4EROA

Study on structure and function relationships in human pirin with cobalt ion
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
288
structure length
288
Chain Sequence
SSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pirin
publication title Pirin is an iron-dependent redox regulator of NF-kappa B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 75
structure length 288
sequence length 288
ec nomenclature ec 1.13.11.24: Quercetin 2,3-dioxygenase.
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02678 Pirin Pirin
A PF05726 Pirin_C Pirin C-terminal cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4eroA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4eroA01
1YFYA 5I8YA 1UIJA 2IXIA 3UKVA 3WW4A 1XE8A 2QCSB 3E6BA 4BYYA 3SMHA 1J58A 5J3UA 3M3IA 3OF1A 4IEVA 1YHFA 1X8MA 2XHKA 4HBNA 4B29A 2ZKLA 1SEFA 1NZCA 2I45A 3EBRA 2O8QA 4UXAA 1DZTA 3B02A 5AVPA 2VECA 1UD1A 3CLPA 3FFQA 2Q0AA 1LRHA 2C0ZA 5KHGA 3E97A 5J7MA 5I0SA 3KGLA 1H1IA 5CADA 5EFUA 4OFGA 5C8WA 3H7YA 4J1XA 3OTFA 4X6RB 4IEPA 3BPZA 1YWKA 4IEXA 3EHKA 4AVBA 1YFXA 2K0GA 1Q43A 2Q1ZB 4AXOA 4FBFA 3UKNA 2BNOA 3TNQA 5JAXA 4D7SA 4LA3A 3R6SA 4D7TA 4MX3A 1RL3A 4Q0VA 4YNIA 3OGJA 4H7LA 3MDPA 2D93A 2QVSB 3DV8A 4HSJA 4XETA 1XE7A 2Y0OA 2H6BA 4PJYA 4I0BA 5E16A 1I5ZA 1VJ2A 3LA3A 4HSLA 3RNSA 5BXXA 1DGWA 2GAUA 2CAUA 1OFNA 3CJXA 1Y3TA 2D40A 3I59B 1J59A 1YLLA 2EAAA 5JCTA 4KWKA 3H8UA 4HMZA 1ZRRA 1ZZ8A 4HLTA 1O3TA 3FWEA 3NVCA 1UPIA 2QDRA 5KBFA 1ZZBA 4LEJA 4O9GA 3U10A 2VPVA 5LRRA 3H50A 4HVQA 1ZZ7A 3LA2A 5FDBA 1X7NA 4JV4A 3VHRA 4L11A 3KSCA 4XFCA 2QNKA 1O5LA 4IEOA 4XF0A 4BHPA 2UYBA 1NYWA 2MPFA 3BALA 1ZX5A 2ZCWA 5I8SA 3LZZA 3HQXA 3S0MA 2GC2A 4QM9A 4HN0A 2D5FA 3PVBB 4MUVA 5FQ0B 4MGZE 3S7IA 5LEJA 2IC1A 4KL1A 3DL3A 3DKWA 4YRDA 3RZZA 3MYXA 4IEYA 5CU1A 2B5HA 1CAUB 4Q0QA 4UBHA 3IIAA 1SFNA 4XFGA 4A2UA 4UBGA 5J48A 5JSOA 5KHIA 5F1RA 1CGPA 3SXWA 1LKNA 2PQQA 2XL7A 1O4TA 4Z07A 4CYDA 2Z2SB 4L2NA 1X8EA 2ATFA 2XKOA 2D5HA 2XLGA 2OYZA 3RYRA 2XLFA 4EWDA 4MV2A 1FXZA 2DCTA 4ZU7A 2IXHA 1QXRA 4QMAA 3BU7A 1WGPA 2N7GA 3H9AA 2FQPA 2XLAA 2IXJA 4XEZA 4YSFA 4ORFA 1J3QA 1UIKA 4XFHA 2MHFA 4J1WA 4JTOA 2GC1A 4AVAA 4Q0UA 5D1IA 5FLIA 1ZZCA 1IPKA 3SCHA 3HT1A 2MNGA 4MH0E 3C3VA 3G7DA 1O7FA 1CAWA 3FE5A 3LA7A 4N9IA 1JUHA 1CX4A 3IDBB 2IXCA 4IEZA 1G6NA 3NSTA 4YYOA 4F7ZA 4ONUA 4NVPA 4KU7A 1J3RA 1Q3EA 2H6CA 3S7EA 2EA7A 5I0UA 1CAXB 4IEQA 2HJIA 5BV6A 3SCFA 4XFBA 4YARA 1EPZA 2P17A 1GQGA 3D0SA 4Q0SA 2K9ZA 3PNAA 4E2QA 2B9UA 5JSRA 5FLJA 1RC6A 4HN1A 4LA2A 1ZNPA 4XFAA 1IPJA 3DN7A 4XF9A 2OZJA 2CV6A 4LUKA 3ROUA 1YFUA 2CAVA 5FLHA 3E6DA 1YUDA 3I54A 2F4PA 5EZWA 4GULA 4HZFA 4RD7A 5BPXA 1CAVA 4AQ6A 2ET7A 2GH2A 2OPKA 3KGZA 5FPXA 2UY8A 5HI0A 5T3NA 3E5QA 2V09A 2BYVE 2WC2A 3KCCA 5FPZA 1NE6A 3E5UA 3FZ3A 3BCWA 4MGYE 2H0VA 4R52A 4KWJA 1UCXA 3WW2A 5I0TA 1DZRA 1SQ4A 1QWRA 3L2HA 3IWZA 1ZRCA 4I2OA 4META 4IEUA 2VQAA 2PTMA 2OA2A 3EJKA 4HVRA 4KWLA 1RTVA 2IXKA 4QGNA 3QACA 4HVOA 4PIXA 1X82A 1O3SA 2B8MA 2PA7A 2PAMA 1WLTA 3H1WA 2Z69A 1CAXA 4P9GA 2WFPA 2ET1A 3LOIA 4IETA 5FCCA 4IERA 2PHLA 1NXMA 1EY2A 3GYDA 2GC0A 1UW8A 1DGRA 4XFFA 4Q0PA 1PM7A 2CGPA 3O14A 4QXKA 2O1QA 2BNNA 2IXLA 3JZVA 4PIYA 3ZDSA 5BY5A 1LR5A 4LULA 1O3QA 5JSPA 4I01A 3WW3A 4E2GA 4PIZA 5E1RA 3E6CC 4WZCA 2PHDA 3ES1A 4XF1A 2UYAA 5I93A 3OCPA 4EWAA 4JVAA 1ZRDA 3H3ZA 5BUVA 3EO6A 4QM8A 3FHIB 4MGKE 4F8AA 3EQEA 4DINB 1I6XA 4E2SA 3BB6A 1GQHA 4EV0A 3ES4A 3ELNA 3ETQA 1RGSA 4I0AA 3RDIA 3SCGA 1LB2A 3I59A 4I3PA 1O3RA 2XGXA 2XKPA 3GBFA 1L3JA 2BGCA 2PYTA 4X6QB 3CEWA 1ZRFA 2PAKA 2KXLA 1QXJA 4BIFA 1OMIA 3ACLA 4QX5A 1VR3A 4KU8A 4FT8A 4LUMA 2Q30A 2FMYA 1OI6A 4OLLA 4WVZA 5I8TA 4QGLA 3H3UA 1FT9A 4IEWA 1Y9QA 4EROA 3H1YA 1EYBA 4I09A 4JTNA 4Z82A 1ZREA 3OD0A 1V70A 3HT2A 3QOPA 3FJSA 3ST7A 5C6CA 4XF4A 2BNMA 2Q4SA 2XL9A 2UY9A 1ZVFA 4IESA 1QY4A 2GU9A 2GC3A 1CAWB 1TQ5A 1YFWA 5FQ0A 5I0RA 5LEKA 1U12A 3NL1A 4MZUA 4FAHA 3NKTA 1H1MA 1CAUA 3CL1A 4AVCA 5JR7B 3I7DA 3N4MA 3U0ZA 3M70A 3NW4A 4FAGA 1J3PA 4QGMA 4BH9A 4I02A 1EP0A 1RUOA 1WA4A 1Q5OA 3KMHA 4LTAA 4N9HA 3LWCA 1ZZ9A 4Q29A 3RYPA 4AQ2A 1NE4A 3PLQA 3TNPB 1O5UA 3USSA 1XRUA 3E5XA 3MZHA 3CF6E 5I91A 4EWEA 1OD5A 4K8FA 4R8HA 2QJVA 3D82A 3CO2A 3IDCB 3H7JA 1CAVB 3UKTA 2E9QA 5CVRA 2GZWA 4MGIE 3IBMA 1ZZ6A 1RUNA 3MPBA 5KHHA 4WBBA 4XFIA 5KHJA 4ZU4A 3HIFA 3LAGA 4TLFA 1J1LA 4XF3A 3SHRA 5KHKA 5LRSA 3WW1A 1FI2A 3D0JA 4ZU5A 3RYKA 3H1MA 3NJZA 1HW5A 2HKXA 1VP6A 3FX3A 3U11A 2PAEA 2ETEA 3RPQA 4O9EA 2BEOA 5K8SA 2EVXA 2PFWA 2OZ6A 1PMIA 4LLOA
chains in the Genus database with same CATH superfamily
