4ERIA

Evidence for a dual role of an active site histidine in alpha-amino-beta-carboxymuconate-epsilon-semialdehyde decarboxylase
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
331
structure length
331
Chain Sequence
KPRIDMHSHFFPRISEQEAAKFDANHAPWLQVSAKGDTGSIMMGKNNFRPVYQALWDPAFRIEEMDAQGVDVQVTCATPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKVLAQVPLQDLDLACKEASRAVAAGHLGIQIGNHLGDKDLDDATLEAFLTHCANEDIPILVHPWDMMGGQRMKKWMLPWLVAMPAETQLAILSLILSGAFERIPKSLKICFGYGGGSFAFLLGRVDNAWRHRDIVREDCPRPPSEYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLGEQKIGGLVLSSNLGESAKDKIISGNASKFFNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence for a Dual Role of an Active Site Histidine in alpha-Amino-beta-Carboxymuconate-epsilon-Semialdehyde Decarboxylase
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
total genus 123
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4eriA00
2E1WA 4CEUC 1UMLA 3LSBA 2GOKA 4Z42C 4HK7A 3A4JA 4IH3A 3A3WA 2D2HA 4P5UA 4PCPA 3LU2A 3FEQA 3ISIX 4B91A 2QPXA 1J6OA 1FWGC 2Z2AA 4GY1A 4H01A 3GU1A 2ICSA 1O5RA 2Z2BA 4C6KA 3S2MA 4B3ZA 1YNYA 1EJVC 2VUNA 3ITCA 4C5ZA 3NQBA 2HBVA 1YRRA 4XAGA 3NEHA 1V4YA 3GUWA 2OB3A 1WXYA 1WXZA 4GY0A 1EJUC 2VC5A 4H9XA 2PLMA 5HMFA 2P50A 4YIWA 1EJWC 1YIXA 2R1LA 4RDVA 4AQLA 4KEUA 4I6VA 4INFA 4C5YA 4J2MA 3RYSA 4H9VA 3GU9A 2Z00A 3GIQA 3S2JA 5G4HC 2XIOA 2Y1HA 4KF1A 3EGJA 3LGDA 3K4WA 3F2DA 1EZ2A 2FVKA 3E3HA 2OQLA 3S2NA 1NDYA 3PANA 4C6MA 4UB9A 3PNUA 4LAKA 1POJA 3OQEA 3DCPA 3GTIA 4R88A 3TN5A 1FKXA 4KIRA 1POKA 2Z7GA 2D2GA 4QRNA 4L6DA 4CQBA 2FTYA 3QY7A 1V7AA 4HJWA 3E0FA 2Z28A 4KETA 1V77A 3B0XA 2OGJA 4EPDC 3DUGA 1FWBC 4CQDA 3K5XA 2A3LA 1EF2A 5AKQA 4I6KA 3MVTA 4LCQA 2R1PA 3PBMA 2YB1A 3S2LA 1RJRA 3MVIA 4QTGA 3F4DA 1R9YA 3GTHA 4C6PA 3HTWA 4R85A 3V7PA 4DLMA 3E38A 4C6NA 4EPBC 1PTAA 1KRBC 1FWFC 3OU8A 1BF6A 3RCMA 4J5NA 4V1XA 5E5CA 3SO7A 1P1MA 4WHBA 4CEXC 3GRIA 2VHLA 4C65A 1EJXC 2EG6A 4GY7A 3EWCA 3URAA 4AC7C 3T8LA 4GXWA 3G77A 4XD4A 3URBA 4KEZA 3RHGA 4F0LA 4KESA 4HK6A 2D2JA 1FWAC 2QS8A 3GU2A 2QVNA 2OODA 3JZEA 3E74A 2ANUA 4C6BA 4ERGA 2UZ9A 3F4CA 4QROA 3WMLA 2GSEA 2PAJA 1YBQB 4IF2A 1E9ZB 1R9XA 4M51A 5LXXA 4IGNA 1S3TC 4HA0A 4E3TA 5A6TC 3OOQA 1EJTC 3OJGA 4F0SA 2FVMA 3UR2A 4LALA 2UBPC 4NI8A 2YZ5A 1ZZMA 4ERAA 1RK6A 4IFOA 2WJDA 1A5OC 4G2DA 1A5LC 2FTWA 1J6PA 4GX9A 3IARA 4C6CA 4EPKA 2VC7A 4DIAA 4EPEC 1I0BA 1QXLA 1YBQA 3CJPA 4D8LA 1FWIC 2Z25A 1KRAC 4H9TA 4B90A 3GG7A 2HNHA 1ADDA 1FKWA 3D6NA 3CAKA 4H00A 4XAYA 2Z26A 4EP8C 1E9YB 3AU2A 3B40A 1RJPA 1UIOA 4XAZA 4IFKA 1K70A 3N2CA 4F0RA 2AMXA 3URQA 1FWDC 4BY3A 4QSFA 1I0DA 4GZ7A 1XGEA 2KAUC 3IJ6A 1GKPA 2WJEA 3TN6A 3KM8A 2ADAA 3UF9A 3OVGA 4LH8A 1RK5A 2R1NA 3GTXA 1EYWA 4LCRA 4JOMA 4G7EB 4C6LA 2PUZA 2PGFA 3F2BA 4XD3A 2F6KA 2G3FA 4PCNA 4H9YA 3R0DA 4R7WA 3OODA 3A3XA 4PBFA 1JGMA 1ONXA 4L9XA 2P53A 4GC3A 3TNBA 4C6EA 2DVXA 1R9ZA 3LSCA 1GKQA 4LAOA 1J79A 2GWGA 3K2GA 3LY0A 3WZ0E 4C6DA 1W1IE 3BE7A 2DVTA 1XWYA 2AQOA 4QS5A 4DO7A 2ZC1A 3F2CA 4NP7A 1HZYA 3TN4A 3NURA 4C6FA 4CQCA 4CNTA 1XRTA 2HPMA 3GIPA 3CS2A 1K1DA 4UBPC 1P6CA 4DNMA 1ONWA 1O12A 3PNZA 3QY8A 3C86A 4RZBA 4IQJA 3B0YA 5FSDC 1DPMA 3PAOA 4WGXA 3MTWA 2FFIA 4DI8A 4LCSA 2HPIA 3AU6A 3O0FA 1RA0A 4C6OA 1FWEC 4GBDA 3FDKA 3LS9A 1KCXA 3ICJA 2I9UA 2Q01A 3LNPA 4GOAA 4ERIA 2O4MA 1J5SA 1QW7A 1A5NC 4IGMA 4C6QA 4ICMA 4PBEA 2VR2A 1VFLA 4LEFA 3T1GA 3WYZA 2VM8A 4QS6A 2I5GA 3AUOA 4KQNA 1A4MA 1ITQA 3MDWA 4ZSUA 3ORWA 1PO9A 1P6BA 3QY6A 4RDZA 1RA5A 1M7JA 3LGGA 4KEVA 2GZXA 3UR5A 1IE7C 2EG7A 4DI9A 1UIPA 4IG2B 1NDWA 1A4LA 1K6WA 3MKVA 4H9ZA 4C6IA 1FWHC 3IGHX 3IV8A 4C6JA 3UPMA 4CNUA 3URNA 1EJSC 4RDWA 1NDZA 3IACA 2HBXA 1PB0A 3T81A 4WVXA 4H9UA 3MSRA 4DYKA 4PE8A 3O7UA 1GKRA 2CZVA 3EWDA 3E2VA 2Q09A 1FWJC 3TN3A 2PGRA 4RE0A 1ITUA 4IG2A 2W9MA 2EG8A 2HQAA 4CNSA 3HPAA 4C60A 5HMEA 4OFCA 4J35A 4NG3A 2Z29A 1NFGA 1FWCC 1EJRC 2R1MA 3RN6A 3MJMA 1PSCA 4DZHA 3S4TA 2GWNA 4ZSTA 2IMRA 4HK5A 4LFYA 4GYFA 1NDVA 2E25A 2O4QA 1RAKA 2Z4GA 4BJHA 4LANA 4XAFA 1M65A 1UBPC 2RAGA 4BKNA 3IPWA 4DLFA 1RJQA 3E0LA 3HM7A 4KERA 1A5KC 4RDYA 2Z24A 1V51A 3GTFA 2YB4A 3QGAC 4TQTA 4XD5A 3MPGA 1XRFA 4GK8A 2R1KA 2BB0A 3LA4A 4MUPA 4DZIA 4XD6A 3DC8A 2Z27A 5CH9A 3FDGA 4GX8A 2WM1A 1M68A 2AQVA 4IFRA 3QGKC 4B92A 2BGNE 5FSEC 2YXOA 5HMDA 4G7EA 4IFKB 1YMYA 2WJFA 3SFWA 4H9MA 1KRMA 1V79A 2DVUA 2OOFA 4V1YA 2QT3A 1KRCC 4LAMA 3MDUA 3ID7A 1A5MC 3IRSA 3UBPC
chains in the Genus database with same CATH superfamily
