4ERQA

X-ray structure of wdr5-mll2 win motif peptide binary complex
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Structural basis for WDR5 interaction (Win) motif recognition in human SET1 family histone methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transferase
total genus 103
structure length 304
sequence length 304
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4erqA00
3C75H 3K27A 3N0EA 3PXWD 5GXHA 3JAMg 1SQ9A 1NEXB 2H14A 3FRXA 2AH0A 2J55H 2I0TA 3I7LA 2B5MA 3NVXA 4UI9R 1JMXB 3L4MD 4NSXA 2HKRA 2CO0A 4H5JA 2UZYB 2P9KC 2CE9A 5H14A 3UVNA 3BG1A 4MK0B 5AFU3 1K32A 1JMZB 1YFQA 1JOFA 4JXMA 1OMWB 1VYHC 2IURA 3FGBA 2B5NA 5FQDA 3RLMD 3A0FA 3EI2B 4Y5RD 3IJ0A 3RMZD 2GNQA 2PBIB 2P9NC 3I7HA 2CN2A 4J78A 2I0RA 5EALA 2P9PC 3BG0A 3I7OA 3SMRA 2CO0C 2PM6B 3SBRA 5C2WB 3EI1B 2CNXA 3KRXB 3SJLD 3MZKA 2P9IC 5I5IA 3PXSD 4CY3A 4GQ2P 5EM2A 2UZXB 5EMKB 2CN3A 3L4OD 3EMHA 4J86A 1L0QA 3SHFA 2H13A 4GM3A 4FA5D 3UKRC 3SCYA 5C2VB 5GMKn 4ERZA 2XYIA 4A09B 1OLZA 4FA9D 3SVWD 4A11B 4O45A 4LG8A 3SN6B 2OIZA 4FB1D 2I0SA 4OZUA 4X61B 5HE1B 2QXVA 4E54A 4CZVA 5FXYA 4PNKB 3AFCA 5AJAA 4CZYA 2YB8B 1TYQC 5CXCA 4CI1A 4OWRA 5B4WA 3SFZA 2I3TA 3MKSB 3BWSA 4GZ8A 5FLXg 1GG2B 2H6QA 2YMUA 4BL0A 1PGUA 3ZWLB 4K3ID 4A0AA 5CYKA 3SBPA 3AL8B 3OKWA 3I7PA 2IUVA 4X3EA 3JROA 4J82A 5AMSA 3VGZA 4Z8LA 4CY1A 4A2LA 1PEVA 3OL2A 3PXTD 3GREA 4H5IA 4LG9A 3ULEC 1FWXA 5HYNB 5TEFA 2OK4A 4JD2C 2Z2NA 2IWFA 4PSXB 2I3SA 4YVDA 4A0BA 5HE0B 3J81g 1PI6A 1U2VC 2H68A 3GFCA 2J56H 3FM0A 4E5ZB 3CFVA 2EBSA 1U4CA 3RFHA 4IA9A 1K8KC 4XEIC 4N14A 5H17A 2YNNA 3B7FA 3RN0D 1QNIA 2PM9A 1A0RB 4I79A 5HE3B 2W18A 4L9OA 5I5JA 2H9NA 4D0KA 3K26A 2TRCB 3OKYA 4X63B 4D6VA 3DXMC 1JJUB 4QT8A 3C99A 2OVQB 2O9KA 3KRWB 3I8CA 3AL8A 5K19A 3MMYA 2H47A 5IJ8E 3F3PA 2BCJB 4GGCA 3EI3B 3OW8A 1GOTB 4HDJA 3U4YA 4ZOXA 4J79A 5EMMB 4ES0A 3ODTA 5GXIA 4CZXA 4ESGA 5KDOB 2P9LC 2H6NA 2G99A 4ZOYA 4IMMA 2GC4A 3UVLA 4FHLA 5CXBB 3JPXA 4ERYA 3OKTA 4PBZA 3EU7A 1SHYB 1XHMA 5THAA 2B4EA 2OVRB 1NR0A 4CC9A 2IUPA 3P4FA 3RFGA 3IIWA 3EG6A 3SBQA 2XL3A 3C9CA 4FA1D 2HJ4A 3SXTD 4GGAA 4CI8A 2XL2A 4GQBB 3UR4A 4A08B 4PXWA 3EI4B 4BUJC 3UVMA 3RSEC 4L3GD 4J8BA 2Z2PA 4CI3A 3IJCA 5IJ7E 3UVOA 3DSMA 5EARA 3UVKA 3EI2A 3V7DB 5HQGA 3JRPA 2MTAH 1MDAH 4XYIA 5GSAA 1SQJA 3NVQA 2AGLA 1P22A 3JZHA 4U1EI 5EMJB 2HJBA 3EI1A 2IWKA 2H9MA 4FWWA 2AGWA 2AGYA 4R7AB 2IUQA 4GM8A 2P9SC 4JSNC 4QRJA 3SWSD 4J73A 3VH0A 4A09A 4ZOZA 3DWLC 4XYHA 3J80g 4A11A 1MG3A 5FKRA 5K1CC 1XIPA 2XU7A 2AGXA 5FKTA 3EI4A 5IC7A 5IGQA 2QC5A 4J87A 4A2MA 3VA6A 4FAND 5FKSA 4J84A 1S4UX 3I2NA 1N6DA 1PBYB 1GXRA 3IJ1A 3CIKB 2IAAA 3AH8B 2OVPB 1N6EA 2J57G 4AOWA 3UKUC 3W15A 5JWZA 3I89A 1RI6A 3HFQA 5EM2B 4X60B 5IT9g 4J8GA 3DXKC 3PVUB 4J77A 4J0WA 3AL9A 3I7KA 4JSVC 4QQEA 4L3HD 2H3XA 2H6KA 1B9XA 4FA4D 2Q7QA 4LGNA 4E54B 5TF2A 4ZN4A 4CY2A 4PC0A 2OJYA 3PSCB 4E5ZA 5FA5B 4BH6A 2PM7B 2H9LA 1ERJA 5CXCB 4J0XA 2H9PA 3OTTA 4A7JA 5EAPA 4Y7RA 3F3GA 4JSPC 4PBYA 4A0AB 2HKMA 3JZGA 5CYKB 4GQ1A 5SXMA 4GMBA 4TZ4A 3N0DA 3C5MA 3F3FA 3I8EA 2B5LA 4ERQA 4PSWB 5A2Qg 3E0CA 3OL2B 2P9UC 4JSXC 1GP2B 4O3UB 5EMLB 5C9ZB 4O9DA 3V5WB 4ZOVA 3PVWB 3MZLA 2AH1A 3PSLA 3I7NA 4QL1A 3RRMC 4A0BB 4FAVD 2YBAA 3EWEA 2Z2OA 5IGOA 3EI3A 3SLED 1B9YA 2OK6A 3ORVD 3IKOA 5TEEA 3JZNA 2CE8A 3IIYA 2AGZA 2HXCA 1XKSA 2G9AA 2PM9B 3NVNA 4GM9A 1MG2A 5H1MA 4JT6C 1TBGA 3CFSB 3OKYB 4O1QD 4J81A 3JB9L 1N6FA 5CXBA 2BBKH 4CY5A 2GC7A 4CI2A 4G56B 3PE7A 4EWRA 4JT5C 4GGDA 4U7AA 3V9FA 1R5MA 4K3JB 2AQ5A 3MXXA 3RN1D 4L1QD 4O3TB 5I5MA 1Q47A 4A08A 2YNPA 3MKQA 4AEZA 3DM0A 5EAMA 2HYEA 4KFMB 5HE2B 2HESX 5TDHB 2YNOA 5FKQA