1YFYA 4PDWB 3M3QA 1BK0A 5FY5A 5FUPA 1GQPA 3EB7A 3ZSLA 5L9BA 2ARAA 4CCDA 4AL9A 4ZZ8A 3J8F1 2OIIA 1XE8A 4BISA 1UY1A 3J7HA 4LBLA 4DIQA 1CN1A 2DFCA 3RS6A 4BYYA 1PO21 1J58A 3T3YA 5JUVA 2PLV3 2Z5WA 4FPGA 5A3TA 4IEVA 5G04L 1LHUA 4S2GA 2X5IC 2OQ6A 2PHRA 3VBFA 2AH2A 1SEFA 2VXRA 4XUOA 4YVSC 4ZU7A 3BU0A 1W9YA 4CP1A 4P02B 5A7PA 5C5UA 3B02A 4QX1A 3IPVA 1DU3D 1F8VA 1CD3G 1BCXA 1UKGA 3CLPA 3GF6A 2Q0AA 1HQWA 1LRHA 3W5MA 2BTVC 3E97A 3K77A 5JR2A 5L7OB 3KGLA 3SH5A 1G9BA 1NX9A 1GP4A 1D4M2 3HWJA 4ZZ5A 3GCWA 3HR9A 3ILFA 1BVP1 4LJHA 3H7YA 2BW8A 5EJ3A 5C8WA 4X6RB 3WG4A 4IEPA 4BLJA 4Y33A 3BPZA 1QNWA 1XNTA 5HBAA 4IEXA 3LFMA 4JAAA 2WZR3 1UY3A 4FXGB 1S2BA 1YJLA 1Q43A 2W1QA 3W5NA 2R061 4YGBA 2ZBJA 2VM9A 3B7MA 3PDQA 1IS4A 1LGNA 2W1WA 3KHCA 1ZBE1 4CP0A 1XYPA 1SFPA 2BNOA 4OMCA 5LW9A 3LQCA 2WYFA 3TNQA 5HCHA 1Z0HA 1EAH2 4D7SA 4A41A 4JGZB 4LA3A 3R6SA 1H2KA 2CNAA 1HQLA 1O8PA 1RL3A 4B1MA 1W0OA 1ODMA 1AJOA 3OGJA 5HCBA 3MDPA 4OHWA 2Y6HA 1ZBA2 2RDNA 3OG2A 4XETA 2E7QA 2WS91 4B4QA 3JD71 2Y0OA 3UYJA 4PJYA 3LA3A 1VJ2A 4HSLA 1WW6A 5FPLA 5BXXA 1WW7A 2CAUA 1BEV2 2VUDA 4NIHA 5K0UB 1YI7A 3POWA 1K5MA 2HWD3 1BK1A 2C24A 4DY5A 1GZWA 1RUJ1 1AYN1 1TNFA 3TBDA 3I2FA 4ATFA 5FYYA 1MS8A 3INAA 3S5AA 1VBE1 1YRZA 4LE4A 1RUE2 4CDXB 3D6EA 2ZGKA 5ABJA 1JZ2A 1R1A1 2OKXA 3RZMA 1JYWA 5JXIA 4W6XA 1W39A 3RZGA 1LTEA 5KBFA 1DIWA 2B4KA 2EICA 4CUGA 1OVPA 5BNQA 4D6SA 5CKMA 2VPVA 4E8CA 5CG8A 4AAPA 1E57A 3MF9A 5FZDA 3AX4A 1F15A 1LOEA 5DUUA 4AE2A 4MYEA 3WDWA 2WFF1 1X7NA 3I2IA 1XYNA 2MEV2 2QFEA 3RMXA 4F83A 4DRVA 4JKMA 4QPIB 1C5IA 1C28A 3WQBA 4FPFA 1TEIA 3HNYM 2UYBA 2YPDA 5FBJA 5AFEA 1AR61 2MPFA 4IE6A 5FOBB 4IV1B 1OOPC 1QJY2 1ZX5A 1XOYA 1EV11 1UXZA 3POGA 4A3ZA 3AMMA 3HQXA 3AYCA 1UZVA 1MEC2 1PZ8A 2GC2A 3GGLA 4AFAA 1MVEA 3RI9A 5EYXA 4Z1VA 4UI9L 1V9U3 4MUVA 4NIIA 3I4IA 2ZAHA 1CONA 3DL3A 3W59A 5ABJC 3DKWA 3WDXA 5A3PA 2R7EB 3MYXA 3DEMA 1O91A 1SLCA 3DPRA 2VAUA 3KVBA 1RB8G 5BNOC 3TRSB 4CEYC 2W46A 2FDIA 5B2GB 1SFNA 3MO4A 2QQIA 1NY72 4LITA 1G9DA 4ZKTB 3TEZA 3I3EA 5KHIA 1YJKA 1CGPA 4P9YA 3WQ1A 1F31A 1LKNA 4CDWA 1TNRA 2RM23 2NN8A 2GMMA 1O4TA 4Z07A 1HRV1 3D4KA 2XQXA 3OGSA 3O1SA 2QQKA 3OUIA 1N1TA 1VRH3 4LQRA 1OC1A 4EN7B 5EIYB 2RS13 2BBVA 3AMHA 4OCTA 1C57A 4RHV2 4BQ3A 2E7AA 1AYM3 2WWSA 5K4LA 4NUBA 3WHUA 1Q8OA 5LY2A 4MV2A 5A6ZA 3ZO0B 2DCTA 3VL9A 1FPN2 5G05L 5IAXA 4OZXA 5HXMA 4Z92B 3BIWE 2WO3A 1KFXL 3THCA 2OVUA 4QHOA 4UFJA 5IVVA 4AHXA 1I5PA 2FQPA 3H9AA 1VBD1 1R093 2BUKA 2ZOEB 3H8XA 1ND2A 1UIKA 2XOMA 1MQTB 4R9AA 4XAEA 1BZWA 5LBFA 2WWUA 4YG0A 4NPLA 4NHLA 1CIWA 3FBMA 2KR2A 3D8CA 1FMD1 1UZWA 1ZZCA 3IN9A 4BMBA 2W5FA 1KS5A 5KR7A 1LOGA 3ZXKA 1IPKA 3SCHA 3HT1A 5I0DA 1GOHA 1C8NA 3MV01 3WHTA 5F6LB 4I3GA 3PTRB 3B3QE 5DZFA 5JI7A 2JB4A 1O7FA 4Y5TA 2OS2A 2RS32 1CAWA 1W8FA 4N8MA 4DUWA 4E4DX 2HWE2 3MLKA 1TG7A 3NWKA 1ULDA 1FATA 4C1XA 1CX4A 3IDBB 3EMRA 3WVJA 4IEZA 1RUD2 1OKQA 1RMU1 1ASJ2 2P2KA 3ACFA 3AK0A 3MW4A 4LK7A 2VCMA 4YW4A 2YZ4A 1RUC1 4ONUA 4XAAA 3S7EA 4FOQA 2PN5A 2ADDA 1AXZA 2EA7A 5I0UA 2LS6A 4PLOA 2ADEA 3ZFEA 2HJIA 4CUAA 2XVLA 4AI2A 2W39A 3CDZB 3POBA 3M8LA 4FVVA 3VBFB 2FCUA 2P17A 2A6ZA 2NM1A 2QDNA 3ZR5A 4Q0SA 4E2QA 3IPVB 1S4CA 3AKTA 4YG6A 3OBRA 4CRQA 1RC6A 4RYDA 1GZTA 1PVC2 1XNCA 1DF0A 1KJRA 3B69A 4FPOB 4QXBA 2OW4A 2R042 5FP3A 1QJX3 3LCPA 4JGYA 1IS6A 4L92A 4LO7A 4YM1A 1UXXX 4P9JA 4JDNA 5EZWA 3HD8B 5JXJA 3WF4A 1UOBA 1G9AA 2W08A 2R063 1PMJX 2DCKA 5IUQA 3VBHA 4GMP1 4OVEA 3ZFGC 5C70A 2OPKA 5FWJA 2DUPA 3V56A 3H8OA 5T3NA 4DOUA 4P5YA 5A7OA 2BYVE 5KC5A 5ERLA 5FPZA 1US2A 4WM7A 1RHI1 2ZHNA 1XSRA 3ZXGA 5A6YA 1VBA3 3WF2A 1Q56A 3OY8A 1W03A 1UCXA 2WS93 3PHMA 4NHXA 5FZOA 3WW2A 2WNUA 3JD73 4GKYA 4DFSA 1NOVA 1WD3A 3OEAA 1OUSA 1E5RA 1AJKA 3QH6A 5FZ4A 3LE0A 5DUXA 4ZS3A 3F95A 5EXOA 1FYUA 4RSUA 3OYWA 2C5DA 5D8AB 3PUIA 3SC7X 1AYN3 4HVOA 1JN2P 2VZ1A 4L9BA 4RQPB 2W3JA 4P9LA 5LBBA 3ZFFC 1K5MB 2QUOA 2B8MA 4TWTA 2PAMA 1GZWB 2RE9A 4BMEA 1R1A3 3K48A 5FZ0A 4XMAA 3LOIA 1IOAA 4A6OA 2W91A 4KG8A 5JPMB 1JYTA 5DDJ2 4ET7A 5BYNA 1NUKA 1LODA 1K5JA 2ES3A 1D2QA 2Y8KA 4FPHA 1EY2A 1X50A 3JUUA 2W1SA 1V6OA 2VZ3A 5FZ7A 2GC0A 2WFF3 3WUCA 4I0WB 1UW8A 4CU8A 3HQRA 1DGRA 4Q0PA 4DY3A 1UMZA 1JYIA 2RJ2A 1JUIA 3C8XA 4AI3A 3A0NA 1TMF1 2LM3A 1AR63 2BFUS 2JG9C 2W95A 4GH4A 2WZPP 1W28A 3AVSA 4I30A 3VD4A 1H9PA 4D6RA 4GD4A 1LOBA 2BNNA 2HEWF 3MIBA 4B7EA 1WMEA 1HLCA 3NMBA 5DAQA 1C1LA 2VTFA 2A3YA 1V6MA 3OGRA 4LMFA 3HJRA 4LULA 5FZFA 4XXAA 5HPOA 2R1DA 1H2NA 2BP6A 3UT0A 1O3QA 4CDUC 2W0XA 5E1RA 1UN1A 4WZCA 4LKEA 3E6CC 1W9WA 1RUH1 5APAA 2AEYA 4FQ4A 2DU0A 4LORA 3GJBA 4Y4RA 4BQ2A 3PMEA 2Y6GA 2OUJA 4HETA 4JVAA 4QX8A 2ZGOA 1W6OA 4BA6A 5C4WB 3UNPA 3IDEA 1L7RA 1QXPA 2VCBA 4JHTA 2HWB1 5FIXA 4XYXA 3ZKYA 3X29B 2ZA9A 3J9SA 3E1F1 1D4VB 3EO6A 3L9JT 3WG2A 3FHIB 3SH4A 3ZVXA 1REEA 3MW3A 3WLUA 1JZ4A 1SBFA 2D6KA 1XBFA 3AB0A 3VHPA 4QKDA 3WNKA 3ZN6A 4ZONA 1Z7S3 2TUNA 4CDWB 4BQ5A 5C33A 4TSVA 3PURA 4EV0A 5EV7A 1OH3A 2Y38A 5IK7A 1W05A 3IIIA 1KRIA 1HIXA 1MS1A 3NV1A 3RDIA 1F4HA 1GSLA 1OLMA 2VUAA 4LBQB 4LO4B 4NRPA 1O3RA 2V5YA 3S30A 2XGXA 5FPAA 1GFF2 3DXUA 2QQWA 4URTA 3WP3A 1GP6A 2BGCA 1VBD3 3GNEA 4WVMA 4X6QB 4CXXA 3CEWA 1DQ5A 2WDBA 2KXLA 4RGAA 1ZRFA 2QQOA 2YBPA 4OHVA 3HNMA 4BIFA 2ZZQA 5CZKA 3VZOA 1AXYA 1WMXA 2A5ZA 3TYJA 1OSGA 1SBDA 1VR3A 2W2IA 4AHWA 4XIOA 4DXZA 4YW5A 1FMD3 1ND2B 4WVZA 3RWNA 2VOVA 4JC1A 2XWBB 4KI5M 2P4EA 5I8TA 2TBVA 4AYUA 5A3UA 4KQ7A 4UWDA 3H1YA 4PF1A 4OHXA 5F3IA 4JKKA 1AL21 2VZTA 1EYBA 1B35A 1TME2 4Z82A 4AZZA 2Y33A 2X8KA 5JMCA 4RGKA 1A78A 3OSDA 2Q4SA 5LA1A 1CVNA 2JIJA 1H6YA 4JX0A 1FNYA 1LULA 1NCRA 1ZVFA 2XJVA 1GWKA 3LGRA 4EJRA 1I1EA 5FJKA 2JD9A 4JZRA 1QQP1 2QTWB 4IV3A 1AL0G 1CAWB 1RMU3 3KV6A 4DS0A 3AJZA 2NLRA 3AXEA 4IE7A 3WNOA 3KLSA 1RUC3 3CIHA 5DG2A 3NL1A 1CESA 