1BSLA 1TMLA 1WZAA 1E4LA 1SSGA 3LNMA 1BTCA 3OLDA 1J5TA 5I3FA 3M0ZA 4QJ1A 4S3FA 5HDRA 3UYCA 4LS0A 1DE5A 1U1JA 4EWND 1QI3A 3A3HA 2Z1VA 3PJUA 1NU5A 3EBVA 3HPZA 3RITA 1EJUC 1GWJA 1QASA 3N3TA 4HCLA 3GS6A 4MJ4A 1R3YA 4ICCX 2POZA 5KEZA 1I60A 3CMJA 5FEZA 3GIQA 3FNDA 1Q13A 2PDNA 3HQPA 3DIPA 3KRZA 3W1PA 4RNFA 1HG3A 3B97A 1K7FA 4AG0A 3OVRA 5ENLA 3E3HA 3MMDA 4WY0B 1WP6A 1U1HA 1Q65A 1IHIA 3CMGA 2E9BA 4GUHA 4DPQA 1P0KA 2ISWA 4JQ4A 3MP3A 1RQBA 3TTOA 1GYMA 2RH9A 5I7GA 5EY5A 1CI1A 2MUCA 1FP8A 2P8CA 4OWGA 2I16A 1V7AA 4RUBA 3LPGA 4Z2JA 5ABFB 2FB2A 1QNSA 3EWYA 2AGTA 3SCQA 1GPWA 2WZIA 1BRLB 3KDNA 4MF4A 1ZTVA 2PTWA 1AQ0A 4MMWA 3NQEA 3BC9A 5H91A 4UMBA 3UWQA 3RIKA 4S3BA 4Y8EA 2FJUB 4R27A 3OLGA 4DJFD 5AYYA 3S42A 3GH7A 2J24A 1RVGA 1EC8A 3UQNA 1W1B1 1J0YA 4QIUA 2PDGA 4RJEA 3VNLA 1VPQA 4WHBA 2E4TA 2FZMA 4LUYA 4Z1AA 4ZL1A 4Q33A 1KWGA 5MKGA 4ZO7A 3FVMA 1XDMA 3B8VA 1JF6A 1FCBA 1AJ2A 3L4VA 4MB1A 1J2WA 4HK6A 3WLQA 4GO9A 3UNTA 1V0NA 1LYXA 1LP6A 1XBXA 4L4MA 1TB3A 2F9RA 3WMBA 4QROA 4DO4A 4GUGA 3VK5A 2OELA 1BTMA 2OWWA 1GOXA 2O9PA 2NT1A 3A5FA 4IF2A 3GVVA 4AHQA 4OJYA 4E3TA 5A6TC 3DDMA 4W8LA 4ZXOA 2EF9A 2FVMA 1WDWA 3SZ8A 4BI6A 3G1AA 4M81A 3BG3A 3AC0A 3FJLA 2DUXA 4BF7A 3IARA 1EP1A 3U7BA 1NF7A 4K7VA 3RMEA 2ON3A 1V7YA 3S1WA 2WMFA 4DIAA 3G1HA 1GVOA 2R14A 2WNZA 3CJPA 4D8LA 4FB7A 1XIIA 3AHTA 2WMIA 1TTJA 5C0QA 3TR2A 3MQTA 5G1YA 3NGFA 4JNZA 3S1VA 1WZMA 1XBZA 3O3RA 4XAYA 1K4GA 3L12A 1D2KA 3EA1A 4IJBA 1OFPA 1B3OA 1MW0A 4TIMA 3I7SA 5FF3A 2OVLA 1HFBA 3W1QA 1FWDC 4U33A 3WO8A 3ZWSA 3CWOX 1N82A 4GNKB 3U7VA 3PZGA 3OVGA 1Q63A 4JIPA 3VVGA 4W5UA 1N8IA 2WHKA 4NZ3A 3Q4DA 1AQHA 4PCNA 4IIEA 1WUFA 1BVWA 3FS2A 2JEPA 4PBFA 3NZPA 3AS2A 2PGWA 4C6EA 1G5AA 4WEVX 1RZMA 3KBJA 4LC8A 1VFTA 1SZEA 4DBEA 2AQOA 1AW2A 1U5HA 2ZC1A 4CCEA 5EBAA 3BH4A 3KBWA 1TPC1 1P6CA 3A5VA 3R5EA 3S5OA 3B0YA 5BRBA 1V93A 4MZ8A 1ZGDA 2B81A 2G3MA 1TA3A 4PGLA 4NNBA 1W3HA 3BG5A 1PZ2A 4KGJA 4D6FA 3GB6A 1US2A 1UG6A 2HVNA 1A5NC 3EDKA 3Q94A 3VIFA 5I23A 1E15A 3G0XA 1MW1A 5J5DA 3IAPA 2IUZA 2HE8A 3AZRA 5A6JA 1QW9A 4RE3A 1DJYA 5HNRA 1QI2A 1G7UA 1MEIA 1K7XA 4AIUA 4FXRA 2CLLA 1J11A 4UTJA 4GYPA 5C71A 4RDWA 3IACA 3NQ7A 3S5YA 1PB0A 3WF4A 3DKLA 1V5XA 4JX4A 3DESA 4GFSA 5TAOA 2G0WA 3MY9A 4MNLA 2PLCA 3NQAA 1T7LA 2PGRA 2PWFA 3IK4A 4JY9A 4QDWA 5CJ5A 3CHEA 1I9CB 3NZGA 2OEJA 1Q6CA 3MYOA 1R2SA 4BR1A 1NFGA 2W91A 4MZYA 4MY1A 5AVNA 2R1MA 1Q7QA 3WLJA 1Z32X 4UTHA 2PWEA 1SM9A 3KDOA 4U5KA 4LAUA 2PLKA 4U3CA 4UC5A 1H7NA 4GABA 5AYXA 1S46A 2CLMA 2QCMA 2YW3A 3WNKA 2JALA 2XZ9A 4G7FA 1EIBA 4KWOA 3EOEA 1JFXA 1TV5A 1QOXA 2ZADA 2PPGA 3HN3A 3R1ZA 4BI7A 3UJRA 3EWBX 4DHGA 2EPKX 2NSXA 1W37A 4AC1X 4GX8A 2Y4SA 3G22A 4KS0A 4WQ6A 1S5NA 1F6YA 1JVNA 3I65A 2BOGX 3KWXA 3THQA 5ECUA 3P7YA 4QLKA 4DUOA 4GYJA 3W37A 3W1NA 3SFWA 3W1LA 3RPMA 3KVKA 1FWRA 2X09A 3UEQA 1TMQA 3ID7A 3TYZA 4QAWA 3UBPC 3BCFA 2B0MA 4GFIA 4CEUC 4AD5A 3ENLA 5KZMA 4MPQA 2XU2A 3W7PA 1DTNA 4FNRA 4Y9OA 1JRCA 1PKYA 4J3WA 1E70M 3WH8A 3BLIA 3VOGA 3W01A 4K39A 4GZEA 4R9XA 4MB3A 1TPDA 5CC3A 3E02A 2Z2BA 3GXFA 1UC5A 3D47A 1H60A 2D3NA 1XYLA 3V16A 3UW6A 1E6PA 8XIMA 2NXGA 3QC3A 1V3LA 4GY0A 3U57A 3EX1A 4NXKA 5DO8A 3QV7A 4YIWA 2XIQA 2OPJA 1CXFA 1ZQ5A 3S0CA 2TSYA 3GW0A 4J9JA 1A0DA 2D23A 2Z00A 3S2JA 2J9ZA 2AL2A 1IT8A 3I6RA 2PF8A 3EB3A 3DFPA 2GYIA 3TOPA 2DZXA 2D2OA 2DGAA 1X8FA 4GLEA 3QPZA 4DUWA 1W1PA 4KW2A 2VQUA 4FZIA 5F4SA 2BVDA 1UYQA 2QJHA 1P4CA 3TMQA 3HBLA 3GVGA 4TV6A 3LHUA 2DY3A 2VRQA 4K37A 4TMBA 2XN2A 4TUFA 3TU9A 3U4AA 4HJWA 3TQVA 4DJEA 3W70A 2EGZA 3VCRA 5DMLA 3DUGA 1L6SA 2QHAA 5D33A 3S5SA 1XLHA 1E43A 4LBSA 4Q8NA 5D30A 2A3HA 4KGLA 4JNYA 4TXEA 3LV6A 1TTPA 3S1UA 1OYAA 3A22A 1P1MA 3BGAA 3OYZA 1XISA 3IJDA 1BG4A 5I78A 5EMYA 3HV9A 2PZNA 4ACYA 3HGOA 1WAUA 4KESA 1P6WA 3PPFA 2D2JA 4V33A 3UWUA 3KP0A 3D5HA 5I6SA 1ZFJA 5D9OA 2Y5SA 1EHNA 2ZZ1A 3D0CA 2IQ0A 1TX0A 1I2OA 3A64A 1KFJA 4AVOA 1G01A 4OIFA 4LVFA 2XISA 2PP1A 3G1YA 3ARRA 1ZP4A 4AYGA 1RP8A 2ZZ6A 4FF7A 1XLFA 2ZC8A 3VU2A 4XBKA 4ZTXA 3MWAA 4PUKA 4LGXA 3REQA 2QULA 1XYFA 3BGJA 2QGYA 1EGMA 3AXXA 1YTEA 4JCMA 2HNHA 3U4FA 2XHYA 3CAKA 4LUSB 4WKFA 5AN7A 2YDRA 4DWSC 1TJPA 2ZTKA 3V0SA 3H22A 4I90A 4JFWA 1QPKA 2B7QA 2YCLA 1N8FA 4Y6GA 3CO4A 1K3UA 4G7EB 1UHVA 4XD3A 3V1HA 1OF8A 3N2TA 4BWLC 1BF2A 3R0DA 2Q3OA 3EKZA 4V2XA 1R9ZA 3NL3A 4HA4A 2WSPA 1GKQA 3LY0A 5A6BD 4ADUA 3U3HA 3BE7A 3O6AA 2HCVA 1XDJA 3TN4A 3CH9A 2Y70A 1HL8A 3APGA 5CEWA 1KBLA 1BGAA 3VM5A 1C8YA 3PTQA 4KH2A 3TUUA 2HPIA 2WPBA 2ZZ7A 4KFPA 1JZ6A 3DKJA 4O4VA 4GVHA 3B9NA 4NIRA 3IJIA 3IWPA 2Q02A 2YFNA 3H6OA 1B5TA 3QQ1A 1PVNA 4OQVA 4GIRA 1Q4NX 4C1NA 4KQNA 5BMWA 1H7OA 3VKKA 1OD8A 5CG7A 1EGZA 3CAQA 3O6CA 3LGGA 1UQZA 2HEJA 4AD4A 4PBGA 5FD0A 2C91A 4L4OA 4PRRA 1Z89A 5IDZA 1ZS2A 2WCGA 5FAJA 3NAVA 4PEEA 3WH6A 1T41A 3SCSA 1RBAA 5HK4A 1XF0A 1Q8JA 3TTSA 3PWIA 2OYLA 3EWDA 2PMQA 3GNPA 2ACSA 2YW4A 1XRSA 2NLIA 3R0KA 3G8RA 1A0EA 2EG8A 3GFYA 2FVLA 1QUMA 1UH2A 3P93A 3GC4A 4PULA 1UD8A 4B4FA 2VWSA 1W1A1 3KBVA 2TRSA 3FLUA 3T8QA 1EUNA 2FTPA 2NSOA 1PSCA 5E93A 4MLRA 4RXGA 1UH4A 1TZ7A 3GNOA 2A4AA 4GG9A 4W84A 5BYWA 1OF6A 4NASA 4UIOA 3VM7A 1XYZA 5K4XA 5F4XA 4LOCA 1W5QA 3PPHA 5I3KA 1IEXA 4RZ4A 4QFUA 2YCIX 4NJGA 4GIYA 5J8LA 1SR9A 1XPYA 4L61A 2I17A 1BGGA 3C3NA 4MFEA 1W56A 3N4EA 1PE1A 4OU1A 4D9PA 3CIWA 2FGLA 2OKOA 2E0PA 3LHWA 4FP1A 2GOKA 2X1UA 3S5ZA 2DPEA 4V27A 2PD5A 4UFMA 3ZLFA 4XBSA 2WWDA 4O12A 1K6AA 4IHCA 3FEQA 2ZWYA 4KEMA 4HZMA 4G9PA 4GY1A 3IV3A 1O5RA 2J7BA 3NPUA 3IUDA 1VP5A 2YCKX 3A12A 2XFFA 4CQ8A 5D2VA 3NQBA 3NFUA 2IQTA 2QUTA 1OZMA 4ZFCA 1V4YA 3GUWA 3KTCA 1ZAJA 3QFWA 1W9XA 5DMNA 4RDVA 4J3XA 5F2GA 1QHOA 5AC5A 3T6CA 1L6YA 1G9HA 5LNRA 5AHMA 1OHLA 2OLSA 3MUIA 2XIOA 1CGYA 1VHCA 3QV8A 3ARZA 2XM1A 1DJQA 4JTLA 3ONBA 1ONEA 4OTKA 4OUIA 1KM1A 3DHPA 4KBXA 1G67A 2ZTJA 1XBVA 2TODA 1X1NA 5H8PA 4FA3A 3TN5A 3WQ4A 2WSYA 2QUUA 3DFSA 2FGZA 3GVRA 1UJQA 3TC7A 3TKFA 1X1OA 1S2CA 4ZBCA 5DBUA 