chains in the Genus database with same CATH superfamily
3C75H 3K27A 3N0EA 3PXWD 5GXHA 3O4IA 3JAMg 1SQ9A 3ZE1A 1NEXB 2H14A 3FRXA 2AH0A 3QI0A 2HU5A 2J55H 2I0TA 3I7LA 3ZDYA 2B5MA 3NVXA 4UI9R 1JMXB 3L4MD 4UM8A 4G55A 1VZ2A 4NSXA 2HKRA 2CO0A 4H5JA 2UZYB 1VE7A 2CE9A 2P9KC 5H14A 3UVNA 3BG1A 5E6SA 4MK0B 5M5SA 5AFU3 1K32A 1JMZB 1YFQA 1JOFA 3EQ9A 4JXMA 1A12A 1OMWB 1VYHC 2IURA 3FGBA 2B5NA 1H2WA 5FQDA 3RLMD 3A0FA 3EI2B 4Y5RD 4WK4A 3IJ0A 3RMZD 2GNQA 5M5TA 2PBIB 2P9NC 1H2ZA 3I7HA 4QAMA 2CN2A 4J78A 2I0RA 3K6SA 5EALA 4BP8A 2P9PC 4Z7NA 3BG0A 3I7OA 3SMRA 2CO0C 1K3IA 2PM6B 3IUNA 3SBRA 4AN1A 4NAAA 4BCBA 5C2WB 3EI1B 2CNXA 3KRXB 3SJLD 3MZKA 2P9IC 4Z7QA 4WK0A 5I5IA 3PXSD 4CY3A 4GQ2P 5EM2A 2UZXB 5EMKB 2CN3A 1O6GA 3L4OD 5E6UA 3EMHA 4J86A 1L0QA 3IULA 2H13A 4GM3A 3SHFA 3UKRC 3SCYA 4FA5D 5C2VB 5GMKn 4ERZA 3IJEA 2XYIA 4A09B 1OLZA 4FA9D 3SVWD 4A11B 4O45A 4DNWA 4LG8A 3SN6B 2OIZA 3EQ8A 4FB1D 2I0SA 4OZUA 2VZ1A 4X61B 5HE1B 2QXVA 4E54A 4CZVA 5FXYA 4UM9A 4PNKB 1GOHA 2VDMA 3AFCA 5AJAA 4CZYA 2YB8B 1UOPA 2EIEA 1TYQC 5CXCA 4CI1A 4OWRA 5B4WA 3SFZA 2I3TA 3MKSB 3BWSA 4MMXA 4GZ8A 5FLXg 1GG2B 2H6QA 4D9SA 2YMUA 4BL0A 1PGUA 3ZWLB 4K3ID 4A0AA 3DDUA 5CYKA 3SBPA 1M1XA 3AL8B 3OKWA 3I7PA 2IUVA 4X3EA 3JROA 4J82A 5AMSA 3VGZA 4Z8LA 4CY1A 4A2LA 3MUOA 4NENA 1BPOA 1PEVA 3IVMA 3OL2A 1L5GA 2EICA 3PXTD 3GREA 4H5IA 4LG9A 3ULEC 1FWXA 5HYNB 5TEFA 2OK4A 4JD2C 4L1MA 3VI3A 2QR5A 2Z2NA 2IWFA 4O02A 4PSXB 2I3SA 4YVDA 4A0BA 5HE0B 4JHPC 3J81g 1PI6A 3EQ7A 1U2VC 2H68A 3GFCA 2J56H 3FM0A 4RE5A 4E5ZB 3CFVA 2EBSA 1U4CA 3RFHA 4IA9A 1K8KC 2VDNA 4XEIC 4N14A 1JV2A 2YNNA 5H17A 3B7FA 3RN0D 1QNIA 1VE6A 1A0RB 2PM9A 4I79A 1H2YA 2VDRA 5HE3B 3FCSA 2W18A 4L9OA 5I5JA 2H9NA 3O4GA 4MMYA 4D0KA 3K26A 2TRCB 2VDPA 3OKYA 4G1EA 5HDBA 3GC3B 4X63B 1UOOA 4D6VA 4NC4A 3DXMC 1JJUB 5M61A 4QT8A 3C99A 4Z7OA 3IUQA 2OVQB 2O9KA 3KRWB 3I8CA 4BCDA 3AL8A 5K19A 2HU8A 1JTDB 3MMYA 2H47A 5IJ8E 5M5UA 3F3PA 2BCJB 4GGCA 3EI3B 3OW8A 1GOTB 4HDJA 3U4YA 4ZOXA 4J79A 5EMMB 4ES0A 3ODTA 5GXIA 4CZXA 4ESGA 3VI4A 5KDOB 4AX4A 2P9LC 2H6NA 2G99A 1GOFA 4ZOYA 1T2XA 2JKXA 4IMMA 2GC4A 3UVLA 4FHLA 2HU7A 5CXBB 5C86A 3JPXA 4ERYA 2VC2A 3OKTA 4PBZA 3EU7A 3ZDZA 1SHYB 1XHMA 5THAA 2B4EA 2OVRB 1NR0A 4CC9A 5M5VA 2IUPA 3P4FA 3RFGA 3IIWA 3EG6A 3SBQA 2XL3A 3C9CA 4FA1D 1C9IA 2HJ4A 3SXTD 4GGAA 4CI8A 2XL2A 4GQBB 4MMZA 3UR4A 4PXWA 3EI4B 4A08B 4BUJC 3UVMA 3RSEC 4L3GD 4J8BA 2Z2PA 3T3PA 1GOGA 4CI3A 3IJCA 5IJ7E 3UVOA 3DSMA 5EARA 3UVKA 3EI2A 3V7DB 5HQGA 4BCCA 2VDOA 3JRPA 4NBMA 1QFMA 3IUMA 3V4PA 2MTAH 1MDAH 1YR2A 4XYIA 5GSAA 1SQJA 3NVQA 3T3MA 2AGLA 1P22A 3JZHA 3ZE2A 4U1EI 4JHNA 5EMJB 2HJBA 3EI1A 2QZPA 2IWKA 3K71A 2H9MA 4FWWA 2AGWA 2AGYA 4R7AB 2IUQA 4GM8A 5C92A 2P9SC 2VDLA 2EIBA 3NIDA 4JSNC 4QRJA 3SWSD 1H2XA 3ZE0A 4J73A 3VH0A 3GD1I 4A09A 4ZOZA 3DWLC 4XYHA 3J80g 4A11A 1MG3A 