2QZ2A 2OQ7A 5IK8A 3N9PA 4FAHA 3NKTA 1H1MA 2HLEA 5A7QA 2D6LX 5CKQA 5CEHA 2GNMA 1UY2A 5H9QA 2Q1MA 4JQTA 5IT6A 3ZFEB 3BPSA 4UW5A 4W8JA 1PHMA 3VKOA 3N4MA 5J96B 3U0ZA 1ND3A 5LZ6A 4NMIA 3D5OA 1LHWA 3CJIA 4FAGA 1J3PA 1H1AA 3PIJA 2DF7A 4GALA 1RUOA 4CZSA 3K4DA 1BMV2 4NWVA 4Q29A 3IM0A 5HV0A 1NE4A 3TNPB 3VBSA 4S2FA 1JMUB 1O5UA 5CNAA 3USSA 3WY6A 1XRUA 5A3LA 3MZHA 5FK8A 3CF6E 4JGYB 2NZ9A 4GMP3 4S2HA 4FTEA 2YHJA 5LATA 4YVWC 3A0KA 3CO2A 3GZTB 3FMGA 4G9SB 4JHZA 4Q4W1 4OQ8A 5FZAA 3O1UA 3VBHB 2QE3A 3T4HB 1N3PA 3OGVA 1YCIA 5CVRA 3I49A 4GMP0 1RHI3 4MGIE 3HPNA 2VL4A 3IBMA 4PT6A 3T0AA 1ZZ6A 3J7MA 5GKAC 1RUNA 2OXBA 4QX7A 4WM7B 3T09A 3WEZA 1G7YA 4W4ZA 3S5QA 3WXPA 2JDAA 1W9SA 3OY8B 2VZOA 3ILRA 4QU2A 5FZGA 4DEVA 5FZOB 3UJQA 3UGFA 1W9FA 4A45A 4XTPA 2BGOA 2D3SA 4XJ9A 2KD7A 3ZYBA 3AL5A 3RWKX 3RYKA 3VDDC 4HXCA 5IW0A 1W8OA 4RR3C 3OYWB 4A6SA 3KB5A 3K3NA 5FY0A 4YM3A 2V5DA 5FPBA 5HCAA 3WV6A 4D94A 1REDA 3LIGA 2YC4A 3KT4A 5FYTA 4KWUA 1OQEA 1CPMA 3UK9A 5FPXA 1A8MA 2VZQA 4LLOA 5F32A 1FX5A 1D7PM 4Q4X2 1SLBA 4M0NA 1UIJA 1UKRA 2C6SA 2BU9A 2WN2A 2ZEWA 1GP5A 2HH9A 1Q8QA 4ARYA 2QCSB 2XR4A 5DMYA 3ALQA 4PF5A 5FREA 2BVBA 3SMHA 5FY1A 3DF0A 1TMF3 1UX6A 2X53S 2X5IA 3N7KA 2ZHMA 3O12A 4GA9A 3URFA 4B7KA 2XVGA 3M3IA 4YVSA 1X8MA 4HBNA 1U5IA 2XUEA 4OHZA 3ECQA 3BKZA 2I45A 1FV2A 2VBPA 5DAWA 3SITA 4GH4B 1OLME 2R0FA 1AZDA 1WKYA 2O8QA 3POIA 4RS5A 1PMHX 4NE9A 4UXAA 4A4AA 4BK4A 2XJTA 2FDJA 3H3LA 1AR72 1D4M1 1HB3A 1UD1A 2P3JA 3M3EA 2GN7A 2ZHKA 4HOOA 1PIV2 5KHGA 1LU1A 2DTWA 4MADA 5J7MA 5CKNA 1RUH3 1H1IA 3UJOA 2AC1A 4OFGA 2D98A 4R4ZA 2DTYA 3OTFA 4L99A 2P34A 4YGCA 1LCLA 1WW5A 4LKFA 1T6GC 2DUOA 3EHKA 5EHDA 3P3PA 4AVBA 2HWB3 1QKQA 3PMSA 1YFXA 1LEDA 2G19A 4AEDC 2Q1ZB 4U2AA 5FZCA 4AXOA 3U14A 4FBFA 3VBOC 1W6OB 2CWMA 3S6PA 1EAH1 1QJU2 2JDUA 5FMBA 3OOXA 3TEYA 1UF2C 3QLQA 4FXKB 4QU1A 3ZYPA 4CU9A 2RVAA 4XC9A 1RUI2 5FYVA 2BERA 1ZBA1 4RGGA 4GJYA 2VQ0A 3MIHA 3SQOA 3ZN6B 4BDVB 5A7SA 1SLLA 5GM0A 2WQ8A 2QVSB 3DV8A 1OXCA 1BEV1 5F8PA 3VZJA 3N9MA 1GOGA 1XE7A 2IWGB 2H6BA 3RNSA 4COZA 4WZFA 1CJPA 1FV3A 1OFNA 3CJXA 3K3OA 3KZ4C 3O1TA 3OGGA 1ZM1A 2J1UA 5T52A 5L19A 1J59A 1RUE1 3A7QA 3RI8A 4Y24A 5JOWA 1XQNA 1VMFA 1YLLA 5LA2A 1XB9A 2EAAA 1YEWA 4A3XA 3GZUC 1ZRRA 1V6NA 2E6VA 4K21A 5CFCC 3AKSA 5AC92 4HG6B 2RDRA 3FWEA 5CG9A 1HRI2 3GHNA 1GU3A 1UPIA 4H3WA 4W6WA 3N9NA 5EP9A 1ZZBA 3IMNA 3B9CA 1LENA 2ZS6B 4R9DA 2MEV1 2Y34A 4GQ7A 4Q4V2 5F5CA 5T54A 5DUVA 4HVQA 2V4AA 1ZZ7A 3RG0A 4JV4A 4MXVA 1B35B 2VVDA 3FC0A 4BU2A 4L11A 2RJKA 4GB32 3JBG3 5C3PA 3LFIA 4BHPA 1E5HA 2JD4A 3B01A 3K4AA 2VZUA 2ZKNA 1QQP3 4C0HA 3HN1A 4FOVA 5A32A 1VE0A 1NCRB 2FBEA 3ABZA 3BVCA 1JZ3A 4K40A 3LZZA 4Q4Y3 1UYZA 2ZMNA 1W8HA 2GSYA 2XMLA 3VZLA 4IV3B 5F7UA 4HKLA 4L97A 4QM9A 4ASMB 4HN0A 3QD6A 3MBWA 3PVBB 2R0HA 4WM8B 3S7IA 1H30A 3LEKA 4BPZA 3I3MA 5C9AC 3DYMA 1NA1C 1S55A 3NAPC 2VY0A 4Q26A 5BNOA 4CEYA 5CU1A 1ENQA 1NY71 4Q0QA 3SNMA 3KM5A 1QU0A 1W04A 3DYPA 5FP4A 4PDWC 1Y43B 2WN3A 2R1BA 3C7GA 3I97A 1ND3B 4XFGA 1V6JA 3CJIB 4AW7A 4N53A 4B1LA 5C8CA 5F1RA 3N7LA 3GZAA 3SXWA 2PQQA 5AFBA 1W2AX 1W8UA 4GWJA 1ENXA 1SLIA 1X8EA 2ATFA 5EJ1B 3VBSB 3WNPA 1OH4A 1WMFA 3PU3A 4NOTA 4Q4W3 5DN2A 1QOTA 2EF6A 1RUG3 2QQJA 3U78A 2PLV2 2XLFA 1JYVA 1H6XA 4UAPA 3HBKA 4YFWA 3DKQA 3P1IA 3ZSEA 3ZXAC 2VBBA 2IXHA 2LTNA 5L7OC 2XUMA 4C0BA 2GNTA 3BU7A 1N3QA 4XCAA 5AVAA 1KGYA 3PUHA 3KQ4B 2QZ3A 1N1YA 2VW2A 4QPGB 1XNAA 3V0AB 2K46A 1UAIA 5BNPC 3O1MA 4ORFA 2HWF2 2JXAA 2G9GA 1JODA 4OI1A 4XFHA 1A3KA 2MHFA 5GLUA 4W50A 4J1WA 1KQRA 3OBAA 4JTOA 2GC1A 2I2SA 2Y60A 3I2GA 4Q0UA 1PGL2 4SBVA 2WZR2 3AKRA 3RZJA 2ENRA 3S57A 4A7ZA 1O59A 1H0BA 2OT7A 1T6BX 3MGUA 4JGZC 4MH0E 4XTMA 2GH8A 3MUY1 2RS31 1MS9A 4B3NA 3AM2A 1HXS1 1NG0A 4YWAA 5JMOA 1LAJA 2E31A 1S0CA 5IHRA 4FFGA 5LB6A 2WLPA 1ASJ1 3FE5A 2O8OA 3IT8A 5C3QA 4CXWA 4N9IA 2HBUA 1ULEA 4LHSA 5ISLA 1MPXA 2EXKA 5A7NA 4YYOA 4LK6A 1VBB1 4NVPA 1J3RA 3FN9A 2X5IB 4K7JA 4IEQA 4YVSB 1FOD1 1GNZA 4Y1YA 4CDXC 3PUQA 1R082 2HWD2 1EPZA 2LRPA 3C7EA 4YARA 4AG4A 2K9ZA 1REFA 1PVC1 1W06A 1O8SA 2B9UA 4RS5B 2E63A 2PELA 3WZ1A 2R041 2VBDA 4CU6A 5JSRA 2IVJA 2JWPA 1BQPA 5FLJA 2BV4A 1DP0A 2P37A 2Y64A 1ZNPA 2D44A 5LBCA 4XF9A 3MIGA 4RN5A 2AR6A 3TWIA 2D7FA 2ZEXA 4QXHA 2A3XA 4XMIA 3TOJA 4CP9A 5FLHA 1LHNA 1ACCA 1F2NA 3WQ0A 1JZ7A 2BWAA 3WP6A 4QPIC 1LHVA 4QQ2A 4YM0A 4HZFA 3ZFGA 2YY1A 4JCKA 1XU1A 1EAH3 5GLVA 1MS5A 4D6QA 5ACA1 1OF3A 3BGAA 4IV1C 4QB6A 2ET7A 2GH2A 1YQ6A 1CIYA 1IKPA 2UY8A 2GN3A 1U0AA 4ISRA 2DYCA 1SCSA 3E5UA 3Q8BA 4XUNA 3VBRB 3BCWA 1BXHA 3CU7A 4MGYE 3OUJA 1H2MA 1GUIA 1SMVA 1YQ2A 4R52A 3I3BA 4KWJA 3ZOIA 2WINB 1BEV3 1NCQA 4XE9A 2WR9A 5I0TA 3KVAA 1DDLA 4Y1VA 1XJAA 1SQ4A 3MIDA 2YMZA 1V9U2 4META 3I2JA 2OA2A 2VNOA 4QDRA 2ZX2A 1W6PA 3EJKA 4XUTA 2BBAA 2IXKA 4QKFA 1OPMA 2D3PA 3ZFFA 4OUEA 1X82A 1AX2A 2WNOA 4CE8A 2PA7A 4EQVA 3Q9OA 2VGDA 3H1WA 2Z69A 3GXUA 2ZX3A 4X8PA 1RIRA 2WYSA 5FP8A 4MG2A 2EIEA 3OPZA 3KF3A 2EXHA 1HN1A 3QBQA 3VBUB 4IERA 2PHLA 1A6CA 3ZSJA 4ASKA 2RM22 4W65A 5FMCA 5CB7A 3T2QA 2VG9A 3O0VA 3GYDA 5LK7B 1AR83 2XWJB 1VRH2 4N7UA 4XFFA 2RS12 2FMDA 3FLPA 5L9VA 3ATGA 5FY4A 5FZ3A 2CGPA 1PO13 2R073 1GV9A 5BNNB 1RXGA 3O14A 4SLIA 1KFUL 