3OBEA 4D6CA 1XLCA 3P61A 4I6KA 2QJMA 3F4VA 2E6AA 3PBMA 2VFFA 1QBAA 2DDXA 4C6PA 4CU7A 3V7PA 2W63A 4OECA 1M01A 3ANUA 5IHSA 2QCLA 1CWYA 2PDBA 1JXKA 4IISA 3R10A 4V1XA 3MMWA 3CL7A 4LS1A 5JBEA 4LF1A 4GY7A 3BAYA 3STGA 5LNUA 4AC7C 2YBVA 3T8LA 1E6ZA 1HIZA 3B8WA 1P5BA 2OT1A 1XV8A 3H2FA 4Y9NA 2QPSA 3TXZA 2JQXA 1OQFA 3L68A 2GSEA 3UGVA 4AF0A 3VDBA 4ZOCA 4LVAA 1R9XA 4O8RA 3O63A 2W67A 2YCEA 1UKTA 3E2QA 1RCQA 2UBPC 3NQ6A 3KFTA 4RW5A 1P0EA 2BDQA 5HWMA 4B15A 2H9AA 1X38A 3M0JA 3R79A 1UP3A 4WDWA 1ECQA 3CTTA 1W1YA 3S9YA 1WKYA 1B1YA 1EKOA 1LLWA 4RPQA 5D2YA 1KBIA 1HN1A 1NWSA 3RO8A 2OJPA 3MW7A 3LHTA 2CC0A 4FR1A 3W7EA 2YCJA 4DUVA 2IW0A 1K70A 4Q4OA 3UXLA 1FH9A 5A6KA 1DVJA 3S47A 4P61A 3VD7A 2HRWA 1B3VA 4GCXA 2V6AA 1N2VA 5AC6A 4A2RA 4N9BA 1E3XA 4ES4A 2RGLA 5D32A 3IS4A 4H9YA 3U2OA 4Y7EA 1NOFA 4FOKA 4Z0SA 2PDHA 5M17A 1ZBCA 4WDXA 4NRSA 3SJNA 1J79A 1DWIM 3LTYA 2DU2A 2H8ZA 1F4AA 1XRTA 4DNMA 2C14A 3FHAA 3QHOA 1ITCA 3PFRA 3OA3A 1DWHM 4OOUA 1UD3A 3VNYA 4IMDA 4J1OA 4JHZA 3KCJA 3IJLA 4XBJA 1YTKA 5G4EA 3C8NA 3AIVA 1CYGA 1UZHA 4GOAA 3UJ2A 2NQHA 4QEEA 1F3WA 1TIMA 3BCJA 1OFRA 3BW4A 3NPXA 3BCDA 2RHGA 1Z41A 3AWOA 3WLNA 3GM8A 2GQAA 4O53A 1ITQA 2NUWA 3GBDA 2TAAA 5E1QA 2D20A 3GXPA 4KIEA 4HHPA 1K6WA 2XGBA 4EAYA 1IR1A 1UD2A 3RNDA 1FWHC 1PV8A 1TRIA 8XIAA 4CNUA 1EJSC 4TX6A 1JDCA 1YE4A 4DBSA 1OZQA 4F79A 2VDIA 3L0KA 3BQ5A 5CBBA 3QHMA 3KBMA 4PE8A 1GJPA 5T9BG 4QHRA 5CGTA 4AEFA 3PHAA 1BXNA 4XO7A 4AISA 2VR4A 2NQ9A 3WMCA 4HOZA 3AHXA 2GGHA 3KTSA 5LIWX 1SPQA 1V6XA 4JTEA 4X9SA 1FX6A 3PB0A 3EYPA 4M24A 2EAWA 4C1LA 5CSSA 1NDVA 4CLMA 3G1XA 3O6YX 4LY4A 2A85A 3P74A 1OIMA 2G3IA 1JZ8A 1P1XA 4GI9A 1UUMA 2Y5EA 3WUEA 4NUWA 2J4GA 4X2PA 2BLEA 4K7YA 2V0TA 3MA8A 4O52A 1FUYA 2D0HA 1JCJA 3KRSA 3LQLA 3SN0A 1DJXA 3TK7A 1MSSA 5J04A 4HYVA 4TQTA 6XIMA 4J7RA 2QCGA 1XRFA 1JYWA 1K8YA 3LA4A 4ZQCA 3DC8A 3GDRA 1E1CB 3PZNA 4ZTYA 4DZ5A 1JAEA 2E5DA 4B92A 3S5NA 1V6UA 1B3WA 1DIEA 1EUAA 2JKEA 5U4NA 2C16A 5HUOA 5TNVA 4GKLA 5H6HA 1XLEA 1W9UA 4R5EA 5LNSA 4AZCB 1KRMA 2XH4A 4HHMA 4FI4A 2DVUA 3WNOA 1FH7A 2CLKA 5HQMA 2INFA 1MUMA 1OC7A 1IXQA 4F0KA 3I7QA 4O10A 1NH6A 2I1OA 3EWWA 4JR5A 4O1CA 4QCEA 2PTXA 2YZRA 3TZNA 1P48A 3R94A 4HZ8A 4Y90A 1ZUAX 2GDVA 3RRXA 1PYFA 3SBFA 4H6EA 1WBJA 2GK1A 3B8SA 3RGTA 4C7FA 2VX7A 1XLKA 1H11A 3GNRA 1TPUA 4HJFA 2HS6A 4U2ZA 5HANA 3BOLA 3KLLA 2W66A 1XCFA 1OWQA 4PTDA 4M6PA 3CQHA 2XIMA 4CD7A 2CZ5A 2PDWA 3UESA 1HKIA 3WK3A 5HR6A 3EWXA 4HGXA 3ARSA 4GVGA 1OBAA 1UKPA 2W3ZA 1LUCB 2PDLA 5I3HA 3WJZA 3AHVA 3IIOA 4JAWA 1EWDA 4WY0F 4IPLA 4CGTA 5DRCA 4DY1A 1TVPA 1CT5A 5LNVA 2QEZA 3PNUA 5DFAA 1W5PA 3OQEA 1W1ZA 5EBUA 1MXGA 4R88A 5I02A 4Y96A 3ZLGA 4XZBA 3GIYA 1Q6QA 1M03A 1QI0A 1CGUA 3T78A 4RR4A 3BURA 5EU9A 3VPLA 3HPFA 1S38A 3EOLA 5AKQA 3CUHA 4S3EA 5EFDA 5D2XA 1WYIA 4BHYA 4PZVA 1UZ4A 3F4DA 3GTHA 2I5QA 3HTWA 5IM51 3CPGA 4GC4A 1XDLA 2C79A 3LRKA 3S2CA 4J3ZA 4CQ9A 3I6TA 3WJWA 3BW2A 3OIHA 3VGDA 2VP8A 3TQ0A 1YXYA 3WK1A 3AQUA 1HTIA 3QC0A 3T07A 4F40A 3I3EA 3AZSA 1DJGA 3VKBA 4JKLA 2GQ8A 4W89A 3PN8A 5DY3A 3ONCA 4F0LA 4P7NA 3GU2A 1TJ1A 1V3KA 1JQVA 1OCBA 3CPRA 3FGCB 4MUZA 3O8AA 4IP7A 1OFBA 1YW1A 4RLIA 4A2SA 4M6UA 3E96A 3SQMA 1S3TC 4URIA 2HTMA 3NVTA 3GG1A 1ZZMA 1H4PA 1WB0A 3WD1A 1MEWA 1FBAA 3GY1A 3STFA 1BVNP 2RDXA 3ZXWA 2DT2A 3W6YA 2GUYA 1LOSA 3M0LA 3RU6A 4EPEC 4PMQA 1YBQA 4KKXA 1H2JA 4H9TA 1IEQA 3PAJA 3N17A 3P67A 1FKWA 4ATWA 5BRPA 4EP8C 1UWQA 1MZRA 2ZX5A 1J2BA 1FA2A 1TCDA 3HOJA 3ARVA 1JZ4A 3DFQA 5A6AA 2FDMA 4GZ7A 3P81A 3T05A 1JZ5A 3DYOA 3UWZA 3CWNA 3PUEA 4EVZA 4YXGA 1ZBKA 3SUVA 4JICA 4ZGYA 4O1AA 3R12A 3FXYA 2WJZA 3VGEA 3R25A 2QMKA 3UZXA 2QJJA 1F74A 4UFKA 2VOMA 5A94A 1UQYA 3QF0A 5C9ZA 4UBPC 3WBWA 2DZPA 3ITXA 1G4EA 3GO2A 4N42A 3MTWA 3ZJ6A 1GVIA 1A47A 3DFTA 1PDYA 1D3GA 2VZTA 1K8XA 2XINA 3LNPA 2O4MA 3DOPA 1XLDA 2CXGA 4HPHA 1H1ZA 1L6WA 5F2MA 4WY0A 2VR2A 1VFLA 2E3ZA 2HJPA 4O1EA 3DHDA 1A4MA 3TYDA 1TIWA 1J0IA 1UKQA 4Y8FA 1RD5A 2XYLA 3ITLA 3U9IA 2F2KA 3UR5A 1IEIA 2GUBA 4FMVA 4AZBA 5IBXC 4BF9A 2W4XA 2O0TA 3CAWA 1SR0A 1TRDA 2AGKA 2QR6A 1MQQA 1UP0A 3B8IA 3EOOA 2FDSA 1KGUA 3VYLA 2HNEA 1SFSA 3FKKA 4LSBA 4RE0A 3ES8A 3A13A 1QO5A 3VKCA 4C60A 2YL8A 3B9AA 3AXIA 5E0FA 3QPYA 4LS2A 5E0KA 1VFFA 4KWSA 4CQAA 3TCEA 3MJMA 4DUXA 3N4FA 2GL5A 2E25A 4H7VA 4JQ3A 3N12A 4LUSA 3R0UA 2J79A 4YNGA 1JPDX 2V2HA 3RMJA 1E51A 3T40A 5AZ0A 1AW1A 4A3UA 3FJ6A 3JW7A 3HV8A 2IXVA 4FLOA 4G7EA 5CPOA 1ISXA 3N6QA 3POHA 3HQNA 1UKOA 2X30A 1RLDA 1JCMP 3MDUA 4XIAA 3RM9A 1IQ8A 3IRSA 1W3TA 3WMSA 5BWAA 4UXDA 5XIMA 4NHVA 4JTUA 2VTFA 2GVLA 3QKEA 3LSBA 1HUVA 1XGZA 1R2RA 3TYBA 2XH2A 3EXRA 4IMCA 2NUXA 4N9CA 3GBEA 1A50A 3A3WA 1D9EA 2VZUA 4P5UA 1LWIA 1QW8A 2JF7A 2J6XA 3KOFA 3ISIX 1CXIA 4MJ2A 1T6MA 2WVSA 3FW6A 2VUYA 3ZSSA 1S5VA 2R8WA 2XG9A 1MW2A 2BVTA 4AZCA 1B30A 3E9AA 3K4AA 5U7SA 1C7SA 3C0JA 4DZAA 3N2XA 4GGBA 4L80A 1HNYA 1WXYA 2Q8ZA 3SSZA 4GVIA 1EO7A 5JVLA 1IIHA 3MHUA 3BICA 2P50A 1IT7A 4XZMX 3P3BA 5FKYA 1K03A 3PJWA 2X40A 4FOJA 1DWGM 2FZNA 3UG5A 4REQB 3LXAA 1H51A 4BQ3A 1JD7A 2V38A 2W61A 1T0OA 4MOZA 3CNYA 3N6HA 4E4PA 3S8HA 3TJ4A 1PHWA 3TAOA 1NDYA 1J93A 1C3FA 4ZENA 2X8RA 3DFYA 3OBAA 4MADA 4Y9AA 2PDKA 3VIKA 1U83A 6REQA 3OB8A 3UCDA 2Z7GA 3DEQA 1O7AA 