 2VC9A 5LXXA 4UFKA 3N9SA 3PJXA 2Y5EA 3KBWA 4M8UA 1W5MA 3M1ZA 4XVDA 1KW1A 3AI0A 4GJJA 1VIZA 1XDMA 3M5XA 1BKHA 1UOZA 1OK6A 1P6BA 4GYPA 1RH9A 3O05A 3AS3A 1LCOA 2EJAA 2B0MA 1V0NA 5AHLA 2DUZA 1REQA 4IICA 1XSJA 1DWJM 2VX6A 1I0DA 1AJ2A 2YL5A 3O7UA 3VDGA 1C7SA 4EP8C 2FKPA 2AKMA 4Q4KA 4HNUA 4PEEA 4C6PA 3ZJ8A 1TJ2A 3QHOA 3N3TA 4CU8A 1OFEA 3FGCB 4WDWA 4AD4A 1R9YA 5GNZA 2GGHA 3SZ8A 5B7ZA 2OWXA 3R8RA 4Q6XA 3C2FA 2DP3A 3BGGA 3ALFA 3SCVA 4E4UA 3LD5A 1K6WA 2R14A 3WLLA 5CJNA 4PUUA 1WAWA 3HMJG 3NSXA 1B9ZA 3MT1A 2DSKA 4TV5A 2QQ6A 3VC6A 1KBKA 3QMTA 1IXQA 4RDWA 3NQGA 2ZRYA 4HYRA 3EAUA 4GIRA 1DWIM 1E71M 3CPRA 4XAFA 4XVEA 1F6KA 3VU2A 1OX5A 4O17A 1B3YA 3UPMA 1QPQA 4P61A 2XHYA 3RFAA 5C7HA 3UZWA 4JEQA 2J8TA 1P0EA 3ARQA 4LSBA 1QVBA 4AIUA 3JW7A 4PZVA 3JVAA 3GNNA 4YWSA 1FXPA 4N4QA 1P7TB 3FHAA 3BGJA 4KWOA 1MYRA 3COTA 4ROQA 5BWAA 3S2JA 4A8RA 1W9UA 5A5WA 3K46A 4UFHA 1R3TA 1OINA 1MDLA 3IIZA 3PWAA 3ZVIA 1EA0A 1XL9A 3B05A 2ADAA 3MSGA 4KMQA 3HPXA 3F2BA 4Z42C 4FX7A 2ZCGA 3A6OA 4O57A 4EKJA 3GNPA 4RL3A 2XU2A 5F2IA 4YXGA 2WM0A 1IEWA 1QNRA 3AO0A 4LUJA 4NQ1A 3WDHA 1Q45A 2Z1KA 4HU4A 3WKZA 6REQA 1BTMA 2QCHA 3E49A 3THQA 3PULA 1LZOA 1XUUA 2VWSA 3EX3A 3GTXA 1FTXA 1EUNA 3KL5A 3QGKC 3PVFA 1G5AA 4H9YA 1UG6A 2Z1XA 3KRSA 3DI0A 3F4CA 3NQMA 2PLCA 2H8XA 4D6JA 2ZDSA 3ZMRA 4DI9A 5D9OA 4HA4A 3WH9A 1S2VA 1UIPA 3F5KA 1G4PA 2ZXDA 3HMCA 4YVVA 5HOSA 1QPOA 3UT0A 5HR7A 1S5WA 1GQIA 3LBOA 4DNMA 3MHUA 3TYEA 1X96A 4KBXA 2DT1A 4HZ8A 2Z2BA 5JVLA 4GVGA 4X2RA 3T2QA 2H3DA 5DRIA 4W85A 4S3AA 3UA4A 4CCEA 3ZFHA 1DIDA 2YL9A 4ZE4A 4L56A 3EB2A 2NQJA 1XLIA 4EF9A 3DYOA 2FQIA 1PZ2A 2F8QA 5C2GA 4MYAA 1XD0A 4H9ZA 4KWSA 5DQPA 2R82A 3PZTA 1UP2A 4IGHA 1KRAC 4LAOA 1OC7A 5GNXA 3VD7A 4GBUA 1E6SM 1POJA 4XSMA 5I2UA 1RQEA 2QYGA 3WDJA 3VM7A 3K30A 5D8WA 2C0HA 2JE8A 1UWIA 3I65A 3USBA 1S39A 5CLTA 4F0RA 3MQTA 4I8YA 3T6CA 2MUCA 3DERA 4RZ6A 2O9TA 1EEPA 3H4XA 2E28A 3WD4A 3SEPA 1E6XM 3VKKA 3TN3A 3PTMA 3T55A 4AVFA 1U1JA 2UV8G 3SCWA 2QDEA 3GVWA 4MY9A 4Z1YA 5EMUA 3MI6A 1DQWA 2HK1A 2VFFA 1QNSA 4HTBA 4UZUA 4KERA 2PU0A 3HQOA 1QI0A 2FGLA 1UW9A 1S1PA 4Y6GA 4OFCA 2J6XA 4PTWA 3T44A 2F7FA 3L4VA 2YDQA 3DH7A 3P3BA 1GHRA 3D0CA 3CLMA 3OO2A 3SIZA 1GQJA 2YBUA 4IL0A 5AYZA 3UZZA 3DUGA 1FDYA 4J1OA 4J9JA 1PCKA 4JICA 4GYFA 1VBJA 3C2OA 4Z0SA 3WNKA 1DXEA 3W1XA 4IHCA 4JTHA 4EOUA 4O12A 3EEZA 3R25A 4MAVA 1WZMA 4W8BA 4NY2A 2OSWA 4AVOA 4JTKA 3OOQA 4I6VA 3W7EA 1SU5A 1RUSA 3VOFA 2XTKA 3UPWA 4ZQOA 3GH4A 3WK3A 3WD0A 3R79A 4BK9A 4H00A 3ZXWA 1LWHA 2BHUA 4REQB 1XC4A 3STPA 3N29A 3VDCA 4ERIA 3ITVA 4A6GA 2V9DA 3LV6A 3EWCA 1DJHA 1MFVA 2H6RA 2PTDA 4LT9A 5D2YA 4AWEA 1BKSA 2HPMA 1RVGA 3JUGA 2NSXA 3WLHA 1BPLB 1JI2A 4DLFA 1BWLA 4W88A 1GJUA 2KX9A 4GVFA 2OMAA 2E67A 4ZBCA 2BOGX 3PZUA 2NWSA 4W8AA 3P0XA 3A3XA 1B4EA 1W37A 5G4EA 2WKLA 1TMLA 4WKHA 1PHWA 1NJJA 3EPNA 5EBUA 3ATYA 3L4TA 3W81A 3TFCA 4J5NA 4JXCA 3UFYA 3MJMA 2ZUNA 4LAUA 4DBEA 4F79A 1HIZA 1GOQA 4XZMX 2J66A 4GVIA 1X8CA 1G7UA 1RXOB 2YDRA 2ZUTA 1VFOA 5G4WA 3QJAA 4GISA 1M1BA 4FR1A 2QCDA 3T9PA 2F38A 3ARZA 3C2YA 3RUBL 4IIGA 2WNQA 2F6XA 1JR1A 3ICJA 3VDAA 4LALA 1JZ4A 3WUGA 1AVAA 4HNOA 2OYLA 2W91A 1UA3A 1X97A 4P2VA 1KGXA 2OELA 2ACRA 2ZKMX 4FAMA 2ZUUA 1Q6EA 2Z6IA 5U4NA 4MNJA 3VIMA 1W6TA 2GQAA 4E0CA 5G2WA 1OFDA 1CPUA 2GUBA 3LCLA 3P84A 3W7CA 3UGRA 3WQVA 4C7FA 1JZ5A 4WRHA 3PY2A 4NKCA 2NT0A 4B9YA 2YCEA 3NUKA 3OGVA 4F0HA 4ASTA 3UD6A 2E9BA 6XIAA 1UMYA 3OG3A 4FS9A 1TR1A 4RUBA 2YR1A 2ZWYA 4PMUA 1RY0A 4G2DA 2D2JA 2VXNA 3P5ZA 3WF3A 4C6CA 2YCLA 5CC7A 5KSWA 9XIAA 4E3TA 4JAWA 4CNNA 1ALDA 2PDYA 4LGXA 1W1PA 4W93A 4ZOBA 3GKAA 3EEGA 4Z2JA 1M7PA 4M80A 2BG5A 4KCWA 3M43A 2GDUA 1YXDA 3ZWTA 4C90A 1ZUAX 4U10A 3LZ5A 2Q09A 1JGMA 5EMLA 2J13A 3S1UA 4ORMA 4YTUA 3C52A 3QV8A 1W31A 1WDPA 4QEEA 2XSBA 4LUYA 2D2OA 2INEA 4I5RA 1SSDA 2DJXA 2GDQA 4P7RA 2VMFA 3K1GA 2W67A 5DT7A 4K1WA 5HMFA 1EUAA 7REQB 3RAOA 1IQ8A 5G1YA 1BYAA 3S3GA 1SVDA 1B30A 4ZSUA 3LM3A 3MDWA 1SYTA 2WPGA 1CTNA 3SCRA 3TTQA 1DXIA 2XH7A 4WVXA 3SCNA 4CCZA 1A4MA 1WKYA 2EF9A 3SO7A 4J3ZA 5FESA 2I57A 5HMEA 2EJ1A 2A6NA 3CV7A 1XG4A 4LVDA 1DORA 2WMIA 2Y6ZA 2BGQA 2GPTA 2J24A 2RUSA 1G0CA 4UR8A 1CT5A 4Y9NA 2QR6A 2WVTA 3EBVA 1W1A1 3GU9A 2RJHA 5A3HA 1VYSX 4GRSA 1QNVA 3LBCA 4N2YA 4XKYA 1XLFA 4UTHA 4N6EA 4GINA 1QI5A 2VVSA 1V7AA 2FZ9A 2CPUA 4NF7A 4O53A 1Z48A 3O3RA 1N8FA 5IBXA 3KHDA 4DB7A 5GVJA 2O4QA 1VIWA 1W3TA 4FALA 4CQAA 4N0RA 3K8LA 5EMMA 3UPBA 4DPQA 1JFHA 2X42A 1F07A 1KKRA 3AXMA 4O0QA 1OY0A 1S1RA 3OVGA 3PR2A 1HQTA 2GK1B 1OVDA 1XBVA 3VIOA 1EJXC 4XZHA 