5FKRA 2WQ8A 1XIPA 5K1CC 2XU7A 4BP9A 2AGXA 3O4HA 3EI4A 5FKTA 5IC7A 5IGQA 2QC5A 4J87A 3V4VA 4A2MA 4WJKA 1QFSA 1UTCA 3VA6A 4FAND 5FKSA 4J84A 1S4UX 3I2NA 1N6DA 1E8MA 2BKLA 1PBYB 1GXRA 3IJ1A 3CIKB 2IAAA 3AH8B 2OVPB 1N6EA 2J57G 4AOWA 3UKUC 3W15A 5JWZA 3I89A 1RI6A 3HFQA 1I2MB 5EM2B 4X60B 3IUJA 5IT9g 4J8GA 3DXKC 3PVUB 1E5TA 4J77A 1VZ3A 4J0WA 3AL9A 3I7KA 4JSVC 4QQEA 4DNVA 4L3HD 2H3XA 5E6RA 2H6KA 1B9XA 4FA4D 2Q7QA 4LGNA 4E54B 5TF2A 4ZN4A 4CY2A 4PC0A 2OJYA 3PSCB 4E5ZA 5FA5B 4BH6A 2PM7B 2H9LA 1C9LA 1ERJA 5CXCB 4G1MA 4J0XA 2H9PA 3OTTA 4A7JA 5EAPA 4WK2A 3F3GA 4Y7RA 4JSPC 4O2WA 4PBYA 4A0AB 2HKMA 3JZGA 5CYKB 4GQ1A 5SXMA 4GMBA 4AMZA 4TZ4A 3N0DA 3C5MA 3F3FA 3I8EA 4IRZA 4RE6A 3O4JA 2B5LA 2XZGA 4ERQA 4PSWB 5A2Qg 3E0CA 3OL2B 2P9UC 4JSXC 1GP2B 4O3UB 5EMLB 5C9ZB 4O9DA 3V5WB 4ZOVA 3OF7A 1U8CA 1E8NA 3PVWB 2XDWA 2XE4A 3MZLA 2AH1A 5FFOA 3PSLA 3I7NA 3IURA 4DNUA 4QL1A 3RRMC 4A0BB 3MVDK 4FAVD 2YBAA 3K72A 3EWEA 2Z2OA 5IGOA 3EI3A 1TYEA 1UOQA 1B9YA 3SLED 2OK6A 4AMYA 3ORVD 3IKOA 5TEEA 3JZNA 2CE8A 5FFGA 3IIYA 2AGZA 2HXCA 1XKSA 2G9AA 2PM9B 3NVNA 4GM9A 2VDQA 1MG2A 5H1MA 1O6FA 4JT6C 1TBGA 3CFSB 3OKYB 4O1QD 2VZ3A 4J81A 3JB9L 1N6FA 5CXBA 2BBKH 3ZDXA 4CY5A 2VDKA 2GC7A 2EIDA 4CI2A 4G56B 3PE7A 4EWRA 4JT5C 3NIGA 4GGDA 4U7AA 3QHYB 3V9FA 1R5MA 4K3JB 2AQ5A 3MXXA 3RN1D 4L1QD 4O3TB 5I5MA 1Q47A 4A08A 2YNPA 3FCUA 3MKQA 4AEZA 3DM0A 5EAMA 5M5RA 2HYEA 4AN0A 3NIFA 4KFMB 3KCIA 5HE2B 2HESX 5TDHB 2YNOA 5FKQA 3MUNA
chains in the Genus database with same CATH topology
3C75H 3K27A 3N0EA 3PXWD 5GXHA 3JAMg 1SQ9A 1NEXB 2H14A 3FRXA 2AH0A 2J55H 2I0TA 3I7LA 2B5MA 3NVXA 4UI9R 1JMXB 3L4MD 4NSXA 2HKRA 2CO0A 4H5JA 2UZYB 2P9KC 2CE9A 5H14A 3UVNA 3BG1A 4MK0B 5AFU3 1K32A 1JMZB 1YFQA 1JOFA 4JXMA 1OMWB 1VYHC 2IURA 3FGBA 2B5NA 5FQDA 3RLMD 3A0FA 3EI2B 4Y5RD 3IJ0A 3RMZD 2GNQA 2PBIB 2P9NC 3I7HA 2CN2A 4J78A 2I0RA 5EALA 2P9PC 3BG0A 3I7OA 3SMRA 2CO0C 2PM6B 3SBRA 5C2WB 3EI1B 2CNXA 3KRXB 3SJLD 3MZKA 2P9IC 5I5IA 3PXSD 4CY3A 4GQ2P 5EM2A 2UZXB 5EMKB 2CN3A 3L4OD 3EMHA 4J86A 1L0QA 3SHFA 2H13A 4GM3A 4FA5D 3UKRC 3SCYA 5C2VB 5GMKn 4ERZA 2XYIA 4A09B 1OLZA 4FA9D 3SVWD 4A11B 4O45A 4LG8A 3SN6B 2OIZA 4FB1D 2I0SA 4OZUA 4X61B 5HE1B 2QXVA 4E54A 4CZVA 5FXYA 4PNKB 3AFCA 5AJAA 4CZYA 2YB8B 1TYQC 5CXCA 4CI1A 4OWRA 5B4WA 3SFZA 2I3TA 3MKSB 3BWSA 4GZ8A 5FLXg 1GG2B 2H6QA 2YMUA 4BL0A 1PGUA 3ZWLB 4K3ID 4A0AA 5CYKA 3SBPA 3AL8B 3OKWA 3I7PA 2IUVA 4X3EA 3JROA 4J82A 5AMSA 3VGZA 4Z8LA 4CY1A 4A2LA 1PEVA 3OL2A 3PXTD 3GREA 4H5IA 4LG9A 3ULEC 1FWXA 5HYNB 5TEFA 2OK4A 4JD2C 2Z2NA 2IWFA 4PSXB 2I3SA 4YVDA 4A0BA 5HE0B 3J81g 1PI6A 1U2VC 2H68A 3GFCA 2J56H 3FM0A 4E5ZB 3CFVA 2EBSA 1U4CA 3RFHA 4IA9A 1K8KC 4XEIC 4N14A 5H17A 2YNNA 3B7FA 3RN0D 1QNIA 2PM9A 1A0RB 4I79A 5HE3B 2W18A 4L9OA 5I5JA 2H9NA 4D0KA 3K26A 2TRCB 3OKYA 4X63B 4D6VA 3DXMC 1JJUB 4QT8A 3C99A 2OVQB 2O9KA 3KRWB 3I8CA 3AL8A 5K19A 3MMYA 2H47A 5IJ8E 3F3PA 2BCJB 4GGCA 3EI3B 3OW8A 1GOTB 4HDJA 3U4YA 4ZOXA 4J79A 5EMMB 4ES0A 3ODTA 5GXIA 4CZXA 4ESGA 5KDOB 2P9LC 2H6NA 2G99A 4ZOYA 4IMMA 2GC4A 3UVLA 4FHLA 5CXBB 3JPXA 4ERYA 3OKTA 4PBZA 3EU7A 1SHYB 1XHMA 5THAA 2B4EA 2OVRB 1NR0A 4CC9A 2IUPA 3P4FA 3RFGA 3IIWA 3EG6A 3SBQA 2XL3A 3C9CA 4FA1D 2HJ4A 3SXTD 4GGAA 4CI8A 2XL2A 