3ECQA 4X9YA 1SFTA 3EOSA 4D71A 2FTYA 3N2MA 3W27A 5LGXA 2ZE3A 1Z8AA 2Y62A 1DQUA 2CZFA 3ZJ7A 2WBKA 2UV8G 4W86A 1Y5WA 2GVEA 2PODA 3SIMA 5A2AA 4JY8A 1JPIA 4O18A 2YB1A 1Q6GA 1E71M 1QO2A 1EQPA 1QNVA 4NNAA 1B9ZA 1OY0A 4FK9A 5FJTA 3RCMA 1EXPA 3WQVA 4J5NA 3NDZA 3CHFA 4GISA 2V8ZA 4MTVA 2PU1A 3UXDA 4DO5A 2EG6A 1X6UA 2XFYA 4RV8A 1JYNA 1W8SA 4GXWA 1WOAA 1Q3NA 4WLCA 2VYOA 3PF3A 4XSMA 2BMBA 2HWGA 5CZKA 1F8MA 1M5WA 4NZ5A 2ANUA 4WJXA 4LV4A 1RUSA 5LSMA 2PSNA 3RU8X 3C52A 3VOJA 1C92A 1JGIA 4I7VA 3I10A 1F3TA 1NAL1 4IGNA 1V3HA 3VGHA 1S2WA 2XWDA 3UR2A 1QPQA 4IFOA 1A5OC 1UA3A 2VRJA 3NA8A 4EANA 4NYYA 3E6EA 4ATLA 4ZQPA 4F66A 4UCFA 5D38A 4ICNA 3WQEA 3IIXA 2D22A 3L2IA 1KQYA 2AQWA 1TWZA 4QDMA 3VNZA 2Y89A 3WLTA 4PMDA 1ADDA 2VX6A 4HMEA 4H2CA 4CCDA 2V67A 3ZVHB 4UQEA 5FEWA 2SFPA 1IGWA 3EEZA 1FWSA 3PZOA 3DN5A 2WM0A 2INEA 1TTIA 1B0IA 3PG9A 3I3BA 3UF9A 4QR6A 2Y7DA 1TQJA 2RDTA 3WNLA 3N9SA 2XIIA 4S1FA 3GC5A 4JFSA 3NNTA 1UA7A 3BPWA 4MJMA 4E8CA 3QOMA 1TJ0A 3L0NA 4MY8A 4W9TA 1ICQA 1Y7VA 1XPGA 4W8BA 4NJIA 3WUBA 2J78A 1OX4A 4RZBA 3T44A 1DPMA 3RLUA 1AL8A 3TWAA 2NQ5A 3WSUA 2PBOA 1HT6A 4PMYA 4XG1A 3L4YA 2H3DA 4WD0A 3K46A 1LQ0A 1KTBA 5A6MA 2HVMA 4AFYA 5JUVA 2BODX 1PKLA 2I5GA 2PDCA 3CAVA 3EZ4A 4TOQA 3M43A 2OFJA 4RNIA 4KEVA 4IICA 2X1RA 1ISWA 4XKYA 4C6JA 2QJGA 1LG1A 5LYRA 3M7WA 3W9ZA 1TUFA 3E5BA 1YPIA 3GAKA 3STCA 1QPOA 3AI0A 2NQZA 1RP9A 1GKRA 1CX9A 1EWEA 1HGYA 4RNJA 1TREA 2G3JA 2NWSA 1K9FA 5D8WA 2GQ3A 2HQAA 1H7XA 4DX3A 1HKJA 3CZJA 4L56A 1VZWA 3AICA 4PTXA 3M5ZA 4Q4RA 5LIYX 1H1NA 4PC8A 3CGTA 3RN6A 4DZHA 3TWBA 4S23A 1EDGA 2WMKA 2XH0A 3QW3A 1GVQA 1FHVA 2Y5JA 3SFKA 3HB9A 3OIXA 2DEPA 1AD1A 4A3HA 3C2VA 4DXVA 2P3ZA 2UY2A 3BWWA 2OXNA 1BYAA 1CTNA 2YOCA 4QLLA 4MKVA 2JKPA 4XD6A 1BSIA 3FDGA 4UFHA 4WJEA 1VR6A 3Q45A 4OVXA 3S6OA 1MQPA 3W2MA 4NZFA 2EEXA 2JBMA 4AD1A 2FH8A 4MSSA 4NI3A 7ODCA 1Q7MA 3WDPP 2FLIA 3MV11 1TJ2A 1OFEA 3QQ0A 1V79A 1CB2A 3LX9A 3QR1A 2D73A 1TFVA 4IIFA 4LAMA 1XR2A 4AWTA 1NF0A 1K9TA 3V5OA 2B31A 2BXYA 3VILA 3BAIA 3L4TA 3VNJA 3TTQA 4FALA 3NQDA 1E5NA 1YX1A 2Y7GA 3W07A 2ZUTA 3CC1A 1DQWA 2IKHA 1PIFA 1AA1B 3RCYA 2G96A 2QDHA 4LVBA 2VUNA 1PUDA 4QE4A 1Z6KA 5K4ZA 1QDSA 2GJPA 1ITXA 1RQEA 2E67A 1R3RA 4W4QA 1JPKA 1KXQA 3FGCA 3UJSA 1EC9A 4AIEA 3GR4A 1A5UA 1MFVA 4GUIA 3PFMA 3A21A 2XJ7A 3ZYZA 4R7OA 2TYSA 7PTDA 4WDTA 4H6KA 1VJZA 3K4WA 1M1BA 3LCHA 1GZ1A 1EZ2A 1VAHA 1S5TA 4YL2A 2YLLA 2VFEA 1DJIA 4FX8A 4HCDA 1A5CA 2OO0A 4AEEA 3WF3A 3FXGA 1ZAHA 1PIGA 3IUIA 4I9TA 2CYGA 3GTIA 3VFLA 3BAXA 4YVVA 4IWWA 3SUUA 4S3AA 3OHMB 5AYZA 1XINA 1I8JA 1WUEA 4A05A 3VIOA 4TX8A 1ZPTA 5LIXX 5F2IA 5C9RA 3ZLHA 4K38A 1MVYA 2VC6A 5F7UA 5JQ9A 2YA0A 4POCA 3NZRA 1E0XA 3WD0A 1VBRA 1PIIA 3WENA 4AZ5A 1CEOA 5CPSA 4C6NA 1IWPA 1CW2A 3FN9A 2DIJA 1YQ2A 1XYBA 2O9TA 3KP1A 4L65A 1GG0A 4O54A 1GQJA 3H4GA 3K4DA 3VABA 1R47A 3M44A 4RK8A 5FJRA 4CEXC 1ZNNA 3GRIA 2ZXAA 4UQ9A 2VELA 1QHZA 2OG9A 4NAEA 2HK1A 2IQDA 2ZZ3A 1WDSA 2CEQA 5CCZA 3URBA 4EAMA 4O0KA 3R8RA 4ZE5A 3RPDA 3N04A 4FAMA 3H2AA 4P2VA 3ARXA 1WNOA 3AYRA 3QW4B 4ZVJA 4C6BA 1KLZA 3WMLA 4HOXA 5C70A 1DIDA 1EB3A 3H70A 3PZVA 3C56A 4MNMA 4UCGA 1E9ZB 3KHDA 1W3KA 2J75A 2P1FA 4KRUA 5IFTA 2XGIA 3G24A 5LA1A 2A1YA 3GR7A 3TYUA 3PSWA 5E0CA 1DIKA 4C6CA 1VCFA 2G3NA 4N9EA 1EO5A 2F8QA 1H7WA 2BGSA 4F0MA 2YGYA 2GUUA 3W1RA 2V69A 4XTIA 3GDLA 1LQ2A 1VKFA 1XHGA 5EA9A 2BWGA 2DZAA 1UCWA 2GJLA 3TC3A 4RPPA 2WNQA 2CHRA 3N25A 3W53A 5KITA 4A35A 3OG2A 5C2GA 4DEFA 1MWOA 1XGEA 5GJMA 3LXBA 3KOWA 3W1TA 5T91A 3KUMA 4US5A 1YPXA 1VCVA 4PMJA 2YJQA 5HPCA 3O16A 2PUZA 2VL4A 2CNCA 5HNNA 1EOMA 1FCUA 3ABZA 4M56A 3A3XA 3MB9A 4EXBA 3B9EA 1U22A 6CGTA 4UQAA 3NG3A 4XZIA 2C18A 2GWGA 4QP0A 4UFLA 4ACZB 1QPRA 3NSNA 2GOUA 4NP7A 3NYDA 3GD6A 2QGHA 3GIPA 3DG6A 2QCNA 1XFBA 2W62A 3M0IA 3SCVA 2VD9A 1GOMA 5G4WA 1XCXA 3E0VA 1Z69A 4J27A 4C6OA 1ZJAA 1E55A 1UP2A 2XFRA 1WQ5A 4W87A 1R7OA 1C29A 3N9KA 3CO8A 2WMJA 3M4HA 3MHFA 4C6QA 5I3GA 1E6QM 1HJWA 1B57A 3VOIA 3KBNA 3QV9A 4JIQA 1U30A 4NJHA 2WSRA 1NOWA 1C8XA 2X2GA 5JIPA 7REQB 4RDZA 3D3FA 2DT0A 4AWEA 1SJDA 3M16A 3IGHX 4MGGA 3UPMA 1X6LA 3SW6A 3MCNA 1PZ1A 3TP4A 1V0LA 2VXNA 4GHRA 2CBIA 3XIMA 1NM9A 2X7VA 1IGSA 3T0DA 4IP4A 4XIMA 4JTDA 2JK2A 1SO6A 4F8XA 5B7ZA 2DQWA 1TSIA 4GH3A 3H7VA 3MYPA 4J35A 1H3GA 4MVAA 1GQLA 3WF0A 2DSKA 4B3KA 2E40A 1VFHA 2ZDSA 4GRSA 4HK5A 4YN5A 4PL1A 5FA5A 2BSLA 3CV2A 2RAGA 4IOTA 3TW6A 4L7ZA 4IXXA 1WKFA 3E0LA 1XLLA 1E9IA 4KERA 1O5KA 4LNCA 2OZ0A 5D02A 4BS0A 2BBFA 3GTFA 4WIWA 1E1FA 1JUKA 3LPOA 4FEZA 4UNLA 3MPGA 1GOQA 4WR3A 4YYFA 5GPRA 2Z27A 5CH9A 3W7HA 3SADA 3KVJA 1ML1A 1GYNA 2VURA 3EKLA 3LXCA 1G94A 1ZLPA 4YLWA 2J7EA 1OB0A 1JQXA 1W9BM 3OGRA 1KFWA 1XSKA 1VH7A 4V1YA 3LM3A 5FJUA 2J66A 3SRKA 1A5MC 1KCZA 4PB4A 4S3DA 2PWUA 4LB4A 4QG9A 5KETA 4PEKA 2PGEA 2DSUA 3VIMA 1ISZA 4IJRA 3JR2A 4ZB2A 1LJYA 3AUJA 4PCPA 1XQKA 2X7WA 4AVFA 3LEPA 4LPCA 4H01A 2Z2AA 1LORA 3WH9A 5LHFA 2ZX7A 1QI4A 2OGYA 3R89A 2E6DA 1I1WA 1O95A 3WEMA 4S38A 1M41A 1RBOB 4R53A 5C7VA 3IJ7A 1CZ1A 2JIWA 2WNWA 3NL5A 2LLEA 4L9YA 2NV1A 2VZVA 2CZDA 4M82A 3SCWA 5C8BB 4OBRA 4P7QA 1Y5XA 3V35A 5EMLA 4JNMA 2Y1HA 4M8UA 3RG6A 4A8IA 1JAKA 3UETA 1LBFA 5HJYA 1FXQA 1YTDA 3CUZA 1KC7A 3V0TA 3C6CA 2WVVB 1GHSA 