1O5RA 3MWAA 1P0BA 1NDVA 2UY2A 3W76A 3UXAA 4I90A 4L1WA 5LIUX 3W88A 2PE4A 4S3BA 1QNPA 3FA3A 1JCMP 4QCFA 3BAYA 3FS2A 1L9WA 4QFUA 4CN1A 2VFDA 1OG0A 5HA7A 1QHPA 3L0GA 1S5MA 2JK2A 2BVWA 4OU1A 1KV8A 4IX2A 3GY1A 4HB7A 4CNSA 1SJAA 2BGNE 2QDHA 4XD5A 1JDDA 2HXUA 9CGTA 4BQ4A 4E8CA 1NWUA 3EDJA 3SCOA 3WLRA 6PTDA 1H50A 3W7HA 4AX6A 1QHOA 4PMDA 1NP2A 5CCZA 4YCOA 4AB4A 3UVAA 1VF8A 3S46A 1B3XA 3WF0A 2XGIA 3VPLA 2V2DA 4ZOCA 4EWND 1S3TC 3P82A 2ZADA 3P81A 2PWVA 4BWLA 5J5RA 1R3VA 2ON3A 1EP2A 1LG2A 4O10A 2D24A 4XV0A 1SO6A 5H6HA 5CPMA 1LWJA 1MNZA 5K7JA 3RM4A 1S2CA 5C5YA 1K9FA 2WVVA 3R1ZA 3MS8A 3TMLA 4I5XA 1Q7QA 1W9XA 4KFOA 3EWZA 2PSNA 5GJPA 3NOYA 4QNWA 3LHUA 4MAZA 1BLIA 4LTSA 4UFLA 3KL0A 2IQ0A 4JNZA 3W7KA 2PDJA 1H7XA 4H83A 1GYMA 1B90A 1RD6A 3GTIA 1QI3A 1KLZA 4UWMA 1XLJA 1HVXA 5ABFB 5BYWA 1UKPA 2ACSA 3NO1A 2VUYA 1LDCA 1N55A 3DFOA 4FOKA 3IJ8A 4GYPC 2EAWA 4H04A 4KWUA 3SJ3A 3WEZA 1IWPA 3CBWA 3WDRA 2VR2A 4BQ3A 1OX4A 5AVHA 2CERA 2E6AA 2DH3A 3FNDA 2A1YA 3UQNA 1E5NA 1R7AA 2XIJA 4BA0A 1EGVA 5ENLA 1CXEA 1ZB5A 4CU7A 3NDOA 4LFYA 4N9CA 2DT2A 2DGAA 4YVXA 2J8FA 2YKKA 1SFSA 1AJZA 1JULA 2AMXA 3LMZA 3WLPA 4FLRA 3TOPA 5D09A 1BEUA 2CLEA 3G8EA 4MNLA 5I03A 3RR4A 1M03A 3D3FA 3HG2A 4CQCA 1H7WA 1RCOB 4JR5A 3QBUA 5CEWA 5EL1A 1H0GA 1TV4A 1BD0A 5MKGA 3FDKA 1V02E 2PDXA 3W28A 5E93A 1OJXA 2SFPA 1W1TA 1E1FA 8XIMA 1Z6KA 4NAFA 2BY3A 1TWWA 4HA1A 5CGTA 4DEFA 3C3NA 1TIMA 2IKHA 4QDWA 3VVGA 4S3FA 2BP1A 1ONRA 3IEBA 3TCEA 3GVGA 2XWDA 1KBLA 3C8FA 1IHIA 1LLOA 4NVTA 3WLOA 4DO6A 4QROA 4UC5A 3CEUA 5G1TA 3U2ZA 3WL1A 2Y61A 2J62A 2ZRUA 4PCFA 1G1YA 1XCXA 4IGNA 4ZR8A 1KTBA 3BAWA 2GGJA 3BLOA 1H7NA 3NM1A 1HVQA 4S1FA 1LLZA 3INPA 4OGZA 2C13A 3MKCA 2GQ9A 4UTMA 2ZX9A 4MTVA 1UUMA 4OECA 3SRFA 2JGYA 3RIKA 1SMDA 2ONEA 2PTYA 2WMFA 4W84A 3WH7A 1XIEA 4YNGA 1PVNA 3P8JA 4PB4A 2FPYA 3GHSA 4JTLA 3AU2A 1ZQ5A 3NSNA 1FUYA 1E0XA 1EQPA 4J7RA 4NYUA 3WDQA 3M5ZA 3AS2A 9XIMA 5BW6A 2G95A 3IK4A 4QX4A 5D8ZA 4IQLA 4K8HA 3S5SA 1PAMA 4O1EA 2ZZ5A 3N9RA 1G4TA 4FXSA 4YYCA 3EZ4A 3FLUA 4ATDA 1WKFA 3LG3A 1GVOA 1MZHA 3E9AA 3LENA 3DU0A 2VM8A 3FVMA 3W75A 2GQ3A 3HFYA 4GIAA 2P88A 1KM3A 5CSRA 3MY9A 4GQGA 2NV9A 5A1AA 3N3MA 7TIMA 5LGXA 4FSAA 3EOLA 4BZYA 3GAKA 4JDYA 3VKAA 2EEXA 1CGVA 4X9YA 3L68A 3W9ZA 3HV9A 4BHYA 4WSKA 1AQFA 1XM3A 3W23A 4KCVA 1MW2A 4JHMA 3H7UA 1TCDA 2A79A 3KOFA 2PLKA 1JUKA 1GCYA 4DIAA 3E74A 3NZGA 4ACYA 4D8ZA 4QLLA 3FGCA 3AU6A 1GVIA 4ADUA 3L5LA 1F61A 3K8MA 1B57A 4D9PA 2G37A 2Y7GA 3UYCA 3W1QA 2LLEA 2VOTA 3G1HA 4RDYA 5TNVA 1JRCA 3WQ6A 3WD2A 4K8EA 3BXWA 5AB3A 4E4FA 3IIVA 1R87A 1AJ0A 1JPDX 3VOCA 2Y8VA 1W1VA 2YXOA 1F05A 3GHUA 4QHRA 2R6OA 3R11A 1E4LA 4DO5A 5CZKA 3M0VA 4GOAA 2ISDA 4K38A 3NPVA 3GE7A 3BAKA 1PDYA 4IT1A 4F0SA 2B4GA 2X1UA 4ZE5A 5HWNA 1PX8A 3G6LA 1EBGA 3U4AA 3A5FA 3QR0A 1P7TA 2X1IA 4PMNA 2HCVA 4ZTXA 3LCHA 2A0NA 4UB9A 3OIXA 4QISA 4TTGA 4NAEB 1O7AA 3IJIA 2OGJA 2OSYA 1FKWA 2Z1SA 2CU0A 2XZ7A 3TXVA 1HF6A 3VMOA 3RO6A 4LU0A 1KV5A 3VMPA 1EXBA 4WOZA 2VO5A 3RK8A 4HK7A 3IACA 1PEZA 2OKOA 1DPMA 2J7GA 4GUFA 2PDLA 3W7DA 4H6EA 4MMWA 1SM9A 3CIWA 3MWCA 1YPIA 1JDAA 3EMQA 1HL2A 5K4XA 3MU7A 5D04C 4DM2A 4AD0A 4DBSA 2Q8ZA 4EPDC 4ZXLA 3GG8A 1V03A 3GXIA 4DZAA 4IOTA 4LV9A 5HR6A 1XH1A 2F6UA 3NA8A 1XUZA 2AL1A 1QI4A 1OT2A 2PDHA 7XIMA 3QV7A 4AHOA 1M04A 1UYQA 4KESA 4B3LA 1J10A 1EJRC 3SFKA 3B0VC 2YYUA 3UWEA 3WO8A 4EPBC 3B04A 2QPUA 3WQ8A 2WPBA 1VCVA 3AJXA 1PL9A 4OOZA 1AH0A 4GK8A 2ZYFA 3PANA 1OD0A 5F4WA 1EKOA 1Y5VA 2ATMA 1KGUA 4LWWA 2FIQA 3WQOA 1E1CB 1TREA 1AQ0A 1VHCA 4KEZA 5E6YA 1TV5A 2WLZA 2F2HA 3VTRA 5LGZA 4GC3A 3UJSA 3TR9A 3FYOA 1JAEA 4UMCA 3TFXA 5TBOA 5A6SA 4JGDA 3KVJA 4Q8VA 3WLMA 4AIBA 5H91A 1R9ZA 3WNPA 4GZ7A 4JFTA 4RX0A 5TD4A 2X1SA 4MDOA 3SSJA 1HP5A 2FHFA 4C6FA 3H7RA 3Q67A 3F03K 4NL1A 1Q2SA 5G2HA 3KM8A 3IPWA 3AMCA 1O1ZA 3H4WA 3NQDA 4M0XA 2G3FA 3RU8X 2EKGA 1IF2A 2V3EA 2EPKX 5A6TC 1GOXA 1SPQA 3I4KA 5IDIA 2Z29A 2Z1WA 3WNNA 2UZ9A 1UJPA 1WZKA 3DGRA 3QTGA 2DU2A 3UU0A 4MKSA 1AD1A 2I16A 1X39A 2W61A 5LKYA 3K5XA 2OSXA 3GX9A 3VI2A 4GIYA 3FXYA 4Y90A 4FLOA 4GJ1A 4O0KA 3U5YA 2W0UA 1TZ7A 3IARA 2XIIA 4C60A 2WCAA 1TZ9A 4LCSA 3WQFA 1XGZA 4HN8A 1M65A 3HTWA 2VR4A 4KWWA 3GW0A 3STGA 1XKYA 4AAJA 4M24A 4WXZA 1HTIA 2YPIA 1TIWA 5JH2A 1RALA 1N2VA 1I6NA 3UCCA 4U5IA 1RA5A 1XG3A 3A21A 3NPUA 1FHLA 3GG7A 3FSTA 3CO8A 3ALGA 5AC7A 1W9BM 1FWFC 1TMQA 3QY7A 3FJ4A 1W91A 1FH8A 2ICSA 3IIOA 4HU3A 3OEXA 4TQTA 1F9CA 4NZ5A 4KRUA 3TQVA 4UFMA 3UESA 2VT0A 1RJPA 4REQA 4MF4A 3TWBA 1GNXA 1BAGA 4L64A 4QCEA 3BMWA 3SFWA 3UERA 2INFA 3H26A 