4GQBB 3UR4A 4A08B 4PXWA 3EI4B 4BUJC 3UVMA 3RSEC 4L3GD 4J8BA 2Z2PA 4CI3A 3IJCA 5IJ7E 3UVOA 3DSMA 5EARA 3UVKA 3EI2A 3V7DB 5HQGA 3JRPA 2MTAH 1MDAH 4XYIA 5GSAA 1SQJA 3NVQA 2AGLA 1P22A 3JZHA 4U1EI 5EMJB 2HJBA 3EI1A 2IWKA 2H9MA 4FWWA 2AGWA 2AGYA 4R7AB 2IUQA 4GM8A 2P9SC 4JSNC 4QRJA 3SWSD 4J73A 3VH0A 4A09A 4ZOZA 3DWLC 4XYHA 3J80g 4A11A 1MG3A 5FKRA 5K1CC 1XIPA 2XU7A 2AGXA 5FKTA 3EI4A 5IC7A 5IGQA 2QC5A 4J87A 4A2MA 3VA6A 4FAND 5FKSA 4J84A 1S4UX 3I2NA 1N6DA 1PBYB 1GXRA 3IJ1A 3CIKB 2IAAA 3AH8B 2OVPB 1N6EA 2J57G 4AOWA 3UKUC 3W15A 5JWZA 3I89A 1RI6A 3HFQA 5EM2B 4X60B 5IT9g 4J8GA 3DXKC 3PVUB 4J77A 4J0WA 3AL9A 3I7KA 4JSVC 4QQEA 4L3HD 2H3XA 2H6KA 1B9XA 4FA4D 2Q7QA 4LGNA 4E54B 5TF2A 4ZN4A 4CY2A 4PC0A 2OJYA 3PSCB 4E5ZA 5FA5B 4BH6A 2PM7B 2H9LA 1ERJA 5CXCB 4J0XA 2H9PA 3OTTA 4A7JA 5EAPA 4Y7RA 3F3GA 4JSPC 4PBYA 4A0AB 2HKMA 3JZGA 5CYKB 4GQ1A 5SXMA 4GMBA 4TZ4A 3N0DA 3C5MA 3F3FA 3I8EA 2B5LA 4ERQA 4PSWB 5A2Qg 3E0CA 3OL2B 2P9UC 4JSXC 1GP2B 4O3UB 5EMLB 5C9ZB 4O9DA 3V5WB 4ZOVA 3PVWB 3MZLA 2AH1A 3PSLA 3I7NA 4QL1A 3RRMC 4A0BB 4FAVD 2YBAA 3EWEA 2Z2OA 5IGOA 3EI3A 3SLED 1B9YA 2OK6A 3ORVD 3IKOA 5TEEA 3JZNA 2CE8A 3IIYA 2AGZA 2HXCA 1XKSA 2G9AA 2PM9B 3NVNA 4GM9A 1MG2A 5H1MA 4JT6C 1TBGA 3CFSB 3OKYB 4O1QD 4J81A 3JB9L 1N6FA 5CXBA 2BBKH 4CY5A 2GC7A 4CI2A 4G56B 3PE7A 4EWRA 4JT5C 4GGDA 4U7AA 3V9FA 1R5MA 4K3JB 2AQ5A 3MXXA 3RN1D 4L1QD 4O3TB 5I5MA 1Q47A 4A08A 2YNPA 3MKQA 4AEZA 3DM0A 5EAMA 2HYEA 4KFMB 5HE2B 2HESX 5TDHB 2YNOA 5FKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C75 H;  3K27 A;  3N0E A;  3PXW D;  5GXH A;  3JAM g;  1SQ9 A;  1NEX B;  2H14 A;  3FRX A;  2AH0 A;  2J55 H;  2I0T A;  3I7L A;  2B5M A;  3NVX A;  4UI9 R;  1JMX B;  3L4M D;  4NSX A;  2HKR A;  2CO0 A;  4H5J A;  2UZY B;  2P9K C;  2CE9 A;  5H14 A;  3UVN A;  3BG1 A;  4MK0 B;  5AFU 3;  1K32 A;  1JMZ B;  1YFQ A;  1JOF A;  4JXM A;  1OMW B;  1VYH C;  2IUR A;  3FGB A;  2B5N A;  5FQD A;  3RLM D;  3A0F A;  3EI2 B;  4Y5R D;  3IJ0 A;  3RMZ D;  2GNQ A;  2PBI B;  2P9N C;  3I7H A;  2CN2 A;  4J78 A;  2I0R A;  5EAL A;  2P9P C;  3BG0 A;  3I7O A;  3SMR A;  2CO0 C;  2PM6 B;  3SBR A;  5C2W B;  3EI1 B;  2CNX A;  3KRX B;  3SJL D;  3MZK A;  2P9I C;  5I5I A;  3PXS D;  4CY3 A;  4GQ2 P;  5EM2 A;  2UZX B;  5EMK B;  2CN3 A;  3L4O D;  3EMH A;  4J86 A;  1L0Q A;  3SHF A;  2H13 A;  4GM3 A;  4FA5 D;  3UKR C;  3SCY A;  5C2V B;  5GMK n;  4ERZ A;  2XYI A;  4A09 B;  1OLZ A;  4FA9 D;  3SVW D;  4A11 B;  4O45 A;  4LG8 A;  3SN6 B;  2OIZ A;  4FB1 D;  2I0S A;  4OZU A;  4X61 B;  5HE1 B;  2QXV A;  4E54 A;  4CZV A;  5FXY A;  4PNK B;  3AFC A;  5AJA A;  4CZY A;  2YB8 B;  1TYQ C;  5CXC A;  4CI1 A;  4OWR A;  5B4W A;  3SFZ A;  2I3T A;  3MKS B;  3BWS A;  4GZ8 A;  5FLX g;  1GG2 B;  2H6Q A;  2YMU A;  4BL0 A;  1PGU A;  3ZWL B;  4K3I D;  4A0A A;  5CYK A;  3SBP A;  3AL8 B;  3OKW A;  3I7P A;  2IUV A;  4X3E A;  3JRO A;  4J82 A;  5AMS A;  3VGZ A;  4Z8L A;  4CY1 A;  4A2L A;  1PEV A;  3OL2 A;  3PXT D;  3GRE A;  4H5I A;  4LG9 A;  3ULE C;  1FWX A;  5HYN B;  5TEF A;  2OK4 A;  4JD2 C;  2Z2N A;  2IWF A;  4PSX B;  2I3S A;  4YVD A;  4A0B A;  5HE0 B;  3J81 g;  1PI6 A;  1U2V C;  2H68 A;  3GFC A;  2J56 H;  3FM0 A;  4E5Z B;  3CFV