4DNYA 2WKKA 4FOWA 2O1QA 3P3NA 1SACA 4UW4A 2IXLA 1MQTC 1RUF1 4B4PA 4PIYA 3KCXA 5A3NA 2R32A 5A32B 3PTYA 3MLLA 4MVTA 4CDUA 1R092 1YXWA 4E2GA 1RJ7A 2XPJA 1WLDA 2YC2A 2XVKA 3WX5A 2PHDA 4AVSA 5ABJB 2UYAA 1W3XA 4OI2A 4AI9A 2R6QA 3AZWA 4UF0A 2AREA 3QH7A 4EWAA 1ZRDA 1ZA4A 4Y1UA 1PNGA 2ZGUA 1A34A 3BODA 2RG4A 2WJSA 2Y6JA 1RJ8A 1M06G 5FFOC 3WNLA 4ZS2A 2DVDA 4E4HA 2VXJA 3K75B 4LHNA 2G9ZA 4N53B 5A1AA 4V2VA 3FLTA 4B4RA 4YLZA 2B39A 4DINB 2W52A 1PNFA 2TEPA 5LY1A 3ES4A 1M4WA 3ELNA 4H2AA 1SDDB 3VB9A 5JOYA 3ACIA 3VBFC 3WP4A 3J8F3 3WOGA 2DDUA 1UX7A 1YQ5A 2H0BA 5FP7A 2PHWA 1G9FA 1LB2A 3UETA 2VQTA 4P9IA 5DXDA 3VKLA 1MZ6A 1PO23 1UOGA 1LGCA 5A7WA 3NJYA 2Q8OA 4BQ4A 2YGMA 4QX3A 5FO7B 3DCQA 1XXNA 3H42B 2HEYF 2RS51 3PIGA 3VLBB 1GWLA 2XBO1 1JYNA 1DQ4A 2PYTA 3N3HA 3ZIWA 2A6YA 1XU2A 4Z2AA 3ZN4A 3JB8A 4AFMA 5JOXA 2OUHA 2JEMA 3ACLA 2VVEA 2YBSA 4Q2FA 1V0AA 1DFQA 1Y9MA 4KU8A 3WF3A 3VKMA 5L36A 2FD8A 4ZXKA 2EIGA 1OI6A 4P5HA 1QJX2 1JXNA 5IAVA 4F3JA 3H3UA 1FT9A 3AP6A 5JWPA 3OD4A 3LF7A 2R062 2ID4A 5FXVA 3BTXA 1Q8VA 1POV1 1HXS3 3QOPA 5HXVA 1A8DA 1CX1A 1UQXA 2VNGA 4XF4A 2BNMA 3T4VA 4CCMA 5JLVA 2J7MA 1XNBA 1ZBE3 3T2OA 4XQ4A 4N43A 2EIBA 4K1YA 4BLIA 1VBA2 5J09A 4AHYA 4C91A 1TQ5A 3LPGA 5D8AC 1IQAA 2WS92 3VKNA 4YGDA 3JD72 1VBB3 2ZGPA 5FQ0A 2BPA2 4M0HA 2DUQA 4DUVA 4RQPC 5LEKA 1JHNA 1RVF1 3UGHA 3VZMA 1COV1 1GMMA 4PLMA 1FOD3 2YB7A 3CQOA 2ZX4A 5GZCA 3CL1A 1CAUA 4AVCA 2D6OX 2AENA 1CZSA 4IW3A 5JR7B 4XIKA 4LNVA 4XUQA 1UY0A 2R043 2EXIA 4MXWA 2VC9A 3I3DA 3I2HA 2JECA 1BVVA 1JU4A 2ARCA 2VMCA 1XSQA 1RUJ3 4I02A 1EP0A 4QDQA 2WBKA 3THPA 1ENRA 1QDOA 2ZGLA 3O0XA 2JDHA 3AMQA 1JU3A 4IXLA 1VBE3 4L8QA 4AQ2A 4XQDA 4YGEA 3F2ZA 1AHSA 4Y22A 4CP9B 4ARXA 1AVBA 5ACA3 2IZWA 4YVWA 1OD5A 4K8FA 2EALA 2CHHA 2HWC1 2J42A 2WFF2 1KS4A 4OMDA 4CPBD 1RXFA 3IDCB 2VOKA 1WCDJ 3I3QA 4XDQA 3U37A 5IVYA 2E9QA 2GZWA 1AR62 1E5SA 2X10A 1LU2A 1JYCA 2ZAAA 4NAMA 5FY9A 1SLTA 2BFUL 3BOPA 4Y5Z0 3MPBA 1GR3A 1GWMA 3ZLIA 5KHJA 1J84A 1KDMA 3BTAA 3I2DA 2PHFA 2BRTA 2PHTA 1NCQB 4XF3A 1EV13 5A3WA 3LB9A 5KHKA 4ITCA 1UYXA 3WW1A 5C4WC 3R4SA 5H9SA 3VDDA 3LKJA 4RR3A 4Y20A 1E5IA 5E89A 3AVRA 2UURA 3WDUA 4NIGA 4D0QA 4GZ9A 4TLGA 2HKXA 1HW5A 4MGQA 5A1FA 4NPRA 4COVA 3TEWA 2ETEA 4CUBA 2NMNA 1UNBA 1VMHA 1DGWX 1Y7BA 4Q4X1 3TN91 1VBC1 4O9EA 2BEOA 3MPPG 2ORXA 4PLNA 4ZY9A 4EZHA 3VD9A 3DPRB 3H8RA 2FDFA 4UOJA 3FLRA 2IXIA 3QCWA 5FKCA 3GBWA 1Z7S2 4XZUG 1DHKB 1IG3A 5GJ6A 3ZYRA 1VB4A 4AQTA 2CSGA 4PHZA 2VULA 3E6BA 4FO9A 2Q8EA 1DLCA 2VMEA 1HRV3 3ORJA 1KITA 3OF1A 3UESA 1HX6A 1YHFA 5HV4A 1AR71 4CCLA 1S0DA 2ZKLA 1NZCA 3LSDA 1BBT1 2RHPA 4QHZA 1OHFA 1RUF3 5IFPA 2QQMA 2RMU1 1DZTA 2A6XA 1VBD2 5DG1A 5TSWA 5F5QA 1GZ9A 1ND2C 3OBTA 4PBPA 1EPWA 2DCJA 3BOWA 3LSEA 2CL2A 2GALA 5GLTA 2WIIB 5I0SA 4XBLA 2DCYA 2KM2A 4CDUB 1JYXA 1WA6X 4QB1A 5CADA 5EFUA 4JQRA 1IHMA 4J1XA 1FMD2 4MHUA 4RFT0 4GWIA 4AEDA 4AQSA 2WQ4A 2WT1A 2JE7A 1IS5A 3VBOA 3CZJA 4NN0A 5DUWA 4Q27A 1NXD1 1RUI1 1W9TA 5C71A 5FJHA 3VZKA 2C9AA 4C8DA 1AR91 2ILMA 4JDMA 1G86A 2E33A 2F17A 4OYUA 5ANNA 4ZHNA 3BYWA 4Q1PA 1T2XA 4D7TA 3A22A 1WMDA 3HN3A 3BN6A 2JE8A 4MX3A 4Q0VA 1UWWA 4MHRA 1BKZA 4YZ3A 5H9RA 3W9AA 4E9KA 1RMU2 5M0TA 1HB1A 3B00A 1POQA 3ZR6A 2D93A 1QIQA 4M01A 2A6WA 4Y3OA 4COWA 1RUC2 4LBKA 1H8TA 1W6QA 4E8DA 4UFIA 5EWSA 5SV8A 1ST8A 3RVHA 5LWBA 4I0BA 5IK4A 2BDRA 2D43A 2DBIA 1DGWA 2GAUA 3KT1A 5FXZA 2D40A 2RS53 5FZHA 2XBO3 2DCZA 5FMOL 1HKDA 4TTGA 1SCRA 2YU2A 5A7WB 2HEVF 3OBZA 1KXGA 5FMDA 5AC91 3K4ZA 4KWKA 3H8UA 5E88A 4OQ9A 1H8VA 4DXSA 5CFCA 3V64A 1W2TA 4K8RB 4CDQC 2WNVA 1ZZ8A 2W87A 1H9WA 3ZSKA 1CZTA 3VN4A 5DZGA 4YW1A 5CBLA 1WCKA 3N9LA 3GZEA 4Q4V1 1N1VA 4EN8B 2QDRA 3M2MA 1UU6A 2YG0A 4LEJA 1MZEA 1WW4A 4O9GA 2PQSA 3U10A 2D6MA 1DQ2A 2RR11 4A7KA 2J1TA 2GMEA 1ENSA 1W99A 2VTXA 2WUHA 1POV3 1ZYBA 3LA2A 3AJYA 4KG0A 5FDBA 2JDYA 3C7OA 4IGOA 4WM7C 2ZEYA 4UW3A 3VHRA 1DYKA 1O5LA 1W8WA 4XF0A 1RHI2 3U1XA 1POV0 3WDVA 4R4XA 2BZDA 2ZMKA 3BALA 4CEWC 5CFDC 4YPJA 1I9RA 3JCIA 4NHMA 5I8SA 1X36A 5IATA 3S0MA 4N43B 1N1SA 4KMQA 4BB3A 1C4RA 5J36A 4XJAA 1RVF3 1YNAA 4LIUA 1COV3 2ZPXA 4QPWA 3AZYA 5C9AA 1YYNA 1OLRA 2D5FA 1QHDA 2WA4A 4MGZE 3NAPA 5FQ0B 4XBQA 2WO7A 4AF9A 2AZ5A 2D97A 2LW8A 3RZZA 1TE1B 4FCAA 3N7MA 5B4NA 4IEYA 2R30A 2B5HA 4PDWA 1CAUB 2WNUB 4FI9A 4XCBA 2A75A 1GYKA 3AYEA 4E27A 1PGW2 2JDZA 1IS3A 4MXWB 2VMDA 3A4UA 5FV3A 4NHKA 4Y1ZA 4A2UA 4XJWA 5SV5A 1JZ8A 3WG3A 3IAQA 5F9TA 1ONAA 1D0GA 3A21A 2ZACA 1ZRIA 4LHKA 4CYDA 2JDNA 4LKSA 4KBZA 2P3IA 2HWC3 3DECA 4L2NA 3ZXFA 3NNFA 2XKOA 2D5HA 2JG8C 3RMYA 1VALA 2OYZA 3RYRA 1YC61 5FZ1A 1F35A 5EJZB 2SBAA 3ZX7A 1TMF2 1DZQA 5L7OA 1FXZA 2FZ1A 1UY4A 4C90A 1OT5A 3ZYFA 4HT1T 3MIFA 3NQHA 2HWF1 5FYUA 2N7GA 5F5AA 1NLRA 1B09A 1QGLA 2VZVA 4LBOA 4OUMA 4BWOA 2IXJA 5BNPA 4XEZA 3AMPA 3WDTA 1UMIA 1J3QA 5J37A 5FYZA 1Y4WA 3R0RA 3DGTA 1S0IA 4QDSA 4RL7A 2WA3A 3R4DB 2A73B 4RR3B 3CBNA 4Y20B 3FBYA 3AXDA 4QX0A 4XVHA 4Q5OA 4QHBA 3V0BA 2OX0A 2HWB2 3SEPA 3TN93 1VBC3 3KS7A 2Y6KA 4P9XA 3RJ2X 5FKBA 3IDAA 1JOPA 3C3VA 2JIGA 2FZ2A 5DAPA 2B46X 4XJUA 1QMJA 4XJ8A 4HONA 4P08A 5L9RA 3WQ7A 3KV5A 1SFYA 1HJGA 5FAXA 1JUHA 4UT5A 2IXCA 3IAPA 2R49A 4BQXA 2VZRA 3AKQA 1G6NA 5D21A 1ULFA 3ZXLA 