2ZX8A 4LUSB 4NYYA 1ZZMA 1KWKA 1K8CA 1D8CA 2C15A 3LHZA 4AMAA 4G5DA 4UZSA 1UWTA 2UY3A 1FFQA 3TYDA 1SO4A 1E73M 4KIRA 4A8IA 2BXYA 2XVKA 5J5DA 1RLDA 1Z3NA 3AMLA 3NO3A 2F2KA 3IGHX 3V75A 4L5ZA 1K77A 3NQEA 2OEJA 4ZEPA 3AMGA 3WJYA 4P8UA 4U2YA 3TAOA 2V82A 3TC3A 4GJIA 3VNJA 5IRPA 5DMLA 3R7MA 4HA3A 2J25A 1H1YA 3WUBA 3C86A 1LROA 2G96A 2Y7EA 1SW0A 4FIQA 5CPNA 4K37A 3LV5A 2P0IA 4J2PA 4LBUA 3ZQ9A 2HZGA 1PKNA 3BTNA 2VC5A 2E5BA 5IBXC 5CBIA 4E8DA 3EMZA 1JIBA 1TWZA 4L6DA 4DRSA 4R7OA 4ICNA 2CLFA 2XM1A 3ZT7A 2WVSA 3H70A 4IMDA 2NW0A 1VKFA 3QV9A 1AMKA 3TNBA 4CQDA 3TJIA 1UD2A 3TMQA 2QF7A 5I7GA 1RJRA 1UC5A 1LM1A 3L0KA 1LRTA 1OFRA 2P53A 2B7PA 1IGSA 4J27A 2PF8A 1GORA 3EX1A 1XBXA 4JTUA 3UWYA 1E6QM 1Q6OA 3BOFA 4TX9A 1W1YA 3SUVA 1XLAA 1E70M 4MNKA 1I45A 2VHLA 4S23A 7PTDA 1NFBA 4GIEA 2VZVA 3WUFA 4DYJA 2OEMA 3VD4A 1Q3NA 3B8DA 4FXJA 2VD8A 1P6WA 4CQ9A 1QT1A 4M29A 4QAWA 3UCDA 3LSBA 3GDTA 5FJTA 3GG1A 1E15A 2ZFAA 3S9ZA 2NUYA 4BF9A 4HZ6A 4QE4A 1HO1A 2BVTA 1KCKA 1PBGA 2ZVRA 2FPTA 4PODA 4BWLC 4DJDA 2VQUA 3ARSA 4YLWA 2W4XA 1OCBA 4YTQA 1F6PA 4QJ1A 1MXSA 4KFPA 3HM7A 1V5XA 1OGSA 3L2IA 4JEJA 4B5VA 4MJZA 4QBXA 4AC7C 2WHJA 3NL2A 4AZCB 1M5WA 4DX3A 1Y7VA 2WZIA 3PF3A 3MBDA 7REQA 3Q4DA 5L9FA 3HJZA 4INFA 1XYAA 2E4TA 1EZWA 4IL2A 1B3VA 5HQEA 5I3DA 2E6FA 1E4NA 5HNRA 2YB4A 5FJOA 2YL8A 4ATWA 1B2YA 3H12A 5E9AA 1S2UA 5A8PA 3SUTA 4MNMA 2POZA 3WENA 4NNBA 4P5UA 1KRCC 1GW9A 1KRMA 1ECQA 3NQBA 1WBJA 5A8NA 4B4FA 1QNQA 2DFAA 3E0IA 2QUTA 2HBXA 1TUXA 1MI3A 3ZJKA 2EPHA 1CIUA 1B54A 2VELA 4H9XA 4DJEA 1O6IA 4G1NA 3L21A 1AH3A 2Y4SA 1LQ2A 2ZUSA 4FIRA 3IV3A 3ZWSA 1PTGA 3DHFA 2YZ5A 4IUOA 1JI1A 1ICSA 4L4OA 3LPFA 3BL3A 4OWGA 4YJ5A 4MOZA 1ZAJA 2A6LA 2OJPA 1BYCA 4NRSA 1OGGA 1SJCA 2A3BA 4ZTYA 1NAL1 2DZAA 4GY1A 3M0XA 1UP0A 3M0ZA 3MP4A 2V30A 2C19A 1P5BA 2EPNA 2FVKA 2GK1A 3PZIA 5D37A 3STFA 1R46A 1TVLA 3LCWA 4PBEA 1O66A 1OG6A 4TR9A 1RPXA 1GTEA 2FZ8A 3UJFA 3WD1A 2PDGA 3TSBA 1HKVA 5D30A 1BTCA 1NY1A 3CAKA 4GUHA 4RE4A 5KMYA 4DZIA 2XVLA 4AMCA 4IPNB 2O9RA 4BEQA 5AHFA 1RBAA 3KWXA 5AFDA 2BNJA 3B4UA 2QJNA 1DE5A 1ITUA 5M3WA 3T2OA 1A47A 3UF9A 4F2BA 1OABA 2NXHA 4FK9A 4ZMGA 2C6QA 4LB3A 1DJXA 4CN6A 5IFTA 1WO2A 1UWSA 4K8GA 3WG6A 1VBGA 1CXFA 3TSMA 5CSYA 4Z2HA 2PBGA 1S5NA 4H6RA 1OB0A 1I2QA 4UTIA 1F3TA 1CDGA 4QDPA 5EMYA 4O1DA 1OFPA 5D4YA 1B0IA 4NZFA 2Q3OA 3KDOA 4S38A 4ZB2A 2W9MA 1TFVA 4RLIA 3SQLA 1VRXA 1UR4A 3N15A 3V0UA 4XBJA 1YDOA 1Q85A 4V1YA 5J8LA 1Q8AA 3F4WA 3DEQA 1W9VA 2OX1A 5LZLA 1V08A 3STEA 1DTNA 2GL5A 4HHLA 3KOXA 4HVXA 3VK5A 1E9ZB 3BAIA 4EWJA 1F7BA 4DQWA 5KZEA 3CV1A 4G7FA 2Q6ZA 4PB3A 1QW7A 1FWGC 1DJGA 1PUDA 1AQHA 1SZFA 2ZZ6A 1IYXA 2ZTKA 5FIPA 2A2IA 2V3FA 2GGGA 4CD4A 4KFNA 3MO7A 3WF2A 4M6PA 3W2UA 4J3UA 5ABFA 1D8WA 5AVNA 4TU1A 1RP9A 3ZLHA 4PB5A 3CHVA 3KLLA 3DHPA 1C9WA 1TV3A 1KR0A 1J12A 3PZOA 1P0NA 2ZXAA 1OFQA 4JBRA 1KCLA 3AS0A 4D8AA 4AC1X 5C9WA 3GIYA 1TELA 4Z08A 4PMYA 1E1EA 1QR7A 1EB3A 3BARA 4H8UA 4DJDD 3D47A 2GGEA 4Q8WA 4WIWA 4AHQA 1PXGA 1UR8A 2D2GA 4YL2A 5IDZA 4H6KA 1ZP3A 2R1LA 5BWFA 4BI6A 2PS2A 5JXQA 5LA1A 1P1XA 3IANA 4KT2A 3TC6A 5CPQA 3O15A 1UR0A 3CMFA 4ZZ9A 3SGUA 4K3ZA 4QE1A 5A6MA 4I9MA 5HUOA 3O0KA 2OLSA 2BB0A 2EBNA 3SY5A 3THDA 1TE1A 3WFAA 1KA9F 1QATA 2X0HA 3T81A 4XTIA 3G1RA 5BU6A 1J0IA 4WR3A 4TVCA 3BV4A 3V0TA 3GDMA 4ZOEA 4U3AA 3CWNA 1XIDA 3K4AA 1TPVA 3WX7A 3QLDA 4L6HA 1DEDA 3N9KA 3NVDA 4IXXA 2VFHA 3WBWA 3CL6A 1QWKA 2CZ5A 2XFFA 2IXVA 3QXBA 3UZXA 4AY1A 1XIFA 2YFNA 3LHYA 1MUMA 2BOFX 4H19A 3LERA 1V3JA 5AOUA 4GUGA 3M0YA 1KQZA 4AISA 3MI3A 2FH6A 3UW6A 3TQKA 4DJED 3P0WA 3GFXA 3LCGA 3UG5A 1ISWA 1R3SA 4D6DA 3M4HA 3W2MA 3TLLA 2V5LA 4H6QA 1CECA 3P14A 3JZEA 4ONVA 3LUTA 4JTQA 3A9BA 4NHVA 4V1XA 1SZEA 4MWAB 3F2DA 3LS9A 4GZEA 4TTUA 1SFTA 3JRKA 4EAMA 5C9RA 2ATSA 5JIPA 4JIIX 4NZJA 3UXDA 4Q32A 1GEQA 4LVGA 4X0VA 4H1ZA 4PMOA 1Q13A 1J2WA 3F4NA 4P8WA 4JFVA 4WX2A 4PR4A 1F8MA 4GI4A 5CZJA 2GOUA 4MKNA 5CC3A 4S3JA 1RQHA 2VOMA 3AIVA 3OYXA 4HNLA 2PP3A 3ABOA 1PTDA 3AQUA 4CNOA 4GLEA 1EJTC 1VPYA 1MRQA 3FSUA 3ZM8A 3PUOA 3P8IA 5IM51 2PA6A 5FSEC 3VUPA 3WFLA 2W62A 1O4UA 4V28A 4F66A 2YDAA 4GNVA 2XPKA 4Z1CA 1VFSA 1DHPA 1UR3M 5LA2A 2QJHA 1UASA 1YRRA 1F76A 2PBOA 3CUGA 3SR7A 1K02A 2PDQA 1W3NA 1J5TA 1VS1A 1NH6A 3UETA 7ENLA 4XG1A 4H9MA 4RJEA 3ZJ6A 4DYKA 3LK6A 1J0KA 6TAAA 4UTFA 4ZO9A 4EXBA 3LXAA 4CNUA 3A3HA 1KRBC 1M68A 1WQ5A 1JCNA 3BLPX 1JYVA 2ZA1A 3S5OA 4HMEA 4KEVA 4DAFA 4DWSB 1LORA 5HK4A 4AZ5A 1U2YA 4ZQNA 1YYAA 5H8MA 3M0IA 2DT3A 3GRIA 2DIKA 3LOTA 3IGXA 1PWMA 5HPOA 3PZQA 1F6YA 2C1HA 3A9IA 3WLIA 3DKLA 