A;  2EBS A;  1U4C A;  3RFH A;  4IA9 A;  1K8K C;  4XEI C;  4N14 A;  5H17 A;  2YNN A;  3B7F A;  3RN0 D;  1QNI A;  2PM9 A;  1A0R B;  4I79 A;  5HE3 B;  2W18 A;  4L9O A;  5I5J A;  2H9N A;  4D0K A;  3K26 A;  2TRC B;  3OKY A;  4X63 B;  4D6V A;  3DXM C;  1JJU B;  4QT8 A;  3C99 A;  2OVQ B;  2O9K A;  3KRW B;  3I8C A;  3AL8 A;  5K19 A;  3MMY A;  2H47 A;  5IJ8 E;  3F3P A;  2BCJ B;  4GGC A;  3EI3 B;  3OW8 A;  1GOT B;  4HDJ A;  3U4Y A;  4ZOX A;  4J79 A;  5EMM B;  4ES0 A;  3ODT A;  5GXI A;  4CZX A;  4ESG A;  5KDO B;  2P9L C;  2H6N A;  2G99 A;  4ZOY A;  4IMM A;  2GC4 A;  3UVL A;  4FHL A;  5CXB B;  3JPX A;  4ERY A;  3OKT A;  4PBZ A;  3EU7 A;  1SHY B;  1XHM A;  5THA A;  2B4E A;  2OVR B;  1NR0 A;  4CC9 A;  2IUP A;  3P4F A;  3RFG A;  3IIW A;  3EG6 A;  3SBQ A;  2XL3 A;  3C9C A;  4FA1 D;  2HJ4 A;  3SXT D;  4GGA A;  4CI8 A;  2XL2 A;  4GQB B;  3UR4 A;  4A08 B;  4PXW A;  3EI4 B;  4BUJ C;  3UVM A;  3RSE C;  4L3G D;  4J8B A;  2Z2P A;  4CI3 A;  3IJC A;  5IJ7 E;  3UVO A;  3DSM A;  5EAR A;  3UVK A;  3EI2 A;  3V7D B;  5HQG A;  3JRP A;  2MTA H;  1MDA H;  4XYI A;  5GSA A;  1SQJ A;  3NVQ A;  2AGL A;  1P22 A;  3JZH A;  4U1E I;  5EMJ B;  2HJB A;  3EI1 A;  2IWK A;  2H9M A;  4FWW A;  2AGW A;  2AGY A;  4R7A B;  2IUQ A;  4GM8 A;  2P9S C;  4JSN C;  4QRJ A;  3SWS D;  4J73 A;  3VH0 A;  4A09 A;  4ZOZ A;  3DWL C;  4XYH A;  3J80 g;  4A11 A;  1MG3 A;  5FKR A;  5K1C C;  1XIP A;  2XU7 A;  2AGX A;  5FKT A;  3EI4 A;  5IC7 A;  5IGQ A;  2QC5 A;  4J87 A;  4A2M A;  3VA6 A;  4FAN D;  5FKS A;  4J84 A;  1S4U X;  3I2N A;  1N6D A;  1PBY B;  1GXR A;  3IJ1 A;  3CIK B;  2IAA A;  3AH8 B;  2OVP B;  1N6E A;  2J57 G;  4AOW A;  3UKU C;  3W15 A;  5JWZ A;  3I89 A;  1RI6 A;  3HFQ A;  5EM2 B;  4X60 B;  5IT9 g;  4J8G A;  3DXK C;  3PVU B;  4J77 A;  4J0W A;  3AL9 A;  3I7K A;  4JSV C;  4QQE A;  4L3H D;  2H3X A;  2H6K A;  1B9X A;  4FA4 D;  2Q7Q A;  4LGN A;  4E54 B;  5TF2 A;  4ZN4 A;  4CY2 A;  4PC0 A;  2OJY A;  3PSC B;  4E5Z A;  5FA5 B;  4BH6 A;  2PM7 B;  2H9L A;  1ERJ A;  5CXC B;  4J0X A;  2H9P A;  3OTT A;  4A7J A;  5EAP A;  4Y7R A;  3F3G A;  4JSP C;  4PBY A;  4A0A B;  2HKM A;  3JZG A;  5CYK B;  4GQ1 A;  5SXM A;  4GMB A;  4TZ4 A;  3N0D A;  3C5M A;  3F3F A;  3I8E A;  2B5L A;  4ERQ A;  4PSW B;  5A2Q g;  3E0C A;  3OL2 B;  2P9U C;  4JSX C;  1GP2 B;  4O3U B;  5EML B;  5C9Z B;  4O9D A;  3V5W B;  4ZOV A;  3PVW B;  3MZL A;  2AH1 A;  3PSL A;  3I7N A;  4QL1 A;  3RRM C;  4A0B B;  4FAV D;  2YBA A;  3EWE A;  2Z2O A;  5IGO A;  3EI3 A;  3SLE D;  1B9Y A;  2OK6 A;  3ORV D;  3IKO A;  5TEE A;  3JZN A;  2CE8 A;  3IIY A;  2AGZ A;  2HXC A;  1XKS A;  2G9A A;  2PM9 B;  3NVN A;  4GM9 A;  1MG2 A;  5H1M A;  4JT6 C;  1TBG A;  3CFS B;  3OKY B;  4O1Q D;  4J81 A;  3JB9 L;  1N6F A;  5CXB A;  2BBK H;  4CY5 A;  2GC7 A;  4CI2 A;  4G56 B;  3PE7 A;  4EWR A;  4JT5 C;  4GGD A;  4U7A A;  3V9F A;  1R5M A;  4K3J B;  2AQ5 A;  3MXX A;  3RN1 D;  4L1Q D;  4O3T B;  5I5M A;  1Q47 A;  4A08 A;  2YNP A;  3MKQ A;  4AEZ A;  3DM0 A;  5EAM A;  2HYE A;  4KFM B;  5HE2 B;  2HES X;  5TDH B;  2YNO A;  5FKQ A; 
#chains in the Genus database with same CATH topology