1NQDA 2R16A 2VR4A 1R081 4KU7A 2GP5A 1BBT3 1F4AA 1OQ1A 4XXPA 3ZXDA 4P00B 4D3WA 2RMU3 1YO8A 1H4HA 3ZDVA 4BJ0A 4XFBA 3VDAA 2P5BA 5JZGC 4FQZA 1C8M2 3D0SA 3PNAA 3W58A 2PXJA 2C9KA 3W20A 1PM4A 2IFRA 1BJQA 1PK6C 2D6PA 4XFAA 2OZJA 3KF5A 2CV6A 4LO6B 4QX2A 3FUQA 4LUKA 5C7GA 2CU5A 3ME2A 3ROUA 1YFUA 1UZZA 3E6DA 1OURA 4WVMB 1YUDA 4XBNA 3MUZ1 3I54A 1CR7A 2F4PA 3GALA 4GULA 5KC6A 2CWSA 3PU8A 3AYDA 5BPXA 3OEBA 1GKBA 3VBOB 3KGZA 1AR93 3T0BA 3IMMA 5FZ8A 1AL23 3E5QA 2JDMA 2V09A 2WC2A 3JBG2 3KCCA 4KGGA 1NE6A 4IV3C 5GZFA 5LA9A 3I2OA 2C26A 3FZ3A 5FPVA 4CVUA 4WM8C 3HVDA 1UO9A 1V9U1 1QJY1 4Q4Y2 5C8CB 2Q1FA 4LOSA 2ZXQA 1OOPA 3WD5A 5FOJB 1MEC1 2G1MA 1QWRA 3IZOA 4I2OA 4QQOA 5F37A 1H8TB 1W6QB 2PTMA 3J26N 4RA0A 3IKWA 1ULCA 2YDEA 1RTVA 1NT0A 1ND3C 3NKGA 3T0DA 4GWMA 4QGNA 1XNKA 3HMYA 4N90A 3CJIC 4YG3A 4FOYA 2CY6A 4JRAA 1NLSA 4XILA 1JBCA 3NNMA 4X8NA 1O3SA 1SHWB 1PGSA 1WLTA 4PQQA 4PBOA 1NAEA 1CAXA 1QEXA 2P6CA 4P9GA 2WFPA 4Q4V3 2RM21 1MS4A 4YM2A 4EN9B 4IETA 5CFCB 3RJRA 1N3OA 5FCCA 2XDVA 1OA3A 2WNVB 5KXDA 2QBXA 2RJLA 1X9PA 4IE4A 2RR13 3MHZA 2X05A 2QQPA 1NXMA 4MO3M 4XZPA 3WT3A 1PZ9A 4Q4W2 5JIAA 2QQNA 3ZN5A 1D0HA 3AC0A 3ITQA 5FYIA 1UZ0A 4GAZA 1S1AA 1RUG2 3A23A 4LHLA 4RHV1 1W2OA 4AFBA 2ZGMA 4QPGC 3AZVA 3R4UA 1DG6A 2VTXJ 2Y6LA 2YUEA 1FPN1 1G8WA 2WAAA 5A70A 3JZVA 1HV0A 4QQHA 3AMNA 1LR5A 4YW2A 3K2OA 3JXSA 2JDPA 3ZYIB 1VB2A 1HB4A 4I01A 1JI6A 3WW3A 4PIZA 3CNAA 3KHBA 5IFTA 3ZMOA 1KDKA 2A1XA 4H14A 2BWCA 1HN0A 2WABA 3ES1A 3AP9A 3NAPB 2HYKA 4XF1A 5FUNA 3THTA 2CTVA 2VUJA 3NNGA 1UOJA 2A71A 2NP0A 4B8EA 3H3ZA 1PX4A 3VD7A 2AUYA 3DYOA 2VUCA 3JU9A 4PCRA 3PUSA 4CCNA 3O1OA 2FCVA 4ASLA 3FUOA 4MGTA 2P1BA 4MGKE 4PQ9A 1OLQA 4OI0A 3NJVA 2VZPA 1AX0A 4F8AA 4K3UA 4NPMA 4CCJA 2VMIA 2DURA 3EQEA 2IFWA 1YQCA 1UOFA 2ORZA 5F6KA 1CJDA 2VW0A 4E2SA 1UYPA 2HWE1 3H0OA 1MVQA 3RZLA 1RUD1 1RGSA 3I8TA 3GCXA 1W8NA 3R05A 4XQWA 3KV9A 3T1MA 1IPSA 2W47A 2YBKA 4RS5C 3I59A 5FYHA 2G4IA 5GZDA 5K0UC 2X29A 3M3OA 2A7AA 2HWF3 1W6MA 1PVXA 1L3JA 4W6YA 3LDRA 2B9VA 4GKXA 3SKJE 1WBLA 2PAKA 4AEJA 1QXJA 4YZ2A 3OJBA 5JVVA 1QJX1 3LDBA 4QX5A 1D4M3 2ERFA 5BNPB 2Z4FA 2FDKA 3B94A 1UZYA 2FHRA 2FMYA 2Q30A 4BZ4A 2GMPA 3N9QA 2E26A 4OLLA 4QGLA 4Z2WA 1GOFA 2WT0A 4IEWA 2GP3A 4TXWA 2JE9A 2ZX1A 4KGQA 1LNSA 1MS0A 1W8TA 3VBRC 1P8JA 4I09A 4JDOA 5IVJA 4QKBA 3V0BB 1ZREA 2WWJA 4LKDA 1V70A 4EE2A 3GHMA 4AHZA 1VPHA 3AKPA 3FJSA 1J83A 5DAVA 1VBA1 1G9CA 3O1PA 4XABA 3WDYA 1VMJA 3Q8AA 3USUA 1MACA 1OA2A 2P3YA 1QY4A 4IESA 4DEQA 4HK9A 4LO8A 4EN6B 1LOFC 3ILNA 5D8AA 1CZVA 1URXA 2GC3A 2ZGTA 3O0WA 2ZGNA 3WCSA 1OUXA 1RITA 1ZBA3 1X9TA 4RQPA 1JH5A 2UU8A 4G4FA 2ZABA 1R083 4DB5A 2ZEZA 1VAKA 2RDSA 2DWRA 2ZGQA 3L2YA 5GZEA 1OD3A 3U4XA 3PJQA 3U75A 3AZXA 4LXLA 3ZSMA 4AGVA 4P14A 1W2UA 1WD4A 3VBUC 1SPPA 2Q5TA 1C5HA 4HANA 2IVIB 5J98B 2ZHLA 1RUE3 4QGMA 2Y26A 2VE1A 3VDBA 4FFFA 1MZ5A 3KMHA 3LIHA 1N47A 4LTAA 1HJFA 4ISQA 4N9HA 4QXCA 1WLWA 3LWCA 3RYPA 4DO0A 1W2NA 2EAKA 4LBQD 5DDJ1 4AEKA 4C1WA 4NHYA 3E5XA 3KWVA 5A1LA 5BNNC 2VO5A 5K9YA 2BQPA 5A6XA 4PI0A 4ZPIA 2XJPA 4XHXA 3ZYJB 1QOSA 2O14A 3M4FA 1AR82 1DLLA 4JKLA 4K20A 4LO5B 4R8HA 2QJVA 5FYSA 1UU4A 3D82A 3O1RA 2MEV3 3HBZA 5FTTC 1SZBA 1S0JA 4IDZA 5LASA 3U4SA 3UKTA 5KWRA 1PO12 2R072 4XW3A 4LLFA 4M4RA 4ATEA 3ACHA 3HAGA 3GBGA 2LUWA 4HL0A 1QNYA 4L0PA 5LK5A 1QJY3 1DQ6A 2JKXA 2JG9A 4U36A 4QWNA 1LGBA 1AYM2 1MEC3 2PMWB 4UW6A 3AFKA 4ZU4A 5FYBA 3POJA 3LAGA 3SLIA 4AFDA 1OPOA 5B4XA 4TLFA 4M3CA 2DU1A 2VW1A 1OOPB 5C4WA 3SHRA 2XJSA 1X33A 4OHYA 1V6KA 3KQRA 5DAXA 3C7HA 1DQ0A 2Y0IA 4HFSA 1FI2A 1MZFA 3D0JA 4MGSA 3WNNA 1WCUA 4A44A 3N36A 4HKOA 5FZLA 3NJZA 3PUAA 4R9BA 1QJZA 2WQZC 1VP6A 2J1RA 3U11A 3RPQA 4DPNA 3ASIA 4N53C 2I74A 1CPNA 4IGPA 4XJZA 2VOWA 5F2SA 2FDHA 5K8SA 1Z7S1 1CAXB 5BNOB 1J1LA 4BM8A 1QOOA 4CEYB 1JZ6A 5CA6A 3GDBA 3RFRA 3RRDA 1UPSA 5I8YA 3V65A 4D69A 1NKGA 4LBQA 4UYBA 2QQLA 3UKVA 3WW4A 4AI8A 5FZ6A 2EIDA 4CSWA 1C1FA 3MFAA 1TVGA 4ZXEA 2E32A 3OB8A 4CCKA 4DQAA 2ZJCA 5J3UA 4RHV3 3J8F2 2D3RA 1HDKA 5CIRA 3PJYA 3POFA 1ULPA 4XHBA 5FZBA 2XHKA 3I2KA 5H9PA 4B29A 3EBRA 1FPN3 2QKDA 1S0FA 1PO22 1WUVA 4IQPA 3SISA 1AF9A 5AVPA 3ACGA 2VECA 3N7JA 2X09A 1JOBA 3AYAA 3CZUA 2J1VA 3FFQA 4AOCA 2C0ZA 4Z8BA 4NWWA 3WNMA 1QJFA 2YFUA 4QAWA 1DGLA 3P6BA 4QD2A 5FY8A 1DGRN 4NO4A 2IUWA 3N9OA 1F9KA 1UL9A 1YWKA 2B42B 4MSVA 3ZXJA 2K0GA 1OA4A 2GNDA 2RV9A 4FPEA 4UFMA 3N35A 5KXEA 1TME1 3TAYA 3TEXA 2YYOA 1HXS2 3UKNA 4BQWA 5A3MA 4TZDA 5JAXA 2WO1A 2PHXA 2CYFA 2C4XA 2VD7A 2RS33 1ZBE2 2W68A 3K46A 2HWE3 1SLAA 4YNIA 1ULOA 3O5SA 4NRMA 4UFHA 1RUD3 4H7LA 2HYXA 1ASJ3 3HOBA 4CA9A 4HSJA 4A42A 1KJLA 1VBB2 3MEPA 1STMA 5E16A 1I5ZA 1ULGA 4LT5A 1FOD2 1VIWB 3FFZA 1Y3TA 5GZGA 3I59B 2WO2A 3WCRA 1UMHA 2WRAA 4FPJA 4FPYA 5IVFA 2XJRA 2NYYA 1K5MC 3EYPA 3POEA 4CDQA 1W6MB 5JCTA 1DYOA 2XHNA 1K42A 3FL7A 2G9FA 4HMZA 4INDA 1FAYA 1RUJ2 1AYN2 3AL6A 1PVC3 4HLTA 4QPYA 4K9SA 1O3TA 2ARBA 1EUTA 1H2LA 2Z79A 3NVCA 3Q8FA 5F3GA 1BMV1 1VBE2 1WCQA 2VZSA 4QB2A 3AZZA 3WR0A 5C3OA 1K45A 1R1A2 3ZPYA 2WZ8A 1LHOA 5LRRA 4DRRA 5ACA2 1OVSA 3UV9A 3O7OA 3H50A 4AWDA 1YI9A 1YQ8A 2E53A 1R64A 3T08A 1US3A 4XOGA 4YZ5A 1Z78A 4ES8A 2YV8A 4RFRB 3KSCA 4WVVA 2QNKA 3HEIA 