2ZZ2A 2BMBA 3N17A 2ZOXA 5LIXX 1H3GA 4UTJA 4NXSA 2WSKA 2OVLA 4KWVA 4QGCA 2DZUA 3A4JA 3L5MA 5EMKA 3HO8A 3VNDA 3KRUA 4JYDA 4R3UA 4NAEA 2F84A 1KBBA 5HMSA 3ARYA 4JD4A 2VDHA 4M56A 1QI2A 4RZBA 2OPJA 3E02A 3RLUA 1DJZA 2QT3A 1GKPA 4XIAA 3MBFA 2YB1A 1D9EA 4M5PA 1LL6A 2I9UA 5REQB 2DZXA 1XQKA 3E2QA 3B8VA 4HPXA 3GKFA 4B5WA 1HL9A 4WSJA 1LT8A 1ONWA 3ZT5A 4WDUA 5I3GA 2NXIA 4HMDA 4U28A 1WZAA 1E43A 5CAHA 1OC5A 4PUWA 2EG7A 2QJIA 4EVZA 1GEHA 3A13A 5CG0A 4TV6A 5DXYA 1OK4A 3PG9A 1HFBA 3WQEA 3W71A 4CQ8A 5A95A 1AA1B 3UCQA 3M5VA 4OV9A 4Z1BA 3GU1A 1A3HA 4LANA 3A23A 2TMDA 3VILA 1XLGA 1PTAA 3PS7A 4DM1A 3AXIA 3B3DA 3S9YA 1TTQA 2HRWA 4XB3A 4Z2GA 4HOWA 2OWWA 2I5IA 3HPZA 3DFQA 2ZA3A 3S47A 4TMCA 2ZZ3A 2G3NA 3H54A 3CUJA 3RYSA 2CESA 1E1CA 7A3HA 3V0SA 4UR9A 3BG5A 5FF4A 4QRNA 3MDUA 2VWTA 2VDIA 4AZIA 2QCDB 4K1GA 4UTTA 3CEPA 3I7RA 3T09A 3TZFA 3BUVA 4Z2LA 5IFPA 4QP0A 2Y5SA 4RNHA 2GJLA 4GZIA 2VKZG 4K68A 3NPWA 5LHEA 4JNMA 3VKBA 2IPWA 3VIIA 1O1HA 3CASA 5EBAA 1F3EA 2X8RA 1Q66A 4HKPA 2ABBA 3BSGA 1R2RA 5JIWA 1GZJA 3VIFA 1V6YA 2DIEA 3MB9A 4Y8EA 2VEPA 4RXGA 4DXXA 1OF6A 2HVMA 4QM1A 1KFEA 3FCPA 2YYTA 1BWKA 4O13A 1N8WA 2GUYA 3CMGA 5FEZA 1QCWA 2PDBA 2G3JA 3CO4A 1WKEA 2BFGA 1EPXA 2GZXA 2Y88A 5HNNA 3TEVA 3GVVA 3WQGA 1JUBA 4AWTA 1TWSA 2HDJA 4TIMA 1JL8A 2PC8A 1NDZA 1RHCA 2AKZA 3EOEA 3I6RA 1ADSA 4J2MA 3BCFA 3VE9A 4LEQA 3M0LA 2XFRA 3BW4A 4PUEA 2HXTA 4W9TA 2ZX5A 4JFSA 2C3ZA 4CNTA 3GUGA 3TDFA 3T42A 1ADDA 5LIYX 3W2KA 1Q6RA 3M6DA 3MYPA 3BLIA 3KBSA 4CD5A 2Z24A 3C61A 3LPOA 2RDUA 3A22A 1FWIC 1HT6A 8XIAA 3IK2A 4OTKA 1FCVA 6CGTA 4KKXA 4H3DA 1US3A 1EXPA 3T8QA 3IV8A 1SR0A 3HF3A 3PPCA 3TW9A 4DJDC 4YMZA 1FP8A 3PFMA 3ARXA 1C9DA 3PNZA 1RLCL 5T9BG 1H5VA 2QUVA 5A94A 5FA5A 3L7RA 1UBSA 3V3WA 4ZQCA 1L6FA 2VX5A 1DHKA 3BSMA 3W1LA 4F2TA 4GNJA 3ES7A 1JCYA 3PUGA 4GQBA 1XRSA 1UKSA 2A3LA 3GVQA 1QJWA 4DPPA 3WQCA 4C7GA 3ZO9A 4DUWA 3K4DA 5CJ5A 1KR1A 1CWYA 1YNPA 4V27A 2V63A 2X2GA 5DCEA 2ZRVA 3EYPA 3VO0A 3VIJA 3AHYA 3KLKA 2OXNA 9RUBA 1ZLPA 4UR7A 1UH4A 4GMEA 4D6HA 3TU9A 1VYRA 1PB0A 1K3UA 1MQRA 4XZWA 3WJZA 4LQ1A 2YCIX 2P8CA 2H3BA 4S3KA 3TQPA 1L6WA 1XLHA 3KZSA 4S2BA 4K6AA 3B0UX 5LXEA 3BWWA 1IXPA 3E6EA 2YLAA 3IVTA 3SCUA 2CIPA 2DZBA 3VDBA 5DANA 3KS5A 5C54A 1XSKA 4DJEC 1UWRA 4UQEA 1KCZA 3VCCA 2NQZA 5CSSA 1DJIA 5DEZA 1YXCA 2DORA 3WF4A 2CXGA 1WOAA 3WDIA 2DT0A 1VENA 1BQCA 3E2SA 1XH2A 5BXPA 5A6JA 1FY6A 4IIFA 1FHVA 3G1XA 1OD8A 2H9AB 1WOBA 1U30A 3V18A 2HNEA 3SCSA 2A85A 1NVMA 1ZBKA 3TR2A 3K13A 4FLSA 4IUGA 3AHTA 1NSJA 1C7TA 2PGEA 4YYFA 4LUIA 3PPHA 1NTHA 5CJMA 3W7RA 3W3OA 3FA4A 2OODA 4UTWA 1EJVC 3NSMA 2G5WA 1XLBA 5I3KA 3VZYA 3HPAA 1UOKA 4C6BA 2IMRA 1KFLA 4Y9AA 3PUDA 4IIEA 1OM0A 4AZGA 1GKRA 2DUXA 2DH2A 2PI6A 3MMDA 5I3JA 4DNHA 1T96A 1GVRA 1U5HA 2OFJA 5ECUA 4I6KA 1DQXA 1DWAM 3KX6A 3KL3A 5FJRA 1HNYA 1B1YA 3K2GA 2HVOA 5BOOA 3GC4A 3R0KA 1V7YA 1DWGM 3HBLA 1C8QA 4B3KA 3WLSA 3QFWA 2QCMA 3MP5A 1QASA 4HP5A 3FXGA 7TAAA 1J0ZA 4MSSA 2QCNA 4IF2A 1PKLA 1W3JA 4LY4A 1H1NA 3VKDA 1V0KA 3I6EA 2AAMA 2WVVB 3D5HA 4C6OA 4O1CA 5FJUA 1FWCC 3W1NA 1XS2A 4PRTA 3L66A 2BTMA 4NT0A 1YADA 3UG4A 2REQA 2ZUWA 5FEPA 4AZCA 3AISA 1B3OA 1OX6A 2YFOA 4AEOA 1LBMA 3A47A 1CLXA 4PH6A 3H8AA 3MCNA 3EKGA 4AZBA 4RZ5A 3W7IA 2J6VA 4DLMA 2GWNA 4XD4A 2MANA 4NP7A 2JIWA 3QLLA 2V3GA 4WKAA 1B9BA 4PMXA 1T5AA 4L4LA 4GPNA 1FCBA 4GE8A 2D3NA 3W53A 2FHCA 4MB1A 3H2FA 3GC5A 2C16A 5KTLA 3TKFA 4O0ZA 3N34A 3M64A 3DFPA 4O19A 4PMJA 1V0MA 3CZ8A 1A5BA 1KM0A 1OCNA 3VOJA 3WELA 4NIRA 2NQHA 5BRBA 4AF0B 2X30A 4HPGA 1RPKA 4ORIA 1Q8JA 2V3DA 3CZEA 1GOKA 2OR2A 1KFJA 2VYOA 3RX2A 1T8QA 3WBAA 4H2CA 3A12A 3CC1A 1OYBA 3DXIA 3E3HA 4BEUA 3OJGA 4HSOA 4R27A 3S2LA 2WYSA 3M44A 1GT8A 4GBDA 4H4IA 1TYGA 1DXFA 1EL3A 3BV7A 3UNTA 3NQFA 1ZPTA 3DN5A 4I8DA 1KLYA 1LRNA 4ERGA 1ME9A 4NAFB 3CUXA 4IPIA 1VB9A 1F4HA 2CETA 1UR9A 5FCZA 4MLRA 1R2TA 1XYFA 5DX7A 5BOFA 1HKJA 5H1WA 3OGRA 4AD5A 3V1HA 1RA0A 4IPJA 1W32A 4ECLA 4XAYA 2CFFA 3MSYA 4WUIA 2J78A 4A3UA 3PJTA 3AYVA 1TE6A 3PBUA 4EXQA 3BANA 3SN0A 4ICCX 2CLIA 5TIMA 5CAKA 3UNDA 2HEJA 2IPGA 2WQDA 3RDKA 1OSEA 1JYNA 4NI3A 4Q8OA 2X1RA 3FDGA 2QCFA 2YW4A 3PK7A 3VYLA 3TROA 2PUZA 1PIFA 4EF8A 2R91A 4PTXA 2DIJA 3UJ2A 3ITCA 4NXKA 3RRAA 3DFYA 2VUNA 3GXMA 4C5YA 5C70A 8A3HA 1OFOA 4P7OA 5FACA 1EP3A 1ZTVA 2VQTA 4BCEA 4UOJA 1MZRA 1HKKA 3QR3A 2PEVA 2XDFA 4XZBA 3HQPA 2PGRA 4RNIA 3GQYA 4D72A 1SJDA 4LW7A 4TX8A 3PZ9A 4V33A 1AZ1A 1EZ2A 3AJ7A 4RK8A 4Q22A 1NM9A 3W6MA 1GKQA 3GDBA 2A5HA 4HU0A 4KETA 2O9OA 4O1BA 2CLOA 1GVEA 1H49A 1MXDA 1JVNA 1IV8A 4PUKA 