3OGSA 3OTRA 1XLGA 4KT2A 1POJA 4Z2IA 4WXZA 1OX6A 3WLRA 2H6RA 1KM3A 1EX5A 4FXJA 4LY8A 3SCUA 2PDIA 1JCTA 1FKXA 3P84A 2OZ3A 2PC4A 4JDYA 1E1EA 4QRNA 3G18A 1DWJM 4HN8A 3WQWA 4KETA 1FFQA 3RR1A 2EXOA 3KBSA 3T42A 2OX4A 1TV3A 2W27A 1L8NA 2E28A 3K5XA 1EF2A 1J01A 2J9XA 3MUXA 3MVTA 1GW9A 3NR0A 4XK2A 3S2LA 3BMVA 2EPLX 1PS9A 4MB5A 1SZRA 1BYCA 4IUOA 3BARA 3CPUA 5ABTA 1QOQA 1Q85A 3OU8A 3PG8A 3GXIA 4MZ1A 3TTYA 2WNNA 4YVPA 3VMNA 1YNPA 1S2VA 3CIXA 1IWBA 3W7OA 4XD4A 3W23A 3WLPA 3P0XA 1BXBA 2Z1XA 3HG4A 4FLQA 1ISVA 1XBYA 3T7VA 3ZR5A 4S3KA 3SUSA 1W6TA 3F4CA 3SB0A 1HXJA 4X2RA 4MAVA 1GVRA 4WX2A 2E8ZA 5CPMA 2P88A 1W8GA 4RCXA 4LYQA 4DF1A 4PCSA 2ZXDA 3MBFA 1H62A 3G3MA 2GQ9A 3O06A 1K7EA 4G2DA 3QV6A 2QYGA 3RJYA 1KW1A 2FTWA 1J6PA 3IIPA 4CVWA 1N7KA 4UQCA 4O17A 4EPKA 2VC7A 3AZTA 3OZOA 3KTXA 1O4UA 2J8GA 1C9WA 3WL1A 2PDYA 4B90A 5FEPA 3ZR4A 1H1YA 3UPWA 3B9DA 3KEHA 3W82A 2AL2B 3VUSA 3B05A 3LENA 1RJPA 4QCFA 3PUGA 4IIDA 5CXPA 1QU4A 4HNNA 5FF4A 4LVDA 5AYBA 4G1NA 4Q6XA 3Q67A 3R2GA 4LTSA 4U2YA 2PCEA 2KAUC 3IJ6A 4LEQA 1ESWA 4YS1A 3Q65A 1LCOA 4MM1A 1SO3A 2WKLA 2OU4A 3LPPA 1SYTA 8TIMA 1MXSA 4GACA 3CHCA 3DG7A 3M0MA 3UGRA 2VCAA 3AROA 4MJZA 4DM2A 3FVDA 4Z1BA 3SCOA 3AS1A 4XUYA 3VZXA 1DJZA 3L9CA 5AHNA 4JYDA 4B5VA 5CBIA 1I2QA 3H26A 1UOZA 3M0KA 4DO7A 2E7FA 3COTA 3UZZA 2QIIA 4I9MA 5HPOA 3FX4A 3F4NA 3CT7A 3EMZA 4H8NA 2ACQA 2ZQ0A 3FAWA 3BV4A 3QQWA 1TE1A 2HXTA 1NTHA 3PZQA 1PTDA 3H2NA 1FWEC 1C93A 4O57A 3SGUA 4ZOBA 3HMJG 3IJ9A 5GNXA 4JTTA 1FDZA 1QW7A 4O15A 2AAAA 2HE5A 1B3XA 3B4YA 3S9IA 4XKMA 3QYQA 2V5KA 2ZICA 4Z17A 1FOBA 1W5MA 3SIZA 3AUOA 3N13A 4B9YA 4HU0A 2V30A 3W1XA 4X0NA 4BFAA 4GUFA 1IE7C 3RR4A 1FFRA 1A53A 4H6QA 2GSHA 1HP4A 5FACA 3IANA 1TPB1 4JL2A 4HCHA 3GDKA 4YYCA 4JTIA 3N34A 3UPBA 4QSHA 1A5BA 4WVXA 4K8HA 4IMFA 4DAFA 4ZE4A 5JU6A 3GZAA 3PR2A 4IG2A 2IKJA 2VDHA 3AOFA 4H7CA 1OG0A 1US0A 4C90A 1OT2A 4OBSA 3M6YA 1KKRA 1UR3M 1V02E 1R87A 4IZGA 3VNKA 2VVNA 1EF3A 1WOBA 3G5EA 4FOUA 2GWNA 1AH4A 2DH3A 4KWUA 3CEUA 1ENUA 2HDJA 2AMGA 3OQ8A 2C15A 4DPPA 3P60A 3HQ1A 1V03A 4XKYB 1GQIA 3ZIZA 1REQB 5H2ZA 4BKNA 2NWRA 1LRTA 3M46A 1F73A 1XIJA 3AYTA 2QUVA 4MUPA 3TA9A 1M3UA 4DZIA 1PX3A 3SR7A 3N2BA 4WZHA 4ORIA 4NL1A 3H2MA 3BQ6A 5BXRA 2OSYA 3H53A 3W74A 3L21A 4CN4A 1TKKA 1C91A 1MUCA 1FVPA 1NY1A 3TIMA 4O0ZA 4A8NA 1WV2A 1PWMA 2ZVRA 3VFCA 1FWTA 2QT3A 1QCWA 3OGVA 4LT9A 4YCPA 4WK9A 1GQNA 2VNCA 4ALDA 2R94A 1EA0A 4QNWA 3MSYA 1V6YA 3AIQA 1IZJA 4Q8WA 3CB3A 1CGXA 3PTMA 3UCQA 4X63A 2KZHA 2QW5A 1SZGA 3FHQA 4MKNA 2DSWA 4C6KA 3GNDA 1J12A 2PB1A 5C9UA 2VC9A 3E2RA 1OGSA 1KBKA 3M0HA 4G8TA 2IPWA 3A4AA 3GWQA 4AMCA 1YRRA 5FF2A 1S5MA 2C71A 2PLMA 3NL2A 4JTQA 1L8PA 1O1ZA 2HZGA 4PMVA 1KXHA 4AQLA 4KEUA 3C0SA 1PYMA 2ZFAA 1XJBA 1P0DA 1TV4A 1F2JA 2GJNA 2QV5A 5A5WA 1R3WA 3C2RA 2WCSA 8CGTA 3IIZA 2ODOA 4ASTA 2R6OA 5AOUA 1IF2A 1YE6A 2IPFA 5EKYA 1UWIA 1C90A 4QBXA 3UZYA 4F2TA 1TZZA 1RQHA 3W73A 4DJDA 4UOJA 2I57A 4KIRA 4M19A 2D2GA 4WGHA 1NFPA 4LB3A 7REQA 3MC5A 4QISA 2BVYA 3QY7A 1SO4A 3VI2A 2A7PA 1I75A 4D2JA 3F7JA 4ZZ9A 3W75A 3H21A 2WZEA 1TX2A 1KQZA 1OFOA 1JI1A 4B2DD 3WK2A 3HA1A 3WQOA 3RCNA 3NXLA 2WMIB 3QSRA 1MMFA 4EX4A 4Q6JA 3ABXA 3E0WA 3N4AA 5LNWA 1KRBC 3VUPA 5FESA 1E4IA 1DBTA 3PB2A 1VFOA 2VEMA 4R9OA 1XSJA 4E8DA 3VE9A 3BDKA 5LA2A 3KL3A 2G4JA 1DXIA 4CD8A 1FHDA 1XQLA 2OTDA 3CLMA 2W79A 2G97A 3W7NA 2ZE0A 4Q4PA 3W7DA 2Z7KA 4XV0A 3QLDA 4AH7A 4ERGA 4Q8OA 1CB7B 2CETA 4D6JA 1I2RA 3K1GA 4UR9A 3U2CA 1M04A 4F0SA 4IPPA 3NO5A 4I9JA 4ZCWA 2HS8A 1GVFA 4M5PA 3C0QA 1JZ2A 4HN4A 1XM3A 1XD0A 2AOSA 3DI1A 1JDEA 3CV1A 1EEPA 3RLVA 1I45A 4JN8A 2D0FA 3GDTA 1XUZA 3HMCA 3AO0A 1KRAC 1UASA 1ZALA 1QNQA 2VD8A 1GTEA 3UD6A 5AHIA 1BYDA 1TR1A 3UXAA 3LLFA 1E9YB 1JCYA 3LCIA 9CGTA 1SFJA 4FXFA 1TG7A 1ZBVA 4EE9A 1WDPA 1Y65A 3N2CA 1H50A 1LTDA 3C2FA 4GVFA 1S1PA 1R3VA 1V6WA 1GKPA 4M7SA 2WJEA 4NT0A 2YA1A 4RZ6A 3W7CA 2J25A 2PDUA 2QCHA 1HGWA 5FCZA 4JOMA 4KCTA 2FZBA 3VIIA 3PTKA 4L1GA 3WQFA 1XH2A 3PBYA 5DXXA 3KLKA 4LW7A 2VWTA 5CQ1A 3LSCA 3SI9A 2G95A 4NQ1A 3FSUA 4KFOA 1LUCA 1XIGA 4I8YA 1GHRA 2C13A 1VLIA 3LB0A 4CNTA 2HPMA 1E4NA 3DXIA 1HVQA 3WUFA 4Z2KA 2G37A 3QY8A 3C86A 1QNOA 1YXCA 2XPKA 2ZOXA 3TC6A 4AHOA 1LLZA 3TXVA 3WLLA 4D6EA 3AIRA 4RXFA 4Q8MA 4IP5A 2WLZA 1DHKA 1JXJA 4MAZA 1JI2A 1ECEA 3ICJA 1E6NA 3RDKA 1WKDA 3GNXA 5L6UA 5LZLA 2BHYA 1THFD 2ISDA 3CUJA 3NDYA 3L4ZA 1PCWA 4LEFA 1G0CA 1P0BA 4GQQA 5GQBA 4UMAA 1OT1A 4O1FA 3R11A 3I4EA 1V0KA 2EJAA 2JEQA 3ARWA 5BU6A 3G1RA 3EXSA 3GVWA 4TX9A 4QQ3A 1NDWA 4IIGA 2W6RA 1ALDA 3GK0A 1QPNA 3WNPA 4HOWA 1H5YA 1AMKA 5BWFA 2FZDA 3ZVHA 3W72A 4J2PA 4UZUA 5AECA 2EHHA 3O7UA 1VHNA 1DOSA 1OK6A 1IZKA 3W1MA 3ERPA 1JUEA 2I7GA 4BK9A 2ACUA 3BLLA 5FJJA 3FV9A 5HINA 3CZLA 4PSRA 5BU9A 3USZA 3VDGA 4CD5A 1HKMA 2UY3A 3E1F1 1MFUA 3CZGA 4F0HA 4GYFA 2CBVA 1TPH1 1F3EA 2A3CA 5K9CA 7ENLA 4L4LA 4LYKA 4PODA 4WCJA 2IKIA 3QGAC 4DF2A 1US3A 2R1KA 1TWWA 2V5DA 5DT5A 1M68A 2Y8VA 3K30A 3B8DA 1SMAA 3HZ3A 4PA8A 1H49A 4HMNA 3EPMA 4K8GA 4ZB5A 1W9PA 1UROA 5M5DA 2I14A 4KMQA 4GJIA 1KBBA 2DT1A 4F4RA 1BWVA 5HJLA 3TLLA 3M64A 3SY5A 2BY2A 3TYCA 1XLBA 1PEZA 1DWAM 1PHQA 1DEDA 2Q3RA 2YDAA 4B91A 2PRLA 3W3OA 4AD2A 1XSIA 5BXPA 2IS7A 3VCCA 3T55A 2DT3A 3WLKX 2QKFA 