 3C75 H;  3K27 A;  3N0E A;  3PXW D;  5GXH A;  3O4I A;  3JAM g;  1SQ9 A;  3ZE1 A;  1NEX B;  2H14 A;  3FRX A;  2AH0 A;  3QI0 A;  2HU5 A;  2J55 H;  2I0T A;  3I7L A;  3ZDY A;  2B5M A;  3NVX A;  4UI9 R;  1JMX B;  3L4M D;  4UM8 A;  4G55 A;  1VZ2 A;  4NSX A;  2HKR A;  2CO0 A;  4H5J A;  2UZY B;  1VE7 A;  2CE9 A;  2P9K C;  5H14 A;  3UVN A;  3BG1 A;  5E6S A;  4MK0 B;  5M5S A;  5AFU 3;  1K32 A;  1JMZ B;  1YFQ A;  1JOF A;  3EQ9 A;  4JXM A;  1A12 A;  1OMW B;  1VYH C;  2IUR A;  3FGB A;  2B5N A;  1H2W A;  5FQD A;  3RLM D;  3A0F A;  3EI2 B;  4Y5R D;  4WK4 A;  3IJ0 A;  3RMZ D;  2GNQ A;  5M5T A;  2PBI B;  2P9N C;  1H2Z A;  3I7H A;  4QAM A;  2CN2 A;  4J78 A;  2I0R A;  3K6S A;  5EAL A;  4BP8 A;  2P9P C;  4Z7N A;  3BG0 A;  3I7O A;  3SMR A;  2CO0 C;  1K3I A;  2PM6 B;  3IUN A;  3SBR A;  4AN1 A;  4NAA A;  4BCB A;  5C2W B;  3EI1 B;  2CNX A;  3KRX B;  3SJL D;  3MZK A;  2P9I C;  4Z7Q A;  4WK0 A;  5I5I A;  3PXS D;  4CY3 A;  4GQ2 P;  5EM2 A;  2UZX B;  5EMK B;  2CN3 A;  1O6G A;  3L4O D;  5E6U A;  3EMH A;  4J86 A;  1L0Q A;  3IUL A;  2H13 A;  4GM3 A;  3SHF A;  3UKR C;  3SCY A;  4FA5 D;  5C2V B;  5GMK n;  4ERZ A;  3IJE A;  2XYI A;  4A09 B;  1OLZ A;  4FA9 D;  3SVW D;  4A11 B;  4O45 A;  4DNW A;  4LG8 A;  3SN6 B;  2OIZ A;  3EQ8 A;  4FB1 D;  2I0S A;  4OZU A;  2VZ1 A;  4X61 B;  5HE1 B;  2QXV A;  4E54 A;  4CZV A;  5FXY A;  4UM9 A;  4PNK B;  1GOH A;  2VDM A;  3AFC A;  5AJA A;  4CZY A;  2YB8 B;  1UOP A;  2EIE A;  1TYQ C;  5CXC A;  4CI1 A;  4OWR A;  5B4W A;  3SFZ A;  2I3T A;  3MKS B;  3BWS A;  4MMX A;  4GZ8 A;  5FLX g;  1GG2 B;  2H6Q A;  4D9S A;  2YMU A;  4BL0 A;  1PGU A;  3ZWL B;  4K3I D;  4A0A A;  3DDU A;  5CYK A;  3SBP A;  1M1X A;  3AL8 B;  3OKW A;  3I7P A;  2IUV A;  4X3E A;  3JRO A;  4J82 A;  5AMS A;  3VGZ A;  4Z8L A;  4CY1 A;  4A2L A;  3MUO A;  4NEN A;  1BPO A;  1PEV A;  3IVM A;  3OL2 A;  1L5G A;  2EIC A;  3PXT D;  3GRE A;  4H5I A;  4LG9 A;  3ULE C;  1FWX A;  5HYN B;  5TEF A;  2OK4 A;  4JD2 C;  4L1M A;  3VI3 A;  2QR5 A;  2Z2N A;  2IWF A;  4O02 A;  4PSX B;  2I3S A;  4YVD A;  4A0B A;  5HE0 B;  4JHP C;  3J81 g;  1PI6 A;  3EQ7 A;  1U2V C;  2H68 A;  3GFC A;  2J56 H;  3FM0 A;  4RE5 A;  4E5Z B;  3CFV A;  2EBS A;  1U4C A;  3RFH A;  4IA9 A;  1K8K C;  2VDN A;  4XEI C;  4N14 A;  1JV2 A;  2YNN A;  5H17 A;  3B7F A;  3RN0 D;  1QNI A;  1VE6 A;  1A0R B;  2PM9 A;  4I79 A;  1H2Y A;  2VDR A;  5HE3 B;  3FCS A;  2W18 A;  4L9O A;  5I5J A;  2H9N A;  3O4G A;  4MMY A;  4D0K A;  3K26 A;  2TRC B;  2VDP A;  3OKY A;  4G1E A;  5HDB A;  3GC3 B;  4X63 B;  1UOO A;  4D6V A;  4NC4 A;  3DXM C;  1JJU B;  5M61 A;  4QT8 A;  3C99 A;  4Z7O A;  3IUQ A;  2OVQ B;  2O9K A;  3KRW B;  3I8C A;  4BCD A;  3AL8 A;  5K19 A;  2HU8 A;  1JTD B;  3MMY A;  2H47 A;  5IJ8 E;  5M5U A;  3F3P A;  2BCJ B;  4GGC A;  3EI3 B;  3OW8 A;  1GOT B;  4HDJ A;  3U4Y A;  4ZOX A;  4J79 A;  5EMM B;  4ES0 A;  3ODT A;  5GXI A;  4CZX A;  4ESG A;  3VI4 A;  5KDO B;  4AX4 A;  2P9L C;  2H6N A;  2G99 A;  1GOF A;  4ZOY A;  1T2X A;  2JKX A;  4IMM A;  2GC4 A;  3UVL A;  4FHL A;  2HU7 A;  5CXB B;  5C86 A;  3JPX A;  4ERY A;  2VC2 A;  3OKT A;  4PBZ A;  3EU7 A;  3ZDZ A;  1SHY B;  1XHM A;  5THA A;  2B4E A;  2OVR B;  1NR0 A;  4CC9 A;  5M5V A;  2IUP A;  3P4F