1XI3A 2FMOA 3CQIA 5XIMA 2BSLA 3NZRA 4GQ0A 3U2OA 1UD5A 2QW5A 2CWXA 1FWHC 3QPZA 4PCSA 1R3WA 4C1NB 3PNUA 2WHLA 2QXWA 1W3KA 2O7QA 3ARUA 3W4RA 1VP5A 1ONEA 3M41A 1UC4A 5ABGA 5AECA 5KITA 4JDBA 1JRBA 1TPDA 3O6YX 3WEOA 3EA2A 3FKKA 2GSEA 3O2LA 5FF0A 4I7WA 2UBPC 2ZE0A 1OBAA 3H2CA 1EIBA 2W6RA 4JKKA 3W6YA 3F7JA 3CYJA 2AMGA 2W63A 3W37A 2FVMA 5LNVA 3LPGA 3EA3A 2VGFA 3B9OA 1ZJIA 4IXHA 3DFTA 3WJSA 1RAKA 3E1F1 2ZUVA 4ZSTA 5A8OA 2CKSA 1F73A 2GWGA 3SY1A 5ABHA 2PC4A 4CNPA 1FCQA 1E6PA 1ZY9A 1XYCA 1GW1A 3PAJA 2D0FA 3MSRA 2VCCA 1KGWA 1UUQA 4IG2B 1IR2A 3PBGA 2HK0A 3KOYA 2OB3A 3PP7A 4MPQA 1EHNA 3GU2A 3FYYA 1L2QA 4DO7A 4E2OA 2FZNA 2XN0A 5C9UA 5HBFA 3N2TA 3I68A 5HJLA 3Q94A 3EX4A 1G01A 5ECVA 2XIMA 2PCEA 2OQLA 4UNIA 2V69A 1MWOA 2BVDA 3G22A 3NTYA 3RHGA 4DJFA 3E0LA 3MV11 4HCHA 2NT1A 4U4MA 3KBNA 4ENLA 2VRJA 1W5OA 2RH9A 3MUCA 1VEMA 3N19B 1WB0A 4Y7EA 2A3EA 2VX7A 2FLIA 1K9TA 3VFCA 4P8XA 1HL8A 1VR6A 1NWTA 4FP1A 2OOGA 2DW7A 3EKZA 1H60A 4B92A 3SADA 4QTGA 4HGXA 5KINA 2V81A 3TTEA 2CBJA 1XIIA 2NXGA 5AC8A 4PTMA 1DJQA 2V67A 2HJPA 3TNOA 1UH3A 1KFCA 4LRSA 3AXKA 4QSFA 5DCDA 3GD6A 1ZJAA 4ES4A 1CGTA 5C2CA 1P4CA 1WZLA 2Q01A 2EO7A 1OF8A 2J74A 1OIFA 4LYKA 4AQLA 5M17A 2R24A 5JBFA 4J40A 3GFYA 3QMSA 3LHTA 5AN7A 1HXJA 1CLVA 2XH0A 3O6DA 1Z8AA 2JKEA 4MWAA 4LAKA 4M81A 1PYFA 4UMAA 4YTTA 4PSRA 1JPMA 5LIWX 4XZNX 3JR2A 1R7OA 2OLHA 1MW3A 3OVQA 3QW4B 4KH2A 5BXTA 3HGRA 1A3WA 4PBGA 3UEQA 4MUZA 3W85A 3W74A 3EX2A 1TVNA 1TPFA 1O12A 1XGEA 3SCTA 4OZOA 2G50A 1ZCCA 4GKLA 1UWUA 3WBXA 3T0DA 2W92A 2V8ZA 4UTTC 4O16A 2WLYA 2XVPA 3NZQA 4LPCA 2A3CA 3HG3A 4JOMA 4KEUA 4WJ8A 3TOYA 3KVMA 4NJGA 2QUUA 4C5ZA 1XJBA 1EX5A 3WQ4A 3PZVA 4LBSA 3T7VA 4FB7A 1FBAA 5DBUA 4J3VA 3CHDA 1UKOA 4BFAA 3KBJA 3TWAA 3B40A 5D02A 2QV4A 5T8GA 4YU1A 1NFGA 2WSPA 1QRQA 4E2BA 2GJPA 2QPXA 3QY6A 2G0WA 3WJXA 4POCA 4Q7IA 3B97A 1ZGDA 1JDEA 1Q7ZA 4AEEA 1QWGA 1ITCA 3G18A 3P62A 4JIQA 3MZNA 1V8EA 3A24A 2ZICA 1CEOA 3ZSTA 3CUZA 5D2TA 1ITQA 2BY0A 3CH9A 3G1DA 4DWSA 1M41A 4QAIA 3C8NA 3MUIA 4JX6A 2WANA 1TJ0A 3VNYA 3T78A 1W3HA 1XCFA 1IZCA 5I77A 2EKCA 3GBEA 3A4AA 5T91A 5I07A 1WCGA 4XZLX 4LEFA 1C91A 4I9AA 3AWOA 3EPMA 4LBRA 3BJSA 2R1KA 4PC8A 5A6LA 2RFGA 3NGFA 4CVUA 1VCGA 3IGSA 4QG6A 1JF6A 2QMJA 3BZGA 2I1OA 3TN6A 4NZ4A 2VD9A 4Q6JA 3MC5A 3DX5A 3UZJA 2RDWA 2HQAA 2DUAA 4W7WA 2WHMA 1HN1A 5CBJA 5CPSA 5REQA 1E40A 3URAA 4ADSA 2DZTA 2YIHA 1NOWA 1LBFA 3IRDA 2AGKA 3PWGA 3FK4A 2EG6A 4CEXC 1IZKA 1MW1A 3S2CA 1N7KA 3KCOA 1H61A 5BZAA 4IISA 3SUSA 4HN4A 4K2SA 2CW6A 1TPH1 5K2ZA 1C8YA 1OFBA 3KZPA 3P5YA 4H7ZA 3AIWA 2OO0A 3S2NA 4JQ4A 3O16A 2E6DA 3H23A 4BI5A 4C6LA 1DTUA 4WXYA 4BQ2A 3ITOA 3SI9A 1BGGA 5U7SA 3CAWA 3R0UA 1JUEA 4AYGA 1ML1A 1O5KA 1Z7AA 4FOJA 2V2HA 3T0AA 5KZ6A 1A5SA 4OJYA 3S1WA 2Q02A 5FD0A 2Z27A 1JZ2A 1OFAA 4XBSA 1GPWA 3HIJA 2PAJA 4UTLA 4S3EA 3QY8A 4Q4PA 4DJFD 1A5AA 1TWDA 3PZGA 1TPEA 3O6AA 3W7PA 4KRTA 3ZJ7A 2V5JA 3F4DA 2PWHA 2ZWZA 1KXVA 3RITA 4JX5A 1M7XA 3L5AA 3VNMA 3ABZA 2VI0A 3APGA 3G1FA 1IR1A 1ME8A 5LNWA 2ZC1A 1AW1A 1LTDA 4PEKA 4JTJA 1IGWA 2E68A 3L2MA 4H7VA 2NQ5A 2I5QA 3N4EA 4RE3A 2DDXA 2FHBA 4AFYA 3GZ3A 4AW7A 4HK5A 2CLPA 1RVKA 3M16A 2ASHA 2QMKA 4O1FA 3B8TA 2QGHA 3IIPA 1E9IA 2X2YA 1EWEA 2OWCA 4J28A 1RY8A 1NDWA 2ZBTA 1E4IA 5D03A 4C65A 4UTWC 4MWAD 4M19A 3C0QA 3O9NA 3RLHA 3W1RA 2VURA 1BG9A 3VNIA 4C7DA 1M01A 1K03A 4QQUA 4A05A 3EOOA 2JIEA 3WF1A 2PDNA 2YZRA 3FHQA 1ZBVA 1C92A 5EU9A 2PF0A 3TA9A 1UKTA 5E0FA 3HV8A 1UMLA 1E6NA 4KCUA 3MUXA 2X05A 4U31A 1MVYA 5RUBA 4UIOA 1W8GA 1E3XA 2WZTA 4OBRA 2QVHA 2L5HA 3W73A 2XFYA 3FVDA 4HNVA 2Z0IA 2OOFA 1SW3A 1BVNP 2X0YA 3I10A 2PDKA 4D1IA 2VEKA 1A80A 4RE2A 4X60A 5EFFA 3HFTA 3S42A 1UD3A 4JL1A 5A6BA 3ARWA 4O18A 1J01A 2PRHA 1ZFJA 5JU6A 1LJYA 2NUWA 4ZODA 3W1AA 3R2GA 4EANA 1ZAHA 4NJKA 1YBQB 2QIIA 2CLKA 4GI8A 3MA8A 4E3VA 1G69A 3MKKA 2XH4A 3UY8A 4QS6A 4IMFA 4C6IA 1ZL1A 4KGJA 4Q8NA 4DWSD 4LJ3A 1T40A 3LCXA 3AYTA 1PKMA 4Y96A 3OZOA 3OHMB 4F2UA 3NNTA 2RGMA 4OV4A 2I9EA 2WCGA 3CTTA 5MF5A 1FP9A 2PLMA 3M7SA 2XVNA 4NJHA 1KXHA 1XGDA 2VENA 1Z9AA 5CH9A 5EPDA 1XICA 1GYNA 3VMNA 1MW0A 3LQGA 4QIUA 4UQ9A 5K4ZA 2PU1A 4NI8A 3E2RA 2PDWA 1XIGA 3NQ7A 3WK2A 2PCQA 2H9AA 2GVLA 1VJZA 3ECQA 3O06A 5AYBA 3CMJA 1J0JA 4A35A 3P93A 3WNMA 1FWTA 4HHHA 4O4VA 2PTWA 2XINA 3R0DA 4JX4A 3KXQA 3DBNA 4P8VA 1A5OC 1UPPA 1MUCA 5EMJA 2F61A 2CLMA 3ZLFA 1CZ1A 1KD0A 3FFSA 5HXMA 5BCAA 3W29A 5CC5A 3N18A 4UFJA 3LY0A 3C0LA 2X7VA 3G1AA 4OQVA 1AMYA 1CGUA 3ISIX 2YA2A 1O94A 2NX1A 3O6CA 1X6LA 4FNTA 3URNA 4NNCA 1RK5A 4FZIA 3KHJA 1OT1A 1RK6A 