2V5BA 1X39A 1Q8AA 4CVUA 3CUXA 4WRHA 3NCOA 2OMAA 2RJGA 3GW3A 5K9XA 1B2YA 3RXZA 4GE8A 3G0UA 3NQMA 1VYSX 3E5PA 6ENLA 3QEZA 4PRTA 3B8UA 3V1PA 1YKWA 3TOYA 2C0AA 3EOUA 4GUJA 4LYRA 5G2IA 4DAIA 4JHOA 4O11A 4IX0A 2FVKA 4E38A 2QCEA 5BOFA 1GVEA 4G5DA 1JULA 1PKMA 3ZZ1A 2ZX8A 3YPIA 3LLDA 1LL6A 3CHVA 4JYEA 4N6FA 1DL3A 3GHTA 3RUBL 3UZ5A 4RX0A 2EKCA 5JH2A 1CXEA 4WOZA 5CC7A 1HKWA 1TMHA 2J74A 4V28A 5EB8A 2QCDB 1WZLA 4ZOAA 1V77A 4FO4A 3BSGA 2G8ZA 1AK5A 3G1VA 5EMMA 1GK8A 5FEXA 3U2EA 1WA3A 4AZ6A 3L4XA 2ZZ2A 3TSMA 1JIBA 1K8ZA 2B7PA 4F9DA 3AIBA 4CUCA 2WHMA 4AY1A 4S3CA 4WSKA 1FWFC 4PMRA 1PCKA 1LOLA 5E5CA 3PJXA 3UG3A 1Z9AA 3C2OA 5CPTA 3GDMA 4HVXA 4Q4SA 1FP9A 1E73M 5PTDA 3KS5A 2DJLA 3D3AA 4CD4A 1N8WA 3N11A 4Z08A 1JEZA 4Q32A 3L2LA 1P7TB 3QVQA 5B7YA 1LOQA 3EAUA 3G77A 4H04A 1VS1A 3VTRA 2XVKA 3TMLA 4V15A 3EDFA 2V82A 4P8WA 3W26A 2QS8A 2CXEA 4FS9A 4BQ4A 4ECLA 3W38A 1ZJHA 2BASA 1EH9A 2OODA 4LBUA 3BAJA 4E2VA 5A8MA 2UZ9A 3THCA 1W1TA 3VKJA 4PTWA 4X60A 3CQIA 3ES7A 3FKRA 4I8DA 2Z1SA 1EJTC 1UZ1A 4PMOA 5IFPA 5AC8A 4H8UA 4RW3A 2VCBA 2RDWA 4JTSA 1EBHA 3OZPA 3PK7A 1C8QA 4L4PA 4N2YA 2ZA3A 5B80A 2WB5A 3FCPA 1U5JA 2REQA 1RCXB 1KNWA 2DV0A 3P8JA 5FJOA 5CZ0A 1GTHA 3VOHA 4L64A 4TR9A 3VGFA 3W28A 5TBOA 2VEIA 4OZOA 2WBGA 4AUBA 3BJFA 1FH8A 1QR7A 3GAYA 3AU2A 1T5AA 3EMCA 1M9HA 1QOPA 4GGHA 3LBOA 1UPMB 3WQDA 3WBYA 1DP0A 3UR7A 3GNNA 1VQTA 2WQDA 3B0VC 3ARTA 2PZ0A 4B4HA 4OGZA 3VNMA 3R13A 4LUTB 3ANYA 4LCRA 4JKKA 1G7VA 1D3CA 4UQDA 3AYSA 5GNZA 2YSWA 3W76A 4LC6A 1ONXA 4M80A 4H2HA 4UTUA 2ZXQA 2RFGA 3DZ1A 1HJUA 3LV5A 1UH3A 4UWMA 4AW7A 3RX3A 2PWVA 3HJEA 2NV9A 4O1BA 2XM2A 2INZA 5D9NA 2FFIA 3AU6A 2QNEA 4RKAA 5EGRA 2CLIA 2JGYA 2VR5A 4OT7A 5F1UA 2PD9A 4HSHA 4GWEA 5AHFA 1UWSA 2I9UA 2J62A 5DF0A 3GZ3A 3SUTA 1T8XA 3FIGA 2CHOA 5LKYA 3RM8A 3NJ3A 3WYZA 3H54A 3MWCA 2ZX9A 1F3XA 1UMYA 1E3ZA 3MDWA 2ATSA 1B54A 1L2QA 2NVCA 2V2CA 3KZSA 3MT1A 5FJIA 1PO9A 4B9ZA 3E49A 3SSJA 1VBGA 1KFEA 2HK0A 7CGTA 3VD5A 2ISFA 4GO8A 2CFFA 1BAGA 3VNIA 1NDZA 2DQXA 2OLAA 1I1XA 2X0SA 3LHVA 1CXLA 2TMDA 2YX0A 4AIOA 4YTRA 1CENA 3MSRA 2Y7EA 4EXQA 2Y8KA 3PWAA 1A3WA 1BD0A 3O07A 4IMGA 1EP3A 3HPAA 2D24A 3J7HA 2Z29A 1WE5A 4JN7A 1EZWA 5IOBA 4L6OA 5A2CA 1OYBA 2P5NA 4P7LA 4EOUA 2IXUA 2A7NA 3AYVA 3W6MA 1PX8A 4GXPA 2WK2A 1DHPA 1XKJA 5C54A 4HB7A 4XAFA 4N7QA 3AS0A 3VO0A 5E9XA 3D46A 2OEKA 1FDJA 2WC3A 1Q45A 1A5KC 2Z24A 2BNJA 2ZUNA 4JFVA 3KL5A 3EEGA 1I4NA 1SVDA 1F8IA 4H41A 4MNKA 5DN1A 4O19A 2BGNE 4AX7A 3CV6A 2Z1WA 3M5XA 3WQ6A 1B90A 1KR0A 4HYRA 3WH5A 2HXUA 1G4SA 1G4TA 3CZKA 1EJ7L 2DORA 1WAWA 3NM3A 3OW1A 1A49A 1TVNA 3U2ZA 1KRCC 1Q5MA 5TQLA 3V5FA 6A3HA 4ATDA 4F9JA 3CUFA 3GH5A 4PH6A 3LBMA 4JTKA 2CZEA 1N55A 1EYEA 3FSTA 3WJXA 4U28A 3QKZA 2OZ8A 4AYSA 4QG8A 4H83A 3BLKA 1J6OA 3I3DA 4PRWA 1EL3A 1XLJA 2VZOA 1HF6A 1VBJA 5AC7A 4M1RA 1YNYA 4I5RA 1EOKA 3LLXA 3POCA 5CLWA 1ADSA 3CASA 1BRLA 4HPNA 3BJSA 1XH1A 1OK4A 2ZUMA 3EPNA 2WHLA 2CLFA 4OOZA 1YIXA 1CDGA 3NSXA 1BKSA 3IJ8A 2WO5A 1FQ0A 5KMYA 4KF1A 4B3LA 3NZQA 4BEQA 1G4PA 3SN1A 3SY8A 1GJWA 3AMGA 2ZVIA 1BPLB 3NXFA 4W5ZA 3M47A 1KXVA 5K9DA 4UB9A 3WQPA 4JS3A 5JBFA 4H1ZA 4FIQA 3DCPA 3IVTA 3UWEA 1SSDA 1QT1A 1GVYA 1XYAA 4L6DA 3PVFA 3HU7A 2ZZ5A 3QZEA 3DYMA 4ZB0A 4UTTA 3W6LA 1T40A 3KRUA 3ZT6A 1ICSA 1J10A 1FWBC 4C1KA 4PFMA 3A47A 3W7GA 1XX1A 4OBTA 1XIDA 3LTPA 4FNUA 5CLTA 3T9PA 1XYCA 4ZMGA 3KAOA 5HAOA 5AHEA 2YLAA 4KCWA 3UJFA 4M7TA 5ABEA 4DWSA 1GGOA 4ADSA 3IRDA 1W54A 3EA3A 3L23A 2Z1KA 1VD6A 3UXKA 4GNVA 4TU1A 1SMDA 3SO7A 3TSBA 5A6LA 2WZTA 1DJNA 4Q22A 4NAFB 1MRQA 1U1UA 3MCOA 3R4IA 4Q4MA 1AODA 1A5SA 3UG4A 1FWNA 4CN1A 1QTWA 1IIGA 1OGBA 1FWAC 3W81A 2E5CA 1F5ZA 2FKPA 3WLIA 3FAXA 4G6CA 3CK5A 3L2MA 4FX6M 2ZRXA 3SGZA 2DSZA 2Y63A 2G50A 3LM7A 2ZDRA 3ABSA 4D6HA 1BVZA 4BEUA 4NVTA 5I09A 3QZAA 4W7VA 1GG1A 3OOQA 1Z7AA 5JIWA 1RV8A 3R58A 1WKEA 3OPSA 3T4CA 2R91A 4EWJA 2Q8XA 3ZOAA 5FOOA 2C1HA 3UWYA 1YDVA 1VENA 4LXFA 3ZR6A 2XVPA 4DXKA 3LHZA 4KCVA 1QXLA 1JNEA 5I2UA 2PA6A 4DELA 3OEXA 3BK0A 2F84A 3W85A 2QDEA 1HW6A 1XLIA 3S1XA 3SQSA 3W84A 2NT0A 2ALRA 1MI3A 2VO5A 2VFGA 3QMRA 4US5D 4JXCA 1ZAIA 2J88A 4XAZA 4YTSA 3CQJA 3RK8A 4NKCA 1BYBA 3WG6A 2YIHA 4K1WA 4YMZA 4MYXA 1ZP3A 4LH8A 3Q2DA 1V3IA 3P82A 2F38A 3WELA 4JFTA 2ZUVA 3UP8A 4G56A 3WD3A 3PZUA 5GVJA 3UERA 3UVIA 1JGMA 1A80A 5FF0A 1TWSA 5DRIA 1J96A 4O4WA 1MQRA 5RUBA 2BVWA 3BMXA 4ZFMA 3DAQA 1W1IE 3LCLA 5JBDA 1XWYA 3WLOA 1VB9A 4JZ5A 5K7JA 1RLCL 4UUIA 3NURA 5EMUA 1K1DA 1F7BA 2V3GA 3NGJA 3I7RA 5HWJA 1AZ2A 4NY2A 1IEWA 1UWAA 4LCSA 2A5HA 2BS9A 3T09A 3C2YA 3ITGA 2XSAA 3UR8A 1AL7A 4XB3A 3QR3A 2Y88A 1L6GA 3B03A 3SRHA 3CHDA 3K1DA 3N19B 7TIMA 1B4KA 4N9DA 3FA4A 4PR4A 1OX5A 1FHUA 4PBEA 4ICMA 4J4KA 4F3HA 2CBUA 3AISA 3KWSA 4LRTA 2PBGA 4KWWA 3WJSA 2VM8A 2QDGA 1ADOA 1SJAA 2Z6JA 5DEZA 5EYWA 2HMCA 3W87A 4LWWA 3VGGA 1KGWA 1P6BA 2GZXA 2O9OA 4DI9A 2ZYFA 5D37A 1WXJA 3MKVA 3QSTA 4H4IA 3URNA 4ZXLA 3AXMA 4HNUA 1KO0A 4FNTA 1IXNA 3AMCA 1ZENA 1H5VA 4WSHA 2ESCA 4X61A 2WAGA 1X98A 2QAPA 4H8VA 5FJPA 3E2VA 1FWJC 3CMFA 3BW3A 2NQJA 2VGGA 4CNSA 5G1MA 2GGGA 4Q4QA 3P62A 2YL5A 5A6BA 4LAZA 4OFCA 4NG3A 5DCDA 5G2HA 1E9LA 3WBAA 5I07A 2MANA 1ODZA 2UY5A 2XH7A 2GJRA 1RXOB 3B3DA 1Q66A 4LFYA 3TW9A 4BCEA 1OCQA 3CUGA 