A;  3RFG A;  3IIW A;  3EG6 A;  3SBQ A;  2XL3 A;  3C9C A;  4FA1 D;  1C9I A;  2HJ4 A;  3SXT D;  4GGA A;  4CI8 A;  2XL2 A;  4GQB B;  4MMZ A;  3UR4 A;  4PXW A;  3EI4 B;  4A08 B;  4BUJ C;  3UVM A;  3RSE C;  4L3G D;  4J8B A;  2Z2P A;  3T3P A;  1GOG A;  4CI3 A;  3IJC A;  5IJ7 E;  3UVO A;  3DSM A;  5EAR A;  3UVK A;  3EI2 A;  3V7D B;  5HQG A;  4BCC A;  2VDO A;  3JRP A;  4NBM A;  1QFM A;  3IUM A;  3V4P A;  2MTA H;  1MDA H;  1YR2 A;  4XYI A;  5GSA A;  1SQJ A;  3NVQ A;  3T3M A;  2AGL A;  1P22 A;  3JZH A;  3ZE2 A;  4U1E I;  4JHN A;  5EMJ B;  2HJB A;  3EI1 A;  2QZP A;  2IWK A;  3K71 A;  2H9M A;  4FWW A;  2AGW A;  2AGY A;  4R7A B;  2IUQ A;  4GM8 A;  5C92 A;  2P9S C;  2VDL A;  2EIB A;  3NID A;  4JSN C;  4QRJ A;  3SWS D;  1H2X A;  3ZE0 A;  4J73 A;  3VH0 A;  3GD1 I;  4A09 A;  4ZOZ A;  3DWL C;  4XYH A;  3J80 g;  4A11 A;  1MG3 A;  5FKR A;  2WQ8 A;  1XIP A;  5K1C C;  2XU7 A;  4BP9 A;  2AGX A;  3O4H A;  3EI4 A;  5FKT A;  5IC7 A;  5IGQ A;  2QC5 A;  4J87 A;  3V4V A;  4A2M A;  4WJK A;  1QFS A;  1UTC A;  3VA6 A;  4FAN D;  5FKS A;  4J84 A;  1S4U X;  3I2N A;  1N6D A;  1E8M A;  2BKL A;  1PBY B;  1GXR A;  3IJ1 A;  3CIK B;  2IAA A;  3AH8 B;  2OVP B;  1N6E A;  2J57 G;  4AOW A;  3UKU C;  3W15 A;  5JWZ A;  3I89 A;  1RI6 A;  3HFQ A;  1I2M B;  5EM2 B;  4X60 B;  3IUJ A;  5IT9 g;  4J8G A;  3DXK C;  3PVU B;  1E5T A;  4J77 A;  1VZ3 A;  4J0W A;  3AL9 A;  3I7K A;  4JSV C;  4QQE A;  4DNV A;  4L3H D;  2H3X A;  5E6R A;  2H6K A;  1B9X A;  4FA4 D;  2Q7Q A;  4LGN A;  4E54 B;  5TF2 A;  4ZN4 A;  4CY2 A;  4PC0 A;  2OJY A;  3PSC B;  4E5Z A;  5FA5 B;  4BH6 A;  2PM7 B;  2H9L A;  1C9L A;  1ERJ A;  5CXC B;  4G1M A;  4J0X A;  2H9P A;  3OTT A;  4A7J A;  5EAP A;  4WK2 A;  3F3G A;  4Y7R A;  4JSP C;  4O2W A;  4PBY A;  4A0A B;  2HKM A;  3JZG A;  5CYK B;  4GQ1 A;  5SXM A;  4GMB A;  4AMZ A;  4TZ4 A;  3N0D A;  3C5M A;  3F3F A;  3I8E A;  4IRZ A;  4RE6 A;  3O4J A;  2B5L A;  2XZG A;  4ERQ A;  4PSW B;  5A2Q g;  3E0C A;  3OL2 B;  2P9U C;  4JSX C;  1GP2 B;  4O3U B;  5EML B;  5C9Z B;  4O9D A;  3V5W B;  4ZOV A;  3OF7 A;  1U8C A;  1E8N A;  3PVW B;  2XDW A;  2XE4 A;  3MZL A;  2AH1 A;  5FFO A;  3PSL A;  3I7N A;  3IUR A;  4DNU A;  4QL1 A;  3RRM C;  4A0B B;  3MVD K;  4FAV D;  2YBA A;  3K72 A;  3EWE A;  2Z2O A;  5IGO A;  3EI3 A;  1TYE A;  1UOQ A;  1B9Y A;  3SLE D;  2OK6 A;  4AMY A;  3ORV D;  3IKO A;  5TEE A;  3JZN A;  2CE8 A;  5FFG A;  3IIY A;  2AGZ A;  2HXC A;  1XKS A;  2G9A A;  2PM9 B;  3NVN A;  4GM9 A;  2VDQ A;  1MG2 A;  5H1M A;  1O6F A;  4JT6 C;  1TBG A;  3CFS B;  3OKY B;  4O1Q D;  2VZ3 A;  4J81 A;  3JB9 L;  1N6F A;  5CXB A;  2BBK H;  3ZDX A;  4CY5 A;  2VDK A;  2GC7 A;  2EID A;  4CI2 A;  4G56 B;  3PE7 A;  4EWR A;  4JT5 C;  3NIG A;  4GGD A;  4U7A A;  3QHY B;  3V9F A;  1R5M A;  4K3J B;  2AQ5 A;  3MXX A;  3RN1 D;  4L1Q D;  4O3T B;  5I5M A;  1Q47 A;  4A08 A;  2YNP A;  3FCU A;  3MKQ A;  4AEZ A;  3DM0 A;  5EAM A;  5M5R A;  2HYE A;  4AN0 A;  3NIF A;  4KFM B;  3KCI A;  5HE2 B;  2HES X;  5TDH B;  2YNO A;  5FKQ A;  3MUN A; 
#chains in the Genus database with same CATH homology