2CCRA 3QQWA 4JTCA 4FO4A 1S3HA 1YDVA 3GSMA 2BXZA 4A21A 3BW3A 4J3SA 3MP3A 1Q6CA 3VD5A 3WCZA 3GM8A 1I1XA 1XV8A 3EMCA 4MZ1A 4PCNA 2Z4GA 3PBMA 3GIPA 1TTJA 3W7JA 2W27A 3G8RA 2Q8XA 3MUAA 1VD6A 3CPGA 2PWGA 4F4RA 3W02A 4L9YA 2Y24A 5C0QA 5BNKA 4TMBA 1FCUA 2JF7A 1IXOA 4KGLA 3RPTA 2WQPA 4LNYA 3ZT6A 2Z2AA 3LRLA 2E1DA 7CGTA 3V1PA 2C91A 3C2EA 5E70A 4B4HA 4UTUA 3M0MA 1E3ZA 1YPXA 4EE9A 4BJHA 1EYWA 3NYDA 4WDXA 1K7XA 3W1UA 3LZ3A 4GNKB 1JZ3A 3QM3A 1VGAA 1F8IA 1TQXA 3V5FA 1US2A 3DBPA 1K1DA 5D38A 3H22A 5K3VA 5H2ZA 2VR5A 2WZMA 3TX9A 2XN2A 2HMCA 3P61A 3OHIA 1L8PA 3RG6A 2OTDA 4AG0A 1C8XA 2J7HA 1MUWA 5CLWA 5A8MA 4YCPA 3C5QA 1EH9A 1PDZA 3Q2DA 4AF0A 1Q6QA 3BOLA 3MPGA 3AC0A 3REQB 3ATZA 3ZZ1A 4RKAA 2IS7A 5B7YA 3CL8A 3WJWA 4U2ZA 5DY3A 2Q71A 3AOFA 5KZDA 2BDQA 4MYXA 3VGDA 4M6QA 1YIXA 3PTQA 3LYEA 1B3ZA 1GOMA 1XDLA 4RR4A 3WD3A 3RCMA 1KFBA 3W22A 4E8GA 4RV3A 1OWQA 1Q2RA 3LB0A 5E0CA 4A3QA 1YMYA 1ADOA 3BZJA 1H2JA 3OA3A 3CPUA 3TUUA 2O56A 2NSOA 3U7BA 1CYGA 3OPSA 1W1B1 4IPPA 1UD4A 3NQ6A 5A6BD 2BWGA 2OYKA 3CV6A 3IJ7A 4IFRA 3GUWA 3H6OA 4M6VA 5AYXA 2HVNA 1TA3B 4CGTA 4GFIA 1R8LA 4K39A 3G1YA 1C90A 3KRBA 4OOUA 2YJQA 5F2GA 2FVLA 1M53A 3RCYA 4GXMA 4MVAA 3VX0A 3DGBA 3IGUA 1JYWA 3GXTA 3RO8A 2WAGA 4DJFC 2BX7A 1YEYA 3DESA 4LS2A 1XSIA 4V15A 4O28A 1WDQA 1K70A 1CENA 1BF6A 4JIPA 1PV8A 2Z7GA 4FNPA 4BKNA 4C6QA 1J9YA 1Q4WA 4O54A 4A8LA 3SRHA 1JGIA 1VEPA 1DKWA 1DOSA 3JU2A 3RMJA 2QCLA 1CGXA 2BZNA 4UMBA 1KM2A 3OU8A 2Z1BA 3N12A 4TXEA 1QNOA 4CCCA 2GJXB 1G7VA 3VIKA 2XN1A 1OHLA 2EPOA 5DMYA 1KQYA 4UQAA 1LOSA 3KDNA 3VD9A 3BQ6A 2OQYA 3WSUA 3BMVA 3AMDA 4OHQA 1UBPC 3AFBA 3UR8A 1XX1A 3QQ1A 1VC4A 3ITTA 1JXKA 3MUY1 1X98A 2Z28A 4FI4A 3PZMA 4FX6M 1SO5A 2OEKA 1XRTA 4O1AA 1A49A 2PDMA 3W0KA 3DCPA 4GCXA 4X9SA 2OT0A 5FF3A 1YX1A 3IJLA 4YWIA 4MWAC 3NM3A 4Z1DA 3AAMA 3ZR6A 4MY1A 2DJLA 4BS0A 3U7VA 3SGZA 4G6CA 2FFIA 4YPJA 2FZDA 4X2PA 5I02A 4C1NA 2DVUA 3B4YA 3P74A 1KBIA 1VFUA 2XGZA 1NIUA 4A3YA 3URBA 3VM5A 1H62A 4MFEA 1LG1A 1WV2A 3WZ0E 3ES8A 2GJRA 3ME3A 3RGTA 2D1ZA 1YHTA 4C6DA 1W0MA 3LX9A 1T99A 1FWNA 3RPDA 4HMNA 2PZ0A 4ZGYA 3BCJA 3LBMA 3LTPA 3T07A 3PPGA 4OT7A 4XISA 4DAIA 3GDLA 2Y7FA 1UR1A 2OG9A 5BMXA 3A4WA 5K9DA 3S1XA 1M7OA 3S6OA 4QLJA 3S6TA 1U22A 4I9JA 2A7PA 1OYCA 2BHYA 1AW2A 2WMJA 5H8UA 2YA1A 3W7QA 1LOLA 4X3ZA 3GW3A 3ARTA 3LLFA 6TIMA 4AIOA 5EY5A 3RJXA 1QK0A 4TVDA 1A0DA 3UR5A 4IG2A 2DY3A 1TG7A 2H90A 3LI1A 2OZ8A 4LVBA 4LF1A 1H7RA 5CGMA 1F74A 3CJPA 5JMUA 2OKTA 3BLDA 3W27A 1QO2A 2CNCA 4CD6A 3RMEA 3IUDA 2QEZA 3EWYA 4DWSC 1H1ZA 2CYGA 1TX2A 2HPIA 3VIHA 4D6EA 1P0DA 1W2VA 2J79A 2JQXA 3FJLA 3IIXA 1A0CA 2VRKA 3TJ4A 5BMWA 4NG3A 1JCLA 3NYZA 4GFSA 3PBWA 4Q4QA 3ZSSA 4A3HA 4GXWA 3Q58A 4PGLA 4XKMA 1XYBA 2WNWA 4KRZA 3PAOA 1GK8A 1VBUA 5CQ1A 1AL8A 2D0GA 4I9TA 2JGQA 4X63A 2X41A 3CT7A 3R10A 2NLIA 1MNSA 4UXDA 2WKGA 1BYBA 4HBKA 4MUPA 3S0CA 2NX3A 1QMLA 3BOXA 4Y2WA 2FGBA 1NOUA 3VNLA 4BY3A 4IIHA 3MUZ1 2IPJA 3NEVA 4PCPA 3QYSA 1O5XA 1RSCA 4WSHA 4O52A 3LA4A 1A5NC 3RX3A 2F6KA 4G7EB 1SMAA 4MB4A 1JFXA 3WNOA 3B0YA 1WDRA 4YHGA 2A4AA 2JFEX 1MRAA 3SUUA 2B81A 1UUOA 4AY7A 1HKWA 4HD5A 3CHCA 3VGEA 4ML9A 1O5QA 3N6JA 4ROPA 4LB4A 2GVEA 2VNCA 5HULA 4B5NA 2RDXA 1QTWA 3SCQA 3OLGA 4BF7A 2ZXBA 1WDWA 2DQWA 3W1TA 1YW1A 4JIRA 1JPHA 2R1NA 1CBGA 4RDZA 1J5SA 4HOXA 2ZRXA 5EA9A 5GJNA 1GG0A 3SCPA 5AYIA 2OT1A 1V02A 4UFIA 1FOBA 3XINA 1HJUA 1V3MA 1ODZA 3RNDA 2WZHA 2TAAA 1I2NA 3M0KA 2ISFA 3SURA 4KF1A 3QN3A 3OB8A 1LUCB 2FTPA 2CZEA 3VDHA 1JDCA 4AXNA 4K7YA 3BURA 6ENLA 3IAQA 2WVUA 4DI8A 4JY8A 3PBVA 3H2AA 3RR1A 4HA0A 1S5TA 1CW2A 1CXLA 1J0HA 4TX6A 1FH9A 2ZX6A 3W26A 4RW3A 2PMQA 4A4AA 3TTSA 4DUXA 3CNYA 1K8YA 3NIYA 1EJ7L 2Q3RA 3MMUA 4MFDA 3GS6A 4XX6A 4GI6A 2PGFA 4JIHA 3G0UA 2DSVA 1E9LA 3L2LA 1X7FA 4MPKA 3NVTA 3K8KA 4UOZA 2DSUA 2D3LA 3AZTA 1HKMA 2B7QA 8CGTA 1RP8A 4HHMA 1VZWA 1ENUA 2W79A 1QOXA 5M5DA 3ZIZA 3LTYA 4IMCA 4ZO7A 3EGJA 1JNEA 2FZBA 1M9HA 1TSIA 3CTLA 1ZU8A 4YS1A 2E7FA 1L8NA 3CH0A 3NL5A 2DPEA 1E4MM 2BODX 5GQBA 1JDFA 4L9ZA 2WC7A 3WBYA 4D6IA 2VJXA 1I8JA 3W1PA 3DHUA 3BLLA 4UNLA 4WQ6A 3VNKA 3AIRA 2JBMA 4R34A 3GNDA 1VFFA 3QMRA 5F2LA 3OBAA 2XIBA 4W5UA 1J93A 2J9ZA 4HPHA 1DIOA 3S8HA 5DXXA 1WKDA 3ABQA 5DFAA 4I7VA 1YDNA 3S5NA 3QOMA 2EGZA 4CVWA 3ITYA 4LNCA 1TPUA 3OG2A 5PTDA 4KEMA 3KVLA 1ME7A 1PIGA 1TB3A 3TZNA 4MB5A 3G77A 4AXKA 3VC5A 2C8NA 2G41A 3LEPA 3ZVHB 3A4XA 4NSBA 1GYLA 5I06A 2NVAA 2E6YA 2Y0FA 1JJKA 1XH0A 4JCMA 2P76A 3GIQA 3KFTA 3G24A 2QVNA 4HPJA 5AHMA 4DUVA 2IXUA 3MSDA 2ZRWA 3AXHA 3WH8A 3W24A 3VOHA 4MHBA 2VCBA 3VGGA 