4J25A 4XFCA 4CEWA 4IEOA 2YROA 5FR3A 2TNFA 1NYWA 3OPTA 4R9CA 2QQUA 5FRAA 2VQUA 4FP2A 5CFDA 2W94A 1S0GA 3MV11 1NCQC 1LESA 3ZFGB 3USUB 4IE5A 2ZCWA 2JJ6A 3POYA 4OUSA 2WNEA 4E4ZA 5CYYA 1GZCA 4YFZA 1IZ3A 3VV1A 2F4LA 4Y4YA 2QQVA 1OFSA 1FNZA 2OPWA 4BXSV 5JXGA 1VLNA 1EV12 5FWEA 2XJQA 5LEJA 1OQDA 3JQWA 2IC1A 4KL1A 4M3CE 5DPNA 3RSJA 4CTEA 3BTYA 1I3HA 2AYHA 4YRDA 4AVVA 4XUPA 1JOJA 1U5YA 1PGW1 4CCOA 4DXRA 2AACA 2W92A 3DPRC 4UBHA 3IIAA 3MIEA 3J7NA 5F39A 1SPPB 1IQDC 2ZZJA 5C5TA 4BE3A 1W6PB 2UWCA 4UBGA 3WP5A 5J48A 3NV3A 5JSOA 5DDJ3 5T55A 5L73A 3ZFFB 5K7PA 5T50A 4FPLA 4K6BA 2WT2A 3ZXEA 2XL7A 2Z2SB 3BI3A 4CDWC 2JG8A 1ALYA 2WLQA 5DQ0A 1VRBA 3UL2A 3AP4A 2NMOA 2PHUA 1TZOA 2P3KA 4YZ4A 1C3HA 2XLGA 5JXHA 5C3SA 1HRV2 3K51A 4V2WA 2EXJA 5FZ9A 4M4PA 3VKFC 4Q1RA 1NLQA 3G6JB 1NZIA 3NNLA 4KBBA 4EWDA 2ZTNA 5FY7A 2VOTA 4DMIA 1HV1A 2BVVA 2VVFA 3B9IA 3FHQA 3M1HA 4FPCA 4IUGA 3WG1A 4TYSA 1QXRA 4QMAA 1RUF2 4AAXA 2DVBA 4TN7A 4CPBA 1DYPA 4H7MA 1WGPA 5JIUA 2XLAA 2Y6FA 2JG9B 2LALA 3JQXA 5GLWA 4AI0A 3JB4C 4XPVA 1PIV1 3LD8A 4YSFA 5IYYA 4FTBA 2DBNA 4M3CB 4HPKA 1W90A 1DBNA 3WUDA 2BJSA 4GIQA 4FTSA 4AVAA 4Q8LA 2XONA 2YGLA 4D7YA 5D1IA 3D3AA 5FLIA 5FZIA 3ENRA 3CMGA 1IKQA 1GNHA 5F2WA 2MNGA 1WCSA 2ZGSA 1O4YA 1QJU1 1RINA 2P6HA 3ON7A 3G7DA 1V6IA 4YW3A 3LEIA 1YIPA 2XJUA 4AR2A 4UF0B 4QQPA 5DABA 2DVGA 1QH7A 3LA7A 2NQYA 1LOCA 1S2KA 4S2DA 4XDPA 5LBEA 3VD3A 2CGOA 4BQ1A 4FFIA 5LA0A 2XH6A 1CQ9A 2BGPA 3NSTA 2L9LA 1OF4A 2GDFA 3NNJA 4CXYA 4F7ZA 1ODNA 3ETPA 1Q3EA 3NRUA 2H6CA 4XDOA 2ARXA 5T5PA 1C8M1 1NQJA 4OI4A 1APNA 2A6VA 4M00A 5JZGA 5BV6A 1W6NA 2J1EA 1D2SA 2RS52 2XBO2 3DXTA 3GJAA 3SCFA 3ZFEC 5JI9A 1GQGA 1UU5A 1GANA 1PK6A 3SEEA 3LPFA 5F3EA 5FXWA 3M7AA 2E51A 2SLIA 4HN1A 4LA2A 4WVWA 3WNXA 5E8AA 1IPJA 3DN7A 5A33A 4AK3A 2UWBA 3PVEA 5IWFA 2LROA 4BOWA 2E7TA 2CAVA 3SKVA 1HRI1 1XNDA 2JDKA 2K2SA 5KXCA 4AVTA 1VAMA 4JGYC 4QKNA 3BTZA 2CDPA 2O0OA 4RD7A 3SH3A 1AUYA 5FUIA 1TME3 1CAVA 3JBG1 3J7LA 1LEMA 4AQ6A 3B5LB 4BCUA 4URAA 3RZHA 3VBHC 2HBTA 5HI0A 2CGNA 1W0PA 4EN0A 4LBMA 4N43C 3LOBA 1XE0A 2VNVA 4GB31 4MLOA 5C3RA 4Q4Y1 2YPJA 5FO9B 1KEXA 4HK8A 1QF3A 4WM8A 4LBNA 3UGGA 2H0VA 4A7YA 5FMOS 1V00A 1WBFA 4O61A 5CAZA 1LECA 1PZ7A 1ZA7A 2DVFA 1L7QA 1RVF2 1DZRA 1COV2 2V72A 2WAOA 2WNUC 3IWZA 3L2HA 3ZPOA 5JDBA 1ZRCA 1GLHA 1W0NA 5JPNB 4FSJA 1OBNA 4IEUA 5LCWL 2VQAA 4YW6A 2XQRA 4HVRA 4ES9A 4KWLA 1UYYA 4FPKA 2J1AA 4E4SA 2B45X 3QACA 1NA1A 4PIXA 2YU1A 2BOIA 3OUHA 3VDCA 1BHGA 2VMHA 4KNCA 4CDQB 3AP5A 2ET1A 2J22A 1S0EA 2JICA 3KCYA 3WF0A 4GXLA 3MF6A 4AGRA 2XXZA 5J1XA 2HWC2 1RUG1 2JENA 3MLJA 3C2UA 1OKOA 1W3VA 1PM7A 4NJ4A 3T30A 5IK5A 3LEGA 1S2EA 3VZNA 1AX1A 1SG3A 4QPGA 4UFLA 3V0AA 1GNYA 2I07B 4Y5SA 4CP2A 1JZ5A 2PLV1 1XPWA 3LEMA 4Y22B 3U07A 1IGOA 1WZXA 3M3CA 4LIVA 4QXKA 2W1UA 4GH4C 5DZEA 4YVWB 3T1LA 3ZMNA 1LJ7A 2AGSA 2ZMLA 1JS9A 4CEWB 5CFDB 4IL7A 3J4UH 2VJXA 1LOAA 1SBEA 3NV4A 4XACA 4BK5A 3ZDSA 4CCCA 4DUXA 5T5LA 5BY5A 3VL8A 5JSPA 4NR1A 4KH9A 5IVCA 1F5JA 4UFKA 1QJEA 1U5ZA 1U5XA 1HB2A 4OZOA 2XB6C 1VAVA 4O65A 5I93A 3OCPA 5F3CA 3ZKUA 2CDOA 5A80A 1RUH2 1PGL1 2VCAA 2WZR1 1GICA 3MICA 3TN92 1VBC2 2XG3A 3VDDB 2DV9A 2J1SA 5BUVA 4QM8A 5EYYA 3WINE 4JGZA 4WV8A 5FXXA 4Q4X3 4COUA 3NV2A 1AXKA 5FZKA 1Y9GA 1EUUA 1R1ZA 4LBJA 1I6XA 5KXBA 2Q8DA 2D6NA 5GALA 3BB6A 4YW7A 1GQHA 2JG8B 5IVBA 3PVNA 4Y26A 3ETQA 1O4ZA 3AFGA 1S0BA 4AGGA 4I0AA 1L7LA 3SCGA 5K0UA 1MR5A 1BBT2 3PL0A 4I3PA 4NROA 4J6GA 4P9WA 3LDKA 2WSVA 3KD4A 5EQUA 2RMU2 3OPWA 2XKPA 3GBFA 2JX9A 4H55A 3AP7A 2WL1A 1BYHA 4BXFA 1AR73 2HWD1 3KT7A 2C1FA 4CDXA 1QH6A 1PIV3 1XYOA 2VOXA 3Q8EA 1HQNA 4NAOA 1OMIA 1JHJA 4YZ1A 1J1TA 3T2PA 1K12A 2NPIA 4FT8A 3NO8A 4LUMA 2FDGA 3CHXA 3PVOA 5E6HA 3HQUA 5D2AA 2GNBA 5T5OA 2W9XA 4HPKB 3MI8A 5ANQA 2VU9A 1Y9QA 1K3IA 4O7XA 4LE3A 2YXSA 3VBRA 4CUCA 1KD7A 4EROA 4GWNA 2KA3A 4DXTA 4V1PA 4NIAA 5IJRA 4JTNA 1QJU3 2VCCA 3OD0A 4QPIA 2UWAA 1B35C 3HT2A 5CISA 1AR92 3ST7A 5C6CA 5C8CC 1AL22 4PI2A 4IV1A 2XL9A 2UY9A 4AEDB 1RUI3 4N7IA 1LOFA 4CCEA 4D8MA 4LR4A 4OULA 2BOJA 2GU9A 1WWYA 3ZYGA 5JOZA 3IB3A 4XURA 1NCRC 3DUIA 4LOTA 1H8TC 5FBZA 5HCFA 4CU7A 3ZIXA 3C7FA 1MS3A 4BQYA 1YFWA 1JTZX 2V73A 5I0RA 1QQP2 2YFZA 1U12A 2Q8CA 5A6QA 1C8M3 1PX3A 3P5BA 4FP3A 4MZUA 5A3OA 4NRQA 4QT6A 3VBUA 2YC0A 4AEMA 4M3CF 1H4GA 4Y1XA 5JZGB 3I7DA 4QQLA 5EPAA 1W6NB 2WNVC 5FYCA 3WSOA 2DVAA 2VNRA 3ZYHA 2WZEA 3MFCA 3M70A 4JRLA 3NW4A 3BUCA 4EYUA 3NJXA 3ZM8A 4BH9A 1PK6B 2JB8A 1RYYA 3VHOA 2WSUA 4EZ4A 5AC93 5FYMA 1WA4A 1Q5OA 1HRI3 4Q8KA 4MOAA 2Z42A 5A33B 1ZZ9A 4IE0A 2ZX0A 1AR81 5BNNA 3PLQA 3TB0A 2RR12 3Q8CA 2AEZA 3APBA 3VBSC 4EWEA 5I91A 5FK7A 1PO11 2A3WA 2R071 3VHNA 5IVEA 1GBGA 2A70A 1V6LA 2RDQA 2ZGRA 1SDWA 1VRH1 4FFHA 5FPUA 2RS11 1W8ZA 3H7JA 5FZMA 1CAVB 3WF1A 4AFCA 3O1VA 4GB33 3BIEA 3RZKA 3W21A 5T5JA 4DZGA 1AYM1 1WLCA 4G3YC 3HNBM 3T2TA 5FO8B 4K1ZA 4GJZA 1Q8PA 3B93A 5F5IA 3GM8A 2DFBA 3CKHA 4WBBA 5KHHA 1XC6A 2B7YA 4XFIA 5GLZA 2VMFA 1Q8SA 1F5FA 3HIFA 2V4VA 1MQTA 1R091 1CWPA 5LRSA 2VH9A 1DCSA 4BIOA 1QDCA 4ZU5A 4NIDA 1YIFA 4LPLA 1JW6A 3VD5A 4COYA 1IG0A 2FCTA 3H1MA 4IGQA 2JKBA 5FZEA 3RQ0A 4AI1A 2VMGA 3FX3A 3VUOA 2PAEA 1O6UA 2F6BA 3MW2A 3VGIA 3POSA 5C9AB 1DQ1A 1NA1B 1BLZA 4HKWA 5FP9A 3THDA 3FHAA 3RGBA 2EVXA 2PFWA 2OZ6A 3EXUA 3KV4A 1PMIA