3WIJA 4XZWA 1UWUA 3IPWA 1XG3A 3EWZA 3ZMRA 4FNPA 2YL9A 3NL6A 2X0YA 5BOOA 1EP2A 4QDPA 4UR7A 2PLJA 4E3VA 1YLVA 4I5XA 1L6FA 2YXXA 4AF0B 2WM1A 5IXEA 4Q7NA 3SCNA 1V3MA 4QITA 2YXOA 4AX6A 4H7ZA 4IFKB 4JDBA 3UG8A 2BY0A 2VEPA 1I2PA 1J0JA 4XO6A 3ZSTA 1YDOA 1KM0A 4Z2LA 1QJWA 3R8HA 3WEOA 2CLOA 4K1GA 1NWUA 1UD5A 4IPJA 3GC2A 3CLWA 3VD3A 4H8HA 4DJED 4MWAA 2ZX6A 3V3WA 5EMJA 1AJZA 1TZ9A 2J6VA 1KFCA 1S5WA 3BAKA 3AS3A 1REQA 1EJVC 5CZTA 4OKDA 4UTKA 1YDNA 4LBRA 4XZ9A 1PWLA 3G3DA 3T4WA 3ATYA 3KW3A 2QAFA 3WQ5A 3W22A 4NJKA 5HMFA 2VVSA 3PZMA 2PTDA 2FPVA 4P8UA 3NQFA 3PP7A 3HIJA 4INFA 4K2SA 3W71A 4XVDA 1O5XA 2ZCGA 3WFZA 4H9VA 3EPOA 1H0IA 1KGXA 9RUBA 1PJ9A 4ADTA 3LMYA 4AWUA 3USBA 3F2DA 1OCJA 2XSBA 3LI0A 4DWDA 4MKSA 3KCLA 3LZ5A 2OQLA 3C0LA 3PANA 3KL0A 1BLIA 5E6YA 2RKXA 4NYUA 2C7FA 2GVJA 1R46A 3AMKA 5I24A 4P7RA 3BAWA 4J3SA 2DZUA 3A9BA 6ALDA 3WX7A 1UW9A 3M0VA 4HSOA 4Y9PA 3SQLA 2Z28A 3CV7A 4K36A 1TQXA 1U2YA 2CLHA 1W2PA 4DRSA 1W5OA 3TV8A 2PU0A 1GT8A 2F7FA 4JIIX 3CEPA 4HPGA 3ATZA 1KB3A 2XN0A 4IL0A 1GUVA 4IQEA 1Q2RA 5EFFA 2E77A 4K3ZA 4B5TA 1OADA 3L4UA 3WK0A 2B4GA 4ZQRA 2V5LA 1RY8A 3PY2A 3EWUA 4JQ2A 3APTA 2AKMA 2BY3A 3FYYA 2F61A 4HU3A 3MI2A 3RHGA 3C61A 3UVAA 3TLQA 3MMUA 5DCEA 3BSHA 3CT2A 4E6MA 3KX6A 2WANA 2C1IA 1E6RA 4ZA0A 2WSQA 5F4WA 5SWUA 1LBLA 1YBQB 4S3GA 3R43A 1BHGA 3W00A 2AKZA 5LXXA 2XDFA 1OM0A 1ME9A 3VC5A 1SJCA 2RGMA 3TCSA 2G4FA 2WXDM 3AFBA 1Q4WA 1RK6A 1V3JA 4O14A 1JYVA 1HJXA 1XKYA 1AZ1A 2J77A 3BZGA 4YU1A 3U5YA 2VFDA 1Y0EA 4D72A 1KFKA 5REQB 3EA2A 1CLXA 5C5YA 3I68A 4WXYA 1XUUA 2EPMX 2DZSA 4S39A 4NILA 4WSJA 3QJAA 5A8OA 3KE0A 3VIGA 1PX4A 2ABAA 3GXTA 1K9DA 1TWDA 4HMCA 2ZRWA 4QEHA 3W1AA 4C1NB 5KZ6A 4JYFA 2EPOA 3ABOA 4N02A 2DIKA 4JHMA 4M6QA 1TWIA 3R6IA 4LUIA 3AALA 2R1NA 4GA8A 2PGFA 4A8LA 3HG2A 3LERA 2BV9A 3E12A 3AJXA 3OODA 2OEMA 1YADA 1KM4A 3S83A 1MDLA 4L9XA 5DBTA 1F4HA 3WZ0E 5MKGB 4B2DA 2GPTA 2C1GA 2FMOA 1KR1A 1CGWA 1OFAA 2YYTA 1JCXA 2C3ZA 2VKZG 2A3BA 3PNZA 3RFAA 5FIPA 2E68A 5JXQA 1XYMA 3UA4A 2ALDA 3TROA 3LRMA 1HKKA 2J8FA 5FL1A 3VMOA 2UY4A 3PZTA 3S1GA 4GBDA 1R85A 1EC7A 2QUMA 5MHBA 1GPFA 2ZBTA 1KCXA 4LYPA 4RNHA 5AYIA 1LWJA 1OC5A 3PC0A 4AEOA 1LWHA 2CWNA 3UFYA 1XD1A 5G1TA 4JTAA 4QS6A 1Q6OA 5C6MA 4HSNA 1OEPA 4ZSUA 1P7TA 4HYWA 2NVAA 3WCZA 3P0WA 4DJFC 4I3GA 3OLEA 1S2AA 2EG7A 2WSKA 2PTYA 4GI4A 4IG2B 3ARQA 1A4LA 1DORA 2ZZ4A 1CPUA 4H9ZA 4TV5A 5HNUA 5BW6A 1I2NA 2NX1A 2D0GA 4LX4A 3MUCA 1TA3B 4MFDA 2UWFA 4LNYA 3N29A 4H9UA 4HMDA 2J7GA 1LROA 1KXTA 4HKPA 5T9CE 2Q09A 1ME7A 2AAMA 2QLYA 3S6DA 4XX6A 3RF9A 1OSEA 5A8GA 2ZRVA 1D8CA 1DE6A 1UR2A 3HQOA 4XZNX 5CPLA 3S4TA 2QUNA 5BXTA 1E1CA 1J0ZA 1P0NA 2YBTA 3DFNA 4K68A 3SUWA 3GLCA 1DV7A 2Z4GA 4AXKA 3A4XA 1W5NA 2L5HA 4HNLA 1M6JA 3HM7A 4PB5A 2RDUA 4P7OA 1NWTA 4GK8A 4J3TA 2VJXA 1L9WA 3EX6A 5HA7A 2A6LA 3DI0A 1UWRA 1E0WA 2J13A 4DJEC 3C3UA 4MG4A 1KM6A 2OT0A 1B9BA 4XSLA 3HG5A 3TW7A 3BUVA 2PF0A 3IIVA 1S39A 1KA9F 4LF2A 3GYCA 3NTYA 4MNJA 5HULA 2PP0A 2W92A 2WOQA 3PZ9A 4TTGA 2YXGA 3P2VA 3B4UA 3ZJKA 5A8PA 1LZOA 3OZMA 1XIMA 1EIXA 3W7LA 3RX4A 3RJXA 4C7GA 1IEVA 1OX4B 2VT0A 4MWAD 1U5VA 2QPXA 4MDPA 1S2TA 1BWKA 2H8XA 2OCZA 2J7DA 1UOKA 9XIAA 1GVSA 2IPGA 2BX7A 3ZFHA 2C8NA 1W1VA 4HHHA 3M6DA 5A69A 1XL9A 1QFEA 2VC5A 3EB4A 1Z3NA 2JGQA 2ZA2A 3VE7A 4ZEPA 3WNMA 1VPYA 2WVTA 3NIYA 1DIOA 1NQ6A 1TUXA 2X0HA 2C0HA 2J7FA 3MV01 4UFIA 5TF0A 4UOZA 1S3HA 2YA2A 4LVGA 1E72M 4AWSA 3ALGA 4L1XA 4Q7BA 1A0CA 2WZHA 1HQTA 1XC6A 4F48A 4RE4A 1Q2SA 4PUEA 3K13A 3UWWA 1WDRA 2OYMA 2I5IA 3TTEA 1GNXA 4IMEA 4PYSA 3LGEA 4A21A 1JDDA 1BWLA 4YPJA 2DZWA 3QM3A 1R8LA 1HP5A 1U33A 5A1AA 4PTMA 2XVNA 2C19A 4QAIA 3DECA 4R33A 4XISA 4KCUA 1VPXA 3QLLA 3OG3A 3WBXA 1JD9A 3V4BA 2DFAA 1GEQA 5CPNA 2GDQA 3MVIA 1XC4A 4YTTA 1CECA 5DCBA 1O68A 4M29A 2DZVA 2XTKA 3GKFA 1NP2A 1BXCA 5M1TA 3LDVA 2E8YA 4JEJA 4DXXA 3E2SA 4H3DA 5LGZA 5LHEA 3XISA 4GQ0A 2OSXA 3WN6A 3DYPA 1AFSA 3TNOA 3O0KA 1GW1A 5FI8A 1AQMA 2ONEA 1PKNA 1VF8A 2CITA 1TPEA 3GXMA 2OKTA 5A6SA 3JU2A 2O55A 1KV5A 3LI1A 3CWHA 1GZGA 3TE9A 4L6HA 3ZWTA 3W2LA 4EXAA 3MBDA 2PURA 1G69A 4KWVA 4NRRA 5HBFA 2J9YA 3G8EA 2ZRUA 3QXBA 3WUGA 3FYOA 4MB4A 4L1WA 2ZUWA 3IGUA 4A3YA 4HA0A 4M0XA 3QN3A 2AL1A 2H9AB 3NO3A 4NI8A 2ATMA 5CZJA 2WJDA 3T0TA 4PMZA 3O15A 1PAMA 2JKAA 3RX2A 4A4AA 1V6TA 1W2VA 1TE6A 5CJMA 3BLPX 4AAJA 4HQVA 6REQB 3TAKA 4MHBA 1XFCA 5EL1A 3H4WA 4I7UA 1XH0A 4CU8A 4UTMA 1C7TA 2VENA 1FTXA 2H3BA 2PCQA 4B5XA 3B40A 2FQIA 1XIBA 1AG1O 4Z1YA 1UIOA 2EQDA 3SECA 2YPIA 1J0HA 3PBVA 1C8VA 5IBXA 3L7RA 4AVNA 1MNZA 3WDQA 2QVHA 3FJ4A 1QWGA 5KINA 3TFCA 5CKSA 3KM8A 2E6YA 4JGDA 2ADAA 1J18A 1QATA 3CZ8A 4J3UA 4Q3MA 4QJ3B 4A29A 5I3IA 3AMDA 3GXNA 3GSMA 1K4HA 3VOFA 3QOKA 3LZ3A 1CXKA 1EHAA 4HPXA 5BZAA 4HTBA 3LCFA 4D6DA 5CBJA 2NX9A 2WPGA 3WNNA 3SRFA 2POTA 3AMLA 1JZ7A 3CS2A 3N18A 4UOQA 1B3ZA 3OVQA 1R2TA 1IXOA 4WF7A 1DJHA 3W1UA 3ITTA 1IWAA 1RR2A 1A5AA 3FJNA 3LS9A 1NQKA 3ARYA 2PE4A 1SUXA 1J5SA 3W24A 4GQRA 2WQPA 2FPYA 1KV8A 3PBUA 1LL7A 1UR0A 2J7CA 1S1RA 2OOGA 1W3JA 1M7OA 3VMPA 1DKWA 5C55A 3IJQA 3N9RA 3KVMA 4NNCA 3IV8A 4I7WA 1SGJA 1IR2A 3IGSA 2V9DA 1MDRA 1TTQA 1XIFA 3WDHA 4HZ6A 3T81A 3L0GA 1KCLA 3FYPA 4GQBA 1M53A 3UWVA 4N0RA 1X7FA 1W91A 3T08A 3WD2A 3TEVA 