4IMEA 1G6CA 1UWQA 3PBYA 5CSUA 1E0WA 3K1DA 2ACQA 3KE0A 1H7OA 1LF1A 4GD0A 1B4KA 3DOPA 3QFEA 4QG8A 3WNLA 4JTSA 3DIPA 1V4YA 3KCJA 2P8BA 5HQMA 1I4NA 1GQKA 3AYSA 5G4HC 3GVRA 4DY1A 2YGYA 4RNJA 3ITLA 4JTRA 3R8HA 3BLEA 3E5PA 3P6LA 2E3ZA 1W3LA 3AIUA 1K8XA 1JQXA 1EC8A 1CCWB 5FF2A 3QSRA 3TJLA 4B90A 2Y8KA 1KM5A 3N04A 4JS3A 5EKYA 3NL3A 2IQDA 4JTIA 4ATLA 3VD3A 4AD1A 1GZ1A 4E38A 1Y5XA 2FJUB 4NILA 3C6CA 2BVYA 3EWBX 4ILSA 4QSHA 1TPC1 5F4XA 3FIGA 3MKVA 1RD5A 2PFHA 2QKFA 4FEZA 3FEQA 1UROA 4UBPC 2I5GA 2WK2A 4ZOAA 3Q65A 1US0A 2GDVA 4ZCWA 3QRHA 2DZPA 2GJNA 3VGHA 1W17A 4GA8A 2E8ZA 4HHPA 3EWXA 5FF7A 5BRQA 1X7IA 3LGDA 4FPSA 4Q8UA 3DYPA 5FOOA 4RZ4A 3QZ6A 1NFPA 4OE7A 4M7TA 3NGJA 3RF9A 1XFBA 1XBZA 4WJEA 1UKQA 3ITXA 2QDGA 1NWSA 4XSLA 1GVYA 4GABA 3BW2A 2OYMA 1Q5MA 1S2AA 4PUDA 3BDKA 4IM4A 3LI0A 3UWWA 3LLDA 2XISA 2REQB 4IMAA 4RV8A 3TW7A 2J27A 3P7YA 1C93A 3SRKA 3PJUA 1EDTA 3BSHA 2E1WA 1T7LA 2EXOA 1B3WA 1HJWA 3EPOA 2WSQA 4GI9A 5GNYA 1NEYA 3APTA 3P60A 4YN5A 2FDMA 3HU7A 1XBYA 1DP0A 3ARPA 2BASA 3CIVA 1YBQA 5J04A 3QV6A 1UQYA 4H8HA 3L23A 4QEHA 3OVRA 4R53A 4LS1A 3LRKA 4MDPA 3TAKA 2WV8A 3BLKA 4US5A 2Y62A 2QDDA 2V6AA 2WXDM 4XIMA 1FWRA 3MW7A 3MO4A 3WLKX 3CZKA 1BQGA 1XIMA 2EPLX 4GH3A 1VJIA 3FN9A 1EP1A 4LUTB 2WBGA 2FMNA 3SJNA 1LYXA 4QQ3A 2C7FA 3S83A 3S1VA 1IWBA 5B80A 4S39A 2WC3A 4ZL1A 1K7FA 3C2RA 4ALDA 3CAQA 3MVTA 2NX9A 3VE7A 3NXFA 2VGBA 2AL2B 4R7WA 2EG8A 1IEXA 2WHKA 3WN6A 2EPMX 1JPKA 3LQLA 3V7PA 1Y0EA 2VC6A 1AG1O 1SO3A 5DN1A 1EO5A 1KO0A 2GVGA 1K4GA 3W7LA 1HJQA 3T05A 4PRWA 4H9TA 2QCGA 1ZS2A 1SZRA 3GFZA 1ELSA 5C9ZA 1I0BA 2XSXA 2Y89A 2VEGA 1MEWA 1K9EA 4AYSA 4AWUA 3WY1A 5LA0A 5H8PA 2I14A 3N1AA 1XWYA 1AD4A 3TA6A 2JKAA 3W2LA 1W5NA 1HJXA 2E9LA 3Q45A 2KAUC 2GFTA 4C6MA 1T41A 5DELA 4WF7A 3D6NA 1LL4A 4JNYA 5DCBA 4HNCA 4L4PA 3L9CA 1QOPA 1AFSA 3CU2A 5I6SA 3W84A 1TX0A 2XSAA 1GONA 3TTYA 1TWIA 4PBFA 2QS8A 4JFUA 3DHDA 3QW3A 1XPGA 4GACA 4IQDA 3W38A 1Q6GA 1OZMA 3DAQA 4PTNA 3H2OA 5CPLA 3E0VA 1V51A 3PHAA 4QDMA 3MYOA 2VGGA 4W87A 4J35A 4ZENA 4HJWA 3NO5A 2FPVA 3HZ3A 1ISYA 3ZR5A 2BV9A 1OCJA 3CT2A 2RAGA 2OU4A 3VGBA 4C6NA 1E55A 3POCA 2QPSA 2WSYA 3B9DA 4X22A 1BVWA 3LCIA 3MHGA 1QHZA 1GPFA 2NV1A 4KCTA 4QJ3B 1U5JA 4HU8A 1XHGA 4U5KA 4Y9MA 4IIDA 4XO7A 2D20A 4NZCA 3LLXA 4H9UA 2JALA 4NZ3A 3G3MA 3PSVA 4FNRA 1N8IA 3UA3A 2Z1VA 1QDSA 4C1LA 3HURA 4B91A 4F3HA 2XJ7A 1H09A 3AYRA 3OBKA 1SFLA 3T0TA 1EGMA 4FHAA 4GGHA 3GHRA 2NV2A 3HG5A 2EQDA 4UUIA 3URQA 5I5RA 4DHGA 2IPFA 4PE8A 2G3MA 4C91A 1E56A 3VX1A 4O8RA 4RNFA 4D6GA 1XF0A 5IHSA 5C6MA 3N2BA 1WXZA 1JCJA 1TTIA 1MMFA 3ONBA 3VZZA 3KUMA 3L4YA 3EDKA 4K36A 4KPLA 2DV0A 1M7JA 3HGJA 4PMVA 4XAZA 1NQ6A 2FH8A 1F3WA 4YVPA 2NWRA 4FNQA 4TVUA 1YDYA 1F3XA 3QR1A 1FXQA 1TJPA 2XG9A 2R8WA 3BH4A 1FKXA 4PUNA 3DG3A 1AW5A 1Z42A 2YXXA 3CZLA 3EWDA 4JQAA 4N9DA 1AK5A 1JNDA 4LYQA 4XUGA 4Y9PA 3REQA 1XIHA 1VQTA 3FY1A 5LNUA 1R9XA 3SQSA 1YXYA 4PTVA 4JTAA 3C4UA 2CBVA 5KZMA 2I7GA 1H63A 4IIBA 1V79A 4LS0A 3SUWA 1Q7MA 3F4VA 1SUXA 4Q7BA 1DIEA 1GJPA 2R1MA 1NOFA 3I7QA 4IPLA 3AWNA 5C7VA 1EIXA 4TUFA 4MJMA 3UZYA 4LC8A 1FRBA 5XIAA 4UQBA 1GVQA 3N11A 3WMCA 1PX3A 4PUJA 5DMMA 2J75A 2CLLA 1WNOA 2CXEA 1TA3A 2TPSA 4G1KA 4OIFA 1D3GA 5A8QA 3U6WA 2PWFA 3WLQA 5AC6A 1P43A 3IJ6A 2QF8A 4M1RA 1D3HA 1C8VA 5DY2A 4B5TA 5CZ0A 2Z25A 2CBUA 1EO7A 2J7FA 1E0VA 4US5D 2INZA 3M7WA 3NEHA 3AUJA 1MDRA 2TODA 1L0PA 3GXDA 4PRRA 3E5BA 4DZ5A 2WO5A 2ANUA 2AAAA 1V3LA 4IGSA 5FI8A 3AS1A 1XD1A 1AZ2A 2GJXA 3H21A 4R88A 4XZIA 2ISWA 3NZ1A 1I9CB 3E12A 2BBFA 1OC6A 2HE8A 4GO8A 1ZBWA 3XIMA 1S2WA 5HJYA 5E0KA 5T9CE 4B15A 1JQVA 1E9YB 1H4PA 3EA1A 4DF1A 2ZA2A 3HG4A 3CQJA 2OZTA 4KS0A 3PJWA 4AX7A 2Z6JA 1FFRA 3O1NA 5AKQA 4A8NA 2YLLA 3QYQA 1WUFA 1VLWA 4OUEA 3GXFA 3APYA 3NQ2A 1PWLA 2W5FA 1NARA 2ZDRA 3PM6A 2C18A 3LXBA 1TPB1 2W3ZA 1BVZA 1KXQA 4Q3MA 1BG4A 4ZQRA 4HCLA 4H8NA 4HQVA 2G4FA 4LVAA 1IEVA 1V6VA 2RGLA 4JTTA 2IKGA 3T1GA 3OW1A 5I23A 2ZZ1A 1AQMA 1FWDC 2WCSA 2HS6A 3GR4A 4A22A 4EPEC 3BAJA 5E5CA 3MMTA 3TYBA 4PFHA 3L0NA 3VXGA 2PRLA 1EJWC 2DSZA 4Z1AA 2TYSA 3TV8A 5K9CA 1UH2A 2VDGA 1OADA 2DEPA 3G5EA 5L6UA 2J7BA 4GHRA 2VFGA 3AIQA 1QFEA 1MO0A 3L4UA 1UB3A 3W2JA 1JEZA 2FTYA 3S4TA 1L2UA 4JHZA 5EFDA 4LY8A 2HV5A 5HWJA 1XLMA 3UWUA 3W2NA 4Q8PA 1E0TA 2J8GA 3OA5A 2Q8LA 4ZQMA 3DI1A 1YTKA 1RCQA 3A64A 3KTSA 4M51A 2FB2A 2AOSA 3GNRA 4C6EA 1NF0A 3BJFA 1RJQA 4JTGA 1W56A 2BHZA 1BYDA 2CITA 1O95A 1EJSC 1NP0A 2VZSA 4JIEA 4JZ5A 2GLKA 2GSHA 3RX4A 1MQPA 4GX8A 2WJFA 2QUNA 5T26A 4JKLA 1KM6A 2AQWA 1Q63A 5DBTA 5I24A 3GH5A 3RPMA 1A5MC 1EGZA 