chains in the Genus database with same CATH topology
1YFYA 4PDWB 3M3QA 3ZSLA 3J8F1 2OIIA 1XE8A 4LBLA 1CN1A 2DFCA 3RS6A 4BYYA 1PO21 1J58A 2PLV3 2Z5WA 4FPGA 4IEVA 1LHUA 4S2GA 2X5IC 2PHRA 3VBFA 2AH2A 1SEFA 2VXRA 4YVSC 4CP1A 3B02A 3IPVA 1DU3D 1F8VA 1CD3G 1BCXA 1UKGA 3CLPA 3GF6A 2Q0AA 1HQWA 1LRHA 2BTVC 3E97A 5L7OB 3KGLA 3SH5A 1G9BA 3HWJA 1D4M2 3HR9A 3ILFA 1BVP1 5EJ3A 3H7YA 2BW8A 5C8WA 4X6RB 3WG4A 4IEPA 4BLJA 3BPZA 1QNWA 5HBAA 4IEXA 4JAAA 2WZR3 4FXGB 1S2BA 1YJLA 1Q43A 2R061 4YGBA 2ZBJA 3B7MA 1IS4A 1LGNA 1ZBE1 4CP0A 1XYPA 2BNOA 3TNQA 1Z0HA 1EAH2 4D7SA 4JGZB 4LA3A 3R6SA 1H2KA 2CNAA 1HQLA 1RL3A 1W0OA 3OGJA 1AJOA 5HCBA 3MDPA 4OHWA 1ZBA2 4XETA 2E7QA 2WS91 4B4QA 3JD71 2Y0OA 4PJYA 3LA3A 1VJ2A 4HSLA 1WW6A 5BXXA 1WW7A 2CAUA 1BEV2 5K0UB 1YI7A 3POWA 1K5MA 2HWD3 1BK1A 4DY5A 1GZWA 1RUJ1 1AYN1 1TNFA 3TBDA 4ATFA 1MS8A 3INAA 1VBE1 1YRZA 4LE4A 1RUE2 4CDXB 3D6EA 2ZGKA 1R1A1 4W6XA 1W39A 1LTEA 5KBFA 1DIWA 5BNQA 2VPVA 5CG8A 1E57A 3MF9A 3AX4A 5DUUA 1LOEA 4AE2A 4MYEA 3WDWA 2WFF1 1X7NA 4F83A 1XYNA 2MEV2 2QFEA 3RMXA 4DRVA 4QPIB 1C5IA 1C28A 4FPFA 1TEIA 5AFEA 2UYBA 1AR61 2MPFA 5FOBB 4IV1B 1OOPC 1QJY2 1ZX5A 1EV11 3AMMA 3HQXA 3AYCA 4AFAA 1MEC2 1PZ8A 2GC2A 1MVEA 3RI9A 5EYXA 4Z1VA 1V9U3 4MUVA 3I4IA 2ZAHA 1CONA 3DL3A 3W59A 5ABJC 3DKWA 3WDXA 3MYXA 1O91A 1SLCA 3DPRA 1RB8G 5BNOC 3TRSB 4CEYC 5B2GB 1SFNA 1NY72 1G9DA 4ZKTB 5KHIA 1YJKA 1CGPA 4P9YA 3WQ1A 1F31A 1LKNA 4CDWA 1TNRA 2RM23 2NN8A 2GMMA 1O4TA 4Z07A 1HRV1 3D4KA 4EN7B 1N1TA 1VRH3 2RS13 2BBVA 3AMHA 1C57A 4RHV2 2E7AA 1AYM3 2WWSA 3WHUA 1Q8OA 4MV2A 3ZO0B 2DCTA 3VL9A 1FPN2 4OZXA 4Z92B 3BIWE 1KFXL 2OVUA 4AHXA 3H9AA 2FQPA 1VBD1 1R093 2BUKA 2ZOEB 1ND2A 1UIKA 4R9AA 1MQTB 1BZWA 4YG0A 4NHLA 1CIWA 3FBMA 3D8CA 1FMD1 1ZZCA 3IN9A 4BMBA 1KS5A 1LOGA 3ZXKA 1IPKA 3SCHA 3HT1A 1C8NA 3WHTA 5F6LB 4I3GA 5DZFA 3B3QE 5JI7A 1O7FA 2RS32 1CAWA 4E4DX 2HWE2 3MLKA 3NWKA 4C1XA 1ULDA 1FATA 1CX4A 3IDBB 3WVJA 4IEZA 1RUD2 1OKQA 1RMU1 1ASJ2 2P2KA 3AK0A 3MW4A 4YW4A 2YZ4A 1RUC1 4ONUA 3S7EA 4FOQA 2PN5A 1AXZA 2EA7A 5I0UA 4PLOA 3ZFEA 2HJIA 2XVLA 4AI2A 2W39A 4FVVA 3M8LA 3VBFB 2P17A 2A6ZA 2NM1A 2QDNA 4Q0SA 4E2QA 3IPVB 3AKTA 4YG6A 3OBRA 4CRQA 1RC6A 1PVC2 1XNCA 1DF0A 1KJRA 3B69A 4FPOB 2OW4A 2R042 1QJX3 3LCPA 4JGYA 1IS6A 4L92A 4LO7A 4YM1A 4P9JA 4JDNA 5EZWA 3HD8B 1G9AA 2W08A 2R063 2DCKA 5IUQA 3VBHA 4GMP1 4OVEA 3ZFGC 2OPKA 2DUPA 3V56A 5T3NA 4DOUA 5KC5A 2BYVE 5FPZA 4WM7A 1RHI1 2ZHNA 3ZXGA 1VBA3 1Q56A 3OY8A 1UCXA 2WS93 3PHMA 3WW2A 2WNUA 3JD73 4GKYA 4DFSA 1NOVA 1WD3A 1AJKA 3QH6A 5DUXA 5EXOA 1FYUA 4RSUA 3OYWA 2C5DA 5D8AB 1AYN3 4HVOA 1JN2P 4L9BA 4RQPB 4P9LA 3ZFFC 1K5MB 2QUOA 2B8MA 4TWTA 2PAMA 1GZWB 2RE9A 4BMEA 1R1A3 3K48A 4XMAA 3LOIA 1IOAA 4KG8A 5JPMB 5DDJ2 5BYNA 1LODA 2ES3A 1D2QA 4FPHA 1EY2A 1X50A 3JUUA 1V6OA 3WUCA 2GC0A 2WFF3 4I0WB 1UW8A 1DGRA 4Q0PA 4DY3A 1UMZA 1JYIA 1JUIA 4AI3A 3A0NA 1TMF1 2LM3A 1AR63 2BFUS 2JG9C 4GH4A 2WZPP 4I30A 1H9PA 1LOBA 2BNNA 2HEWF 3MIBA 4B7EA 1WMEA 1HLCA 1C1LA 2A3YA 1V6MA 4LULA 1O3QA 4XXAA 2R1DA 1H2NA 4CDUC 2W0XA 5E1RA 1UN1A 4WZCA 3E6CC 1RUH1 4FQ4A 2DU0A 3PMEA 2OUJA 4HETA 4JVAA 2ZGOA 1W6OA 4BA6A 5C4WB 3IDEA 1QXPA 2HWB1 4XYXA 3X29B 2ZA9A 3J9SA 1D4VB 3EO6A 3L9JT 3WG2A 3FHIB 3SH4A 3ZVXA 1REEA 3MW3A 3WLUA 1SBFA 2D6KA 3AB0A 3VHPA 3ZN6A 1Z7S3 2TUNA 4CDWB 5C33A 4TSVA 4EV0A 5EV7A 2Y38A 5IK7A 1KRIA 1HIXA 1MS1A 3NV1A 3RDIA 1GSLA 2VUAA 4LBQB 4LO4B 1O3RA 2V5YA 3S30A 2XGXA 1GFF2 4URTA 3WP3A 2BGCA 1VBD3 3GNEA 4WVMA 4X6QB 3CEWA 1DQ5A 1ZRFA 2KXLA 4RGAA 4OHVA 4BIFA 2ZZQA 3VZOA 1AXYA 2A5ZA 3TYJA 1OSGA 1SBDA 1VR3A 4AHWA 4XIOA 4DXZA 4YW5A 1FMD3 1ND2B 4WVZA 3RWNA 2VOVA 4JC1A 2XWBB 5I8TA 2TBVA 4AYUA 4KQ7A 3H1YA 4OHXA 1AL21 1EYBA 1B35A 1TME2 4Z82A 2X8KA 5JMCA 1A78A 2Q4SA 1CVNA 1FNYA 1LULA 1NCRA 1ZVFA 2XJVA 3LGRA 1I1EA 4EJRA 1QQP1 4IV3A 1AL0G 1CAWB 1RMU3 4DS0A 3AJZA 2NLRA 3AXEA 3KLSA 1RUC3 5DG2A 3NL1A 1CESA 2QZ2A 5IK8A 4FAHA 3NKTA 1H1MA 2D6LX 2GNMA 5H9QA 2Q1MA 5IT6A 3ZFEB 4UW5A 1PHMA 3VKOA 3N4MA 5J96B 3U0ZA 1ND3A 3D5OA 1LHWA 3CJIA 4FAGA 1J3PA 1H1AA 2DF7A 4GALA 1RUOA 4CZSA 1BMV2 4NWVA 4Q29A 3IM0A 1NE4A 3TNPB 3VBSA 4S2FA 1O5UA 5CNAA 3USSA 3WY6A 5A3LA 1XRUA 3MZHA 3CF6E 4JGYB 2NZ9A 4GMP3 4S2HA 4FTEA 2YHJA 4YVWC 3A0KA 3CO2A 3GZTB 3FMGA 4G9SB 4Q4W1 3VBHB 2QE3A 1N3PA 1YCIA 5CVRA 4GMP0 1RHI3 4MGIE 3IBMA 1ZZ6A 5GKAC 1RUNA 4WM7B 1G7YA 3WXPA 3OY8B 3ILRA 4QU2A 3UJQA 4XTPA 2D3SA 4XJ9A 3RYKA 3VDDC 4RR3C 3OYWB 3KB5A 4YM3A 5HCAA 3WV6A 4D94A 1REDA 3KT4A 1OQEA 1CPMA 3UK9A 5FPXA 1A8MA 4LLOA 1FX5A 4Q4X2 1SLBA 4M0NA 1UIJA 1UKRA 1Q8QA 2QCSB 3ALQA 4PF5A 5FREA 2BVBA 3SMHA 3DF0A 1TMF3 1UX6A 2X53S 2X5IA 3N7KA 2ZHMA 3O12A 4GA9A 3URFA 4B7KA 2XVGA 3M3IA 4YVSA 1X8MA 4HBNA 1U5IA 4OHZA 3ECQA 2I45A 1FV2A 3SITA 4GH4B 2R0FA 1AZDA 2O8QA 4RS5A 4UXAA 2XJTA 1AR72 1D4M1 2P3JA 1UD1A 3M3EA 2GN7A 2ZHKA 1PIV2 5KHGA 1LU1A 2DTWA 5J7MA 1RUH3 1H1IA 3UJOA 4OFGA 2D98A 4R4ZA 2DTYA 3OTFA 4L99A 2P34A 4YGCA 1LCLA 1WW5A 1T6GC 2DUOA 3EHKA 3P3PA 4AVBA 2HWB3 1QKQA 3PMSA 1YFXA 1LEDA 4AEDC 2Q1ZB 4U2AA 4AXOA 4FBFA 3VBOC 1W6OB 2CWMA 3S6PA 1EAH1 1QJU2 1UF2C 3QLQA 4FXKB 3ZYPA 