2CESA 4TVDA 1UUOA 2DSVA 1PTGA 3RLGA 4YTUA 5HATA 2OQHA 3KVLA 5D9PA 4ROQA 1FWCC 1F61A 1EJRC 2XIJA 3BANA 1Q6FA 5BROA 1RPXA 1HO1A 1IT0A 3DBPA 3C8FA 3RPTA 2O4QA 5M3WA 2TPSA 1F6KA 3L4WA 1YPFA 5ECVA 2Z1BA 1RJQA 1H7RA 1GEHA 4LV9A 4HTYA 4IJCA 1ZB5A 1V51A 1TPVA 4PUJA 2CKRA 1V8EA 2A21A 1T96A 3GE7A 4TVCA 5CC5A 3TYAA 4UFJA 4IXHA 5MF5A 3QTGA 3QZ6A 1WZKA 3KOZA 4OV4A 4UTLA 2XFWA 3CL6A 1YMYA 4E4FA 3WY1A 3ZQ9A 4DWSD 3CZEA 1SU5A 4DM1A 2CLEA 4EF8A 3TFXA 1CLKA 4R3UA 3KXQA 2QZRA 2GVGA 1BKHA 4W85A 3BMWA 1BEUA 4Z42C 3LCGA 3LOTA 2JE8A 5D05A 2XVGA 1UWTA 4IH3A 1TV7A 3B0PA 1LRNA 1QK2A 4J40A 4CNNA 1VFUA 4JTJA 1D7FA 5KSWA 1FWGC 2ICSA 1EA9C 1J4EA 2FHCA 2VEFA 4AU0A 3S2MA 3PUOA 2I9EA 2GGJA 3GFZA 3ITCA 1UR1A 4O0QA 4YWIA 4PUNA 3ME3A 4EKJA 4CCZA 1QWKA 2A79A 4U5IA 3MSGA 3BZJA 2WCAA 3WQCA 3LBCA 1EJWC 4DF0A 5C2CA 2R1LA 5CG0A 4I6VA 5F1VA 1VFSA 4J2MA 4NAFA 3CXOA 4JTRA 2ACRA 2XZ7A 1M7XA 1EFZA 1HKVA 2OQYA 3TQPA 4Y9MA 3DENA 1MZHA 2FIQA 4C7DA 4IQLA 1VLWA 3AXHA 3MCMA 5E09A 3S6TA 4U4MA 3KOXA 4UNKA 1OVDA 4PN2A 1LBMA 1E0UA 4N4QA 2OSWA 2ZKMX 3XINA 1XP3A 4HA3A 2PWHA 1NFBA 3CBWA 1J8VA 1KFLA 4E2BA 3KHJA 3IGXA 3E0FA 5D03A 4CN6A 4LUTA 3UA3A 3B0XA 3BSMA 2GFTA 5JH1A 1K77A 1X8CA 3BV7A 1FRBA 4EPDC 2NQLA 3UY7A 4HD5A 1XLMA 2PFHA 4CQDA 2A3LA 1HL2A 3U0HA 2BGQA 4MWAC 4LCQA 4KRTA 4HA1A 5CSYA 4DLMA 2A6NA 2FFCA 3BOXA 1UR9A 5DMMA 5TIMA 1PTAA 5ABHA 3ANVA 3JVAA 3WJYA 4P8XA 3NOYA 5D9MA 4ILSA 2VMFA 3GXDA 1WPCA 1EJXC 1Q6RA 3UCCA 2WLYA 4GIAA 2DIEA 3STPA 4ZQNA 4FF5A 2FH6A 2D3LA 2ZUSA 2D69A 3ABQA 1SW3A 4JQ1A 3U8GA 4DYEA 1R30A 5I77A 4PUDA 2Z6IA 4M3PA 4FR6A 3OO2A 1MNSA 3M41A 1QAPA 1J0KA 1WDDA 1XLAA 1AH0A 3EX2A 1PPIA 2NVDA 7XIMA 3MS8A 3H7RA 3WF2A 4A3RA 4HU8A 1ZSXA 3LRLA 1VRDA 3TH6A 4B5NA 4YCOA 2A0NA 2JIEA 3RO6A 2XIBA 3EDJA 5AZ1A 3VIHA 3AIUA 3K8KA 3DGRA 4GYPC 4ERAA 4UR8A 2VDGA 2ISSA 3PTDA 4OUEA 2OO6A 1VRXA 1DYSA 4U10A 2VZSA 4ZO6A 1EGVA 1VC4A 3OLIA 3TQKA 4QM1A 3WFAA 1NELA 3WDRA 3GTNA 1I0BA 4Q8PA 2CIPA 3APYA 3SEPA 3W2UA 4PUMA 4AD3A 3M1ZA 3AHYA 2GLKA 1PZ3A 2XN1A 2WKJA 4PUWA 3DU0A 3EDDA 3M9YA 4GJJA 3HFYA 4QE1A 4FLSA 4JQAA 2PDFA 3CIVA 5DX7A 6TIMA 4MYAA 4GIEA 3IK2A 5HXMA 5BRQA 3MMTA 4M1BA 3TN6A 4ZQOA 1TJRA 1UJPA 4ZQMA 1IZCA 4GD0A 3GTXA 1EYWA 1V08A 5GNYA 5REQA 4O50A 2DZBA 1OFDA 2YDQA 1OGGA 4GXMA 4JKMA 5H8MA 3VDHA 3OHIA 4DN1A 1JCLA 4LAOA 2QDDA 4U31A 4QS5A 3F2CA 5DLCA 2ZIDA 4HT3A 1O12A 5G5IA 1H09A 4IQJA 4B5WA 3H12A 4WGXA 1OC6A 2BG5A 1WBHA 5AC4A 3FEMA 5HNTA 3O0FA 3UZJA 1RA0A 3S46A 1D3HA 4IPIA 3TJLA 1MW3A 4JBRA 2PEVA 2Q01A 1KTCA 4HPJA 1R7AA 4IGMA 3DGBA 3F5KA 5ABGA 3UU0A 3C5QA 3WBEA 4J3VA 2PDMA 5FL0A 3M5VA 3QY6A 4FNQA 1M7JA 4W7UA 4UNIA 4NX5A 4JFUA 1E40A 3VD9A 1Q7ZA 4C6IA 3N3MA 4R34A 1SJBA 3BLDA 4PB3A 2WMGA 4HU4A 4UTIA 2HBXA 3L67A 3W7MA 2VEGA 4JEQA 4OHQA 1RALA 3T0AA 3DFOA 2RJHA 1QNPA 3ZS4A 4PCTA 2I56A 3DERA 4AZGA 4B5SA 3G0SA 4TTUA 1SQ7A 2BOEX 1OD0A 3HPSA 3VD4A 3T0CA 2QCCA 4CD6A 4Q8TA 1MRAA 4WOQA 5CPQA 3HURA 1E0VA 1SW7A 3GVQA 2YR1A 4WKHA 5C7HA 2ISVA 1B31A 4BJHA 3LHYA 1Y8BA 3THAA 1O60A 1M65A 4BI5A 8RUCA 2DW6A 1VIZA 4DLFA 3AHZA 5A8NA 3P14A 2YB4A 2WV8A 3PPGA 4IPNB 4XD5A 1VEPA 3M0XA 4QX4A 5J5RA 3VXGA 3QGVA 4W8AA 3MSDA 2V5CA 2VFIA 4RV3A 4Z1DA 1DWFM 1NARA 1XI3A 2WJFA 3CQ0A 2P0OA 4E2OA 5IRPA 3JUGA 1EX1A 4XUGA 4HBKA 1RPKA 4IGSA 1R3QA 1SO5A 2FZ8A 4DBWA 3V18A 4HK7A 1AVAA 4KFNA 3W2KA 3C4UA 3VIJA 3N15A 2BY1A 1QMLA 2V3DA 3W25A 1BG9A 3KOYA 8A3HA 3LQGA 1X6NA 3UNDA 4IX2A 4I9AA 2A3EA 2ZRZA 2WWCA 1SW0A 5HWNA 1WCGA 4XAPA 2WVUA 4GYKA 3TSDA 4TO8A 1BQGA 1E6XM 3FK4A 4Z2GA 2X1TA 2O7SA 3EX4A 4NF7A 2IKGA 4XQ6A 2OB3A 3VX0A 2NXIA 1K02A 3OZYA 4QQUA 3G2GA 4A3QA 4ZO8A 4C5YA 1GCYA 4L9ZA 1PZ0A 3BG9A 3ARPA 3RYSA 5G4HC 4CU6A 3QH2A 3LG3A 5DT7A 2GJXB 3EGJA 4NXSA 3MU7A 3LGDA 4D1IA 4JL1A 2VGFA 3AWNA 2V63A 3SCRA 4GI6A 1NJJA 4DBDA 4JTFA 4GBUA 4LRSA 1XIEA 3BLOA 5XIAA 3B0UX 3A9IA 4CCCA 3G6MA 3DHUA 2NLYA 5BCAA 3SURA 4R7JA 3FA3A 4F2UA 1POKA 1UC4A 4JIRA 3R8GA 1R3SA 3BOFA 4BWLA 1EEXA 4PMXA 4ZODA 1LLOA 3CTLA 1PXGA 4ORMA 4QE5A 1KD0A 1LRQA 4IMAA 4HIBA 1VIWA 3WQGA 3H24A 1JPHA 1MO0A 3EXTA 4GI8A 6TAAA 4R85A 4EACA 5HMSA 5I79A 1K8CA 3THUA 3MHGA 1L0PA 4D6IA 4C91A 3B04A 3IUHA 3NYZA 3TJIA 1UUQA 4MPKA 1EPXA 5E70A 4AHPA 3F1QA 3LK6A 1JUBA 4C65A 3VAVA 3EWCA 5BXSA 3NOEA 3URAA 3W2NA 4S3JA 4GPNA 1PL9A 3WLHA 4KEZA 3PZIA 5CZSA 1XCWA 2QVNA 2FJKA 3P5ZA 3E74A 1Q6LA 2Q71A 1XW8A 4KRZA 3BLFA 4YJ5A 3FFSA 2PAJA 1V0MA 2WC4A 3REQB 1ZY9A 3EDEA 3WDIA 2OR2A 4M51A 2P8BA 2Y2WA 1MXDA 3AAMA 2FGBA 1TCMA 5HJXA 5BNKA 2QXWA 3TONA 3LN3A 3ZO9A 2EPHA 1ZU8A 2XUCA 3H8AA 1A5LC 2Y0FA 1EDTA 4HZ7A 1Z42A 4LJ3A 1PDZA 1KM5A 5XINA 3HGRA 3GFXA 3VGBA 4QLJA 3NDOA 3W02A 3F03K 2Z25A 1W0MA 1JPMA 3DG3A 2V81A 3G1FA 1V02A 5AFDA 4MWAE 3W7IA 2KX9A 2QJNA 4YHGA 4MY9A 3QYSA 1ZCOA 3A24A 5T8GA 3O9NA 4XVEA 3FY1A 4Z1CA 4A8RA 5CGQA 1WX0A 4X22A 2O56A 3KS6A 2R82A 3TA6A 4F0RA 3PM6A 3URQA 4BY3A 4BF5A 1KCKA 1ZCCA 3H55A 1IYXA 1JR1A 1GZJA 4O8AA 3VA8A 5KTLA 4ONVA 2O7QA 4QG6A 4D8AA 3HO8A 5DXYA 5DQPA 2G3FA 4PFHA 1F9CA 2F6UA 5M2FX 1NOUA 1W9DM 4S2BA 3QRHA 2XWEA 2PWDA 4E5TA 4C6DA 2DVTA 1TV8A 2OLHA 4UTWC 1R86A 4IM4A 2C6QA 3NQCA 4GH1A 4CQCA 4O13A 1GOOA 2PS2A 1DJWA 3GDBA 1OINA 1FXPA 2XGZA 2VGIA