1MSSA 1FH7A 2BOEX 3ABRA 2E8YA 1S5VA 2J47A 3N2XA 3WQ5A 3PWIA 3IJ9A 1Q6DA 4GYKA 3EOSA 3FOKA 5C2XA 3QGVA 3LXCA 1NQKA 4NX0A 4AD3A 3LDVA 3AIBA 3BCDA 3WMSA 1MFUA 3LGGA 3AUOA 4E4PA 2D2HA 3SDOA 1U83A 1A5LC 1BHGA 4UCFA 2IW0A 3W01A 3UBPC 1XRFA 4QE5A 1I2OA 1ICQA 4JHOA 4WY0B 1GQNA 1IWAA 3BC9A 4NX5A 4WZHA 3SW6A 1FVPA 3B03A 4JN7A 3W72A 2R94A 3M0HA 1UCWA 3FAXA 3NQCA 3E38A 4KW2A 4TOQA 4G7EA 3LGEA 1PSCA 5E1QA 1OCQA 3OZYA 2J7CA 3QKEA 2QLYA 3NQ8A 2NUXA 3GBDA 5CZSA 1V6WA 2YBTA 6ALDA 2RKXA 3TN4A 3CUHA 2UY5A 3TYUA 1J18A 1KC7A 1VPXA 2YOCA 3XISA 4L1GA 1EF3A 4DXKA 3DFSA 1BRLB 3RXZA 3ABSA 3M6YA 5CKSA 3M47A 5G5IA 1PO9A 1PPIA 2WBKA 4ZB5A 2YA0A 5D05A 3FW6A 2O4MA 2QCCA 1K9DA 1O68A 1LBLA 2P50A 2PWDA 3SGGA 3OIHA 1T0OA 4J3WA 3S9IA 4ZFMA 1UA7A 4QXIA 2FDSA 3GYCA 3DC8A 3JZUA 4LVFA 1R86A 3C2VA 4O11A 4UNKA 1OIMA 5FJPA 3TONA 4WGXA 4F0MA 2PP0A 1DV7A 4M3PA 1QBBA 2FB3A 4D1JA 3MVIA 3AALA 5I78A 3PTDA 5A69A 3E96A 3V36A 5D33A 3IJDA 2V5BA 4EX4A 3WQDA 3OGSA 1YNQA 3QC0A 1TUFA 3MHFA 3CGTA 4R7JA 1LUCA 5JQ9A 4BF5A 2WMGA 4NU7A 4IZGA 1N82A 1WE5A 3NOEA 1I60A 5I79A 4I3GA 1DQUA 3TQ0A 1TV8A 4IJCA 1P48A 1Y5WA 1THFD 2C1IA 1SR9A 1WDSA 4IP5A 3T8LA 4DELA 5LSMA 1JZ7A 1W3IA 1AODA 3KVKA 1EPVA 3OLEA 5F4SA 5HMDA 1R85A 4BI7A 4RE0A 2E25A 1TPWA 1JF5A 5I00A 2QULA 4DBUA 3H53A 1HO4A 2D73A 4L7ZA 5AY7A 5AC5A 3FX4A 3OQ8A 3GXNA 4QJ5B 2WM1A 3BAXA 5IHRA 3NJ3A 1XQLA 1JCXA 1IZJA 1LQAA 4R33A 3C0SA 2V2CA 4MZ8A 4WK9A 1F2JA 1W8SA 1R30A 5CZTA 3ANYA 2B7NA 3MI2A 3AICA 3LU2A 4U33A 4PUMA 2ZTJA 1DJYA 4ZXOA 1VJSA 1JCTA 5M1TA 2YBVA 1S2TA 1K7EA 1YTDA 3LN3A 3MANA 1SFJA 1SSGA 2HE5A 1BGAA 2XH2A 5CXPA 2XIOA 4JQ1A 3VCNA 1XRVA 1UJQA 4FLQA 4LRTA 3YPIA 4Z17A 4N4PA 1H0IA 2WMHA 1TMHA 4QITA 2WNNA 2EHHA 2PGWA 3B0PA 5FJJA 3N2MA 4AH7A 1VLIA 3VIPA 4L4MA 1W1IE 5E9XA 4J4KA 2W66A 2PRMA 1R0MA 1FA2A 3CWHA 2QJGA 2ISVA 1LOQA 4H9VA 4WLCA 2VGIA 1OYAA 3ZVHA 4KIEA 1DJWA 1A3XA 2OQHA 2VFIA 3USZA 2YDSA 3H2NA 3GAYA 1EC9A 3KBVA 3N13A 4DBWA 4V2XA 2J4GA 4AWSA 3GC2A 4RXFA 4ZA0A 1J79A 2PDPA 4JTDA 4MIMA 4ADTA 3QQ0A 4L80A 3ARVA 4DWDA 3FV9A 1FWJC 4RDVA 3ANVA 3G6MA 1KM4A 3ARRA 3RM9A 2P10A 2VFEA 5C55A 5HNUA 4JYEA 4Q4RA 4D6FA 3I3EA 4AHPA 2CLHA 4A29A 4G8TA 1A5CA 2X40A 4GO9A 4R85A 4IH3A 1RQBA 1TZZA 3SM0A 3N73A 2E9MA 1JZ6A 3G3DA 3BPWA 2XFWA 1JD7A 1NDYA 1JD9A 5FL1A 1GQLA 3W07A 3OTRA 3VZXA 4N9EA 4W89A 1P0KA 3PTKA 5DRCA 2XM2A 1TJRA 1ZCOA 4WY0F 3W70A 1PZ1A 3MCOA 4FXFA 5TQLA 4H41A 1UHVA 2YSWA 5TF0A 1LT7A 3CQ0A 5F1VA 3WMBA 3NDZA 4EK7A 2BY1A 1RCXB 1GG1A 3S2MA 3P67A 3FEMA 3IVSA 1QO5A 2X7WA 2X0SA 3CYVA 1XPYA 1D2KA 4PL1A 3UWQA 1GTHA 2ABAA 3WH6A 1Q6LA 2R1PA 5BROA 5CG7A 2P3EA 2ACUA 4I7UA 4LAZA 3CAVA 4Q8MA 3B8IA 3GO2A 3QHNA 3HQ1A 5DMNA 3GLCA 1SJBA 1P1MA 3L67A 3VNZA 4R9XA 4ERAA 4ZO6A 3A5VA 1MEIA 4N02A 3G2GA 2QJMA 3LNPA 4F8XA 1CI1A 2AGTA 2QAPA 3KTXA 2VZTA 4A3RA 3IS4A 1R38A 2E77A 2E09A 3V16A 3M9YA 3GR7A 1PIIA 5DF0A 4FNSA 3F5LA 3WLJA 4B2DA 3TCSA 3I3BA 1EDQA 4O14A 3NR0A 3M07A 4OUIA 1V3HA 1NF7A 3CQKA 1G4SA 4HK6A 1HG3A 4XAPA 2VTFA 2WWCA 2NVDA 1OZQA 1PKYA 4MM1A 3IJQA 4P7NA 3U0HA 1G9HA 3QTPA 1ITXA 5FL0A 1BXCA 3R5EA 1IEQA 3ANUA 5HPCA 4B16A 4EAYA 2HWGA 5BOEA 3ABXA 4FX8A 2VC7A 2PODA 1PJ9A 1R6WA 4DVOA 3N14A 3CB3A 4AY8A 4PULA 2O92A 2PLJA 4JCLA 2PD5A 3NURA 1FWWA 2GVYA 3W7GA 3VKCA 4E6MA 3TYCA 2DVTA 2JF6A 4AVNA 5BU9A 3TW6A 1L6GA 5A2AA 2I17A 2ALDA 3TIMA 4JKMA 2Z2UA 1CGWA 2OLAA 2CKRA 1J11A 4PN2A 3RLVA 1R3YA 3THAA 2JEQA 4IGMA 4CU6A 2PTZA 1WBHA 2C79A 2VZOA 1X1ZA 4LH8A 4LUTA 3F1QA 2PDUA 2ZIDA 5F7UA 2HSAA 2P1FA 1JPIA 5HNTA 2B7OA 3LTSA 4HTYA 1R5YA 4GCAA 4HCDA 3S1GA 4W8LA 1XW8A 1GOWA 2AL2A 3W7OA 2PP1A 3V4BA 3G1VA 3QZAA 2BY2A 3EDFA 1GHSA 4LXFA 3PN8A 5FKYA 4ACZB 1I2RA 4GZJA 1R47A 3TXZA 3MZ2A 1J6PA 2WSRA 1XLLA 2HROA 1EOKA 1IEIA 4HSNA 3UR2A 1JYXA 3TK7A 2WC4A 4HNTA 1XLDA 7ODCA 1L6YA 3LPPA 4MJ4A 4L9XA 4F40A 3NFUA 3DFNA 1B31A 5IOBA 3QVQA 1H5YA 3HA1A 1QXLA 3BO9A 3E0FA 1RR2A 2OO6A 2DQXA 5C8BB 4X0NA 3U57A 1JZ8A 2J7DA 4CUCA 4QR6A 1LLWA 1A50A 3P80A 2CZFA 2AQVA 4GQQA 4KQNA 1EBHA 3G0XA 5F1UA 2P5NA 1CB2A 4IFKB 4R5EA 3DC0A 3AHVA 1J0YA 3TJXA 4A2RA 5I3IA 2FJKA 5F2MA 3HGOA 3UYIA 3KS6A 1H11A 3SECA 1S38A 4F9DA 1UZ1A 2ALRA 1NWRA 1OEPA 1XC6A 3CS2A 1IT8A 3RILA 1M3UA 3FAWA 3LM7A 3GDKA 3GXPA 1Q6FA 3EB3A 4DZHA 1J2BA 1IIHA 4MZYA 3RCNA 4DBDA 2XUCA 4RPQA 2Y85A 3GHTA 5HINA 4GUIA 3TH6A 3EWUA 1XISA 2MNRA 3RN6A 2PWUA 3PB0A 3QPYA 3TP4A 1TTPA 1IXNA 3UJEA 2FFCA 1TVPA 4WCJA 3QKZA 1H7PA 1FQ0A 2Y63A 3I3DA 2QCEA 3WLTA 3KW3A 4AUBA 3U9IA 4LX4A 3WK1A 4ICMA 3LSCA 3CK5A 2OZ3A