1RUI2 1ZBA1 4RGGA 2VQ0A 3MIHA 3ZN6B 1SLLA 5GM0A 2QVSB 3DV8A 1BEV1 3VZJA 1XE7A 2IWGB 2H6BA 3RNSA 4COZA 4WZFA 1CJPA 1FV3A 1OFNA 3CJXA 3KZ4C 3OGGA 1ZM1A 5T52A 5L19A 1J59A 1RUE1 3RI8A 4Y24A 5JOWA 1XQNA 1YLLA 2EAAA 4A3XA 3GZUC 1ZRRA 1V6NA 2E6VA 4K21A 5CFCC 3AKSA 5AC92 3FWEA 5CG9A 1HRI2 3GHNA 1UPIA 4H3WA 4W6WA 1ZZBA 3IMNA 3B9CA 1LENA 2ZS6B 4R9DA 2MEV1 4Q4V2 4GQ7A 5T54A 5DUVA 4HVQA 1ZZ7A 3RG0A 4JV4A 4MXVA 1B35B 2VVDA 3FC0A 4L11A 2RJKA 4GB32 3JBG3 4BHPA 2JD4A 3B01A 2ZKNA 1QQP3 4C0HA 3HN1A 4FOVA 5A32A 1NCRB 2FBEA 4K40A 3LZZA 4Q4Y3 2ZMNA 2GSYA 3VZLA 4IV3B 4HKLA 4L97A 4QM9A 4ASMB 4HN0A 3QD6A 3PVBB 5ABJA 2R0HA 4WM8B 3S7IA 1H30A 4BPZA 5C9AC 1NA1C 1S55A 3NAPC 2VY0A 4Q26A 5BNOA 4CEYA 5CU1A 1ENQA 1NY71 4Q0QA 3SNMA 3KM5A 1QU0A 4PDWC 1Y43B 2R1BA 1ND3B 4XFGA 1V6JA 3CJIB 4AW7A 4N53A 5F1RA 3N7LA 3GZAA 3SXWA 2PQQA 5AFBA 1ENXA 1SLIA 1X8EA 2ATFA 3VBSB 4NOTA 1WMFA 4Q4W3 1QOTA 2EF6A 1RUG3 2PLV2 2XLFA 4YFWA 3ZSEA 3ZXAC 2IXHA 2LTNA 5L7OC 2XUMA 4C0BA 2GNTA 3BU7A 1N3QA 5AVAA 2QZ3A 1N1YA 2VW2A 4QPGB 3V0AB 1UAIA 5BNPC 4ORFA 2HWF2 2JXAA 2G9GA 4OI1A 4XFHA 1A3KA 2MHFA 5GLUA 4J1WA 1KQRA 4JTOA 2GC1A 2I2SA 4Q0UA 1PGL2 4SBVA 2WZR2 3AKRA 2ENRA 4A7ZA 1H0BA 3MGUA 4JGZC 4MH0E 4XTMA 2GH8A 2RS31 1MS9A 3AM2A 1HXS1 1NG0A 1S0CA 2WLPA 1ASJ1 3FE5A 2O8OA 3IT8A 4N9IA 1ULEA 2EXKA 4YYOA 1VBB1 4NVPA 1J3RA 2X5IB 4K7JA 4IEQA 4YVSB 1FOD1 1GNZA 4Y1YA 4CDXC 1R082 2HWD2 1EPZA 4YARA 4AG4A 2K9ZA 1REFA 1PVC1 2B9UA 4RS5B 5JSRA 2E63A 2PELA 3WZ1A 2R041 5FLJA 1BQPA 2P37A 1ZNPA 2D44A 4XF9A 3MIGA 3TWIA 2AR6A 2D7FA 2A3XA 4XMIA 3TOJA 5FLHA 1LHNA 1F2NA 3WQ0A 2BWAA 3WP6A 4QPIC 1LHVA 4QQ2A 4YM0A 4HZFA 3ZFGA 2YY1A 4JCKA 1XU1A 1EAH3 5GLVA 1MS5A 5ACA1 4IV1C 2ET7A 2GH2A 1IKPA 2UY8A 2GN3A 1U0AA 4ISRA 2DYCA 1SCSA 3E5UA 3VBRB 3BCWA 1BXHA 3CU7A 4MGYE 1H2MA 1SMVA 4R52A 4KWJA 2WINB 1BEV3 1NCQA 4XE9A 5I0TA 1DDLA 4Y1VA 1SQ4A 3MIDA 2YMZA 1V9U2 4META 2OA2A 2VNOA 2ZX2A 1W6PA 3EJKA 2IXKA 1OPMA 2D3PA 3ZFFA 1X82A 1AX2A 2PA7A 3Q9OA 2VGDA 3H1WA 2Z69A 2ZX3A 4X8PA 1RIRA 3OPZA 2EXHA 3QBQA 3VBUB 4IERA 2PHLA 1A6CA 3ZSJA 2RM22 4W65A 5CB7A 2VG9A 3O0VA 3GYDA 5LK7B 1AR83 2XWJB 1VRH2 4N7UA 4XFFA 2RS12 2FMDA 3FLPA 3ATGA 2CGPA 1PO13 2R073 1GV9A 5BNNB 3O14A 4SLIA 1KFUL 4DNYA 2WKKA 4FOWA 2O1QA 3P3NA 1SACA 4UW4A 2IXLA 1MQTC 1RUF1 4B4PA 4PIYA 3KCXA 2R32A 5A32B 3PTYA 3MLLA 4MVTA 4CDUA 1R092 1YXWA 4E2GA 1RJ7A 2XPJA 1WLDA 2XVKA 3WX5A 2PHDA 4AVSA 5ABJB 2UYAA 4OI2A 2R6QA 3AZWA 2AREA 3QH7A 4EWAA 1ZRDA 1ZA4A 4Y1UA 1PNGA 2ZGUA 3BODA 2WJSA 1RJ8A 1M06G 5FFOC 2DVDA 4LHNA 4N53B 3FLTA 4B4RA 4YLZA 2B39A 4DINB 2W52A 1PNFA 2TEPA 3ES4A 1M4WA 3ELNA 5JOYA 3VBFC 3WP4A 3J8F3 3WOGA 2H0BA 1LB2A 2PHWA 1G9FA 5DXDA 4P9IA 3VKLA 1MZ6A 1PO23 1LGCA 2Q8OA 2YGMA 3VLBB 5FO7B 1XXNA 2HEYF 2RS51 2XBO1 1DQ4A 2PYTA 3N3HA 3ZIWA 2A6YA 1XU2A 5JOXA 3ZN4A 3JB8A 4AFMA 2OUHA 2JEMA 3ACLA 2VVEA 4Q2FA 4B3NA 5L36A 1DFQA 4KU8A 3VKMA 4ZXKA 2EIGA 1OI6A 4P5HA 1QJX2 1JXNA 4F3JA 3H3UA 1FT9A 3AP6A 5JWPA 3OD4A 2R062 1Q8VA 1POV1 1HXS3 3QOPA 5HXVA 1A8DA 2VNGA 4XF4A 2BNMA 5JLVA 1XNBA 1ZBE3 4XQ4A 4N43A 4K1YA 4BLIA 1VBA2 5J09A 4AHYA 4C91A 1TQ5A 5D8AC 1IQAA 2WS92 3VKNA 4YGDA 3JD72 1VBB3 2ZGPA 5FQ0A 2BPA2 4M0HA 2DUQA 5LEKA 4RQPC 1JHNA 1RVF1 3VZMA 1COV1 4PLMA 1FOD3 5GZCA 2ZX4A 3CL1A 1CAUA 4AVCA 2D6OX 2AENA 5JR7B 4XIKA 4LNVA 2R043 2EXIA 4MXWA 2JECA 1BVVA 1RUJ3 4I02A 1EP0A 3THPA 1ENRA 1QDOA 2ZGLA 3O0XA 3AMQA 4AQ2A 4IXLA 1VBE3 4L8QA 4XQDA 4YGEA 1AHSA 4Y22A 1AVBA 5ACA3 2IZWA 4YVWA 1OD5A 4K8FA 2EALA 2HWC1 2WFF2 1KS4A 3IDCB 2VOKA 1WCDJ 4XDQA 2E9QA 2GZWA 1AR62 1LU2A 1JYCA 2ZAAA 1SLTA 2BFUL 3BOPA 4Y5Z0 3MPBA 1GR3A 5KHJA 1KDMA 3BTAA 3I2DA 2PHFA 2PHTA 1NCQB 4XF3A 1EV13 3LB9A 5KHKA 4ITCA 3WW1A 5C4WC 3R4SA 5H9SA 3VDDA 3LKJA 4RR3A 4Y20A 5E89A 2UURA 3WDUA 2HKXA 1HW5A 4NPRA 4COVA 2ETEA 2NMNA 1DGWX 1Y7BA 4Q4X1 3TN91 1VBC1 4O9EA 2BEOA 3MPPG 4PLNA 3DPRB 3FLRA 2IXIA 3QCWA 3GBWA 1Z7S2 3ZYRA 1DHKB 5GJ6A 1VB4A 4AQTA 2VULA 3E6BA 4FO9A 1HRV3 1KITA 3OF1A 1HX6A 1YHFA 1AR71 1S0DA 2ZKLA 1NZCA 3LSDA 1BBT1 2RHPA 1OHFA 1RUF3 2RMU1 1DZTA 2A6XA 1VBD2 5DG1A 5TSWA 5F5QA 1GZ9A 1ND2C 3OBTA 4PBPA 1EPWA 2DCJA 3BOWA 3LSEA 2CL2A 2GALA 5GLTA 2WIIB 5I0SA 4XBLA 2DCYA 2KM2A 4CDUB 5CADA 5EFUA 4JQRA 1IHMA 4J1XA 1FMD2 4RFT0 4AEDA 4AQSA 2WQ4A 2WT1A 2JE7A 1IS5A 3VBOA 4NN0A 5DUWA 4Q27A 1NXD1 1RUI1 3VZKA 2C9AA 1AR91 2ILMA 4JDMA 1G86A 4Q1PA 4D7TA 5C8CA 1WMDA 3W9AA 4MX3A 4Q0VA 5H9RA 1BKZA 4YZ3A 4E9KA 1RMU2 3B00A 2D93A 4M01A 4COWA 2A6WA 1RUC2 4LBKA 1H8TA 1W6QA 5EWSA 5SV8A 4I0BA 5IK4A 2D43A 1DGWA 2GAUA 3KT1A 2D40A 2RS53 2XBO3 2DCZA 5FMOL 1HKDA 1SCRA 2HEVF 1KXGA 5AC91 4KWKA 3H8UA 5E88A 5CFCA 1H8VA 3V64A 4CDQC 2WNVA 1ZZ8A 3ZSKA 1H9WA 3VN4A 5DZGA 4YW1A 5CBLA 1WCKA 4Q4V1 1N1VA 4EN8B 2QDRA 3M2MA 1UU6A 4LEJA 1MZEA 1WW4A 4O9GA 3U10A 2D6MA 1DQ2A 2RR11 4A7KA 2GMEA 1ENSA 1POV3 1ZYBA 3LA2A 3AJYA 4KG0A 5FDBA 4WM7C 4UW3A 3VHRA 1DYKA 1O5LA 4XF0A 1RHI2 1POV0 3WDVA 4R4XA 2ZMKA 4CEWC 3BALA 5CFDC 1I9RA 3JCIA 4NHMA 5I8SA 1X36A 3S0MA 4N43B 1N1SA 1C4RA 5J36A 4XJAA 1RVF3 1YNAA 1COV3 2ZPXA 3AZYA 5C9AA 1YYNA 1OLRA 2D5FA 1QHDA 2WA4A 4MGZE 3NAPA 5FQ0B 4XBQA 4AF9A 2AZ5A 2D97A 3RZZA 1TE1B 4FCAA 3N7MA 4IEYA