 3C75 H;  3K27 A;  3N0E A;  3PXW D;  5GXH A;  3JAM g;  1SQ9 A;  1NEX B;  2H14 A;  3FRX A;  2AH0 A;  2J55 H;  2I0T A;  3I7L A;  2B5M A;  3NVX A;  4UI9 R;  1JMX B;  3L4M D;  4NSX A;  2HKR A;  2CO0 A;  4H5J A;  2UZY B;  2P9K C;  2CE9 A;  5H14 A;  3UVN A;  3BG1 A;  4MK0 B;  5AFU 3;  1K32 A;  1JMZ B;  1YFQ A;  1JOF A;  4JXM A;  1OMW B;  1VYH C;  2IUR A;  3FGB A;  2B5N A;  5FQD A;  3RLM D;  3A0F A;  3EI2 B;  4Y5R D;  3IJ0 A;  3RMZ D;  2GNQ A;  2PBI B;  2P9N C;  3I7H A;  2CN2 A;  4J78 A;  2I0R A;  5EAL A;  2P9P C;  3BG0 A;  3I7O A;  3SMR A;  2CO0 C;  2PM6 B;  3SBR A;  5C2W B;  3EI1 B;  2CNX A;  3KRX B;  3SJL D;  3MZK A;  2P9I C;  5I5I A;  3PXS D;  4CY3 A;  4GQ2 P;  5EM2 A;  2UZX B;  5EMK B;  2CN3 A;  3L4O D;  3EMH A;  4J86 A;  1L0Q A;  3SHF A;  2H13 A;  4GM3 A;  4FA5 D;  3UKR C;  3SCY A;  5C2V B;  5GMK n;  4ERZ A;  2XYI A;  4A09 B;  1OLZ A;  4FA9 D;  3SVW D;  4A11 B;  4O45 A;  4LG8 A;  3SN6 B;  2OIZ A;  4FB1 D;  2I0S A;  4OZU A;  4X61 B;  5HE1 B;  2QXV A;  4E54 A;  4CZV A;  5FXY A;  4PNK B;  3AFC A;  5AJA A;  4CZY A;  2YB8 B;  1TYQ C;  5CXC A;  4CI1 A;  4OWR A;  5B4W A;  3SFZ A;  2I3T A;  3MKS B;  3BWS A;  4GZ8 A;  5FLX g;  1GG2 B;  2H6Q A;  2YMU A;  4BL0 A;  1PGU A;  3ZWL B;  4K3I D;  4A0A A;  5CYK A;  3SBP A;  3AL8 B;  3OKW A;  3I7P A;  2IUV A;  4X3E A;  3JRO A;  4J82 A;  5AMS A;  3VGZ A;  4Z8L A;  4CY1 A;  4A2L A;  1PEV A;  3OL2 A;  3PXT D;  3GRE A;  4H5I A;  4LG9 A;  3ULE C;  1FWX A;  5HYN B;  5TEF A;  2OK4 A;  4JD2 C;  2Z2N A;  2IWF A;  4PSX B;  2I3S A;  4YVD A;  4A0B A;  5HE0 B;  3J81 g;  1PI6 A;  1U2V C;  2H68 A;  3GFC A;  2J56 H;  3FM0 A;  4E5Z B;  3CFV A;  2EBS A;  1U4C A;  3RFH A;  4IA9 A;  1K8K C;  4XEI C;  4N14 A;  5H17 A;  2YNN A;  3B7F A;  3RN0 D;  1QNI A;  2PM9 A;  1A0R B;  4I79 A;  5HE3 B;  2W18 A;  4L9O A;  5I5J A;  2H9N A;  4D0K A;  3K26 A;  2TRC B;  3OKY A;  4X63 B;  4D6V A;  3DXM C;  1JJU B;  4QT8 A;  3C99 A;  2OVQ B;  2O9K A;  3KRW B;  3I8C A;  3AL8 A;  5K19 A;  3MMY A;  2H47 A;  5IJ8 E;  3F3P A;  2BCJ B;  4GGC A;  3EI3 B;  3OW8 A;  1GOT B;  4HDJ A;  3U4Y A;  4ZOX A;  4J79 A;  5EMM B;  4ES0 A;  3ODT A;  5GXI A;  4CZX A;  4ESG A;  5KDO B;  2P9L C;  2H6N A;  2G99 A;  4ZOY A;  4IMM A;  2GC4 A;  3UVL A;  4FHL A;  5CXB B;  3JPX A;  4ERY A;  3OKT A;  4PBZ A;  3EU7 A;  1SHY B;  1XHM A;  5THA A;  2B4E A;  2OVR B;  1NR0 A;  4CC9 A;  2IUP A;  3P4F A;  3RFG A;  3IIW A;  3EG6 A;  3SBQ A;  2XL3 A;  3C9C A;  4FA1 D;  2HJ4 A;  3SXT D;  4GGA A;  4CI8 A;  2XL2 A;  4GQB B;  3UR4 A;  4A08 B;  4PXW A;  3EI4 B;  4BUJ C;  3UVM A;  3RSE C;  4L3G D;  4J8B A;  2Z2P A;  4CI3 A;  3IJC A;  5IJ7 E;  3UVO A;  3DSM A;  5EAR A;  3UVK A;  3EI2 A;  3V7D B;  5HQG A;  3JRP A;  2MTA H;  1MDA H;  4XYI A;  5GSA A;  1SQJ A;  3NVQ A;  2AGL A;  1P22 A;  3JZH A;  4U1E I;  5EMJ B;  2HJB A;  3EI1 A;  2IWK A;  2H9M A;  4FWW A;  2AGW A;  2AGY A;  4R7A B;  2IUQ A;  4GM8 A;  2P9S C;  4JSN C;  4QRJ A;  3SWS D;  4J73 A;  3VH0 A;  4A09 A;  4ZOZ A;  3DWL C;  4XYH A;  3J80 g;  4A11 A;  1MG3 A;  5FKR A;  5K1C C;  1XIP A;  2XU7 A;  2AGX A;  5FKT A;  3EI4 A;  5IC7 A;  5IGQ A;  2QC5 A;  4J87 A;  4A2M A;  3VA6 A;  4FAN D;  5FKS A;  4J84 A;  1S4U X;  3I2N A;  1N6D A;  1PBY B;  1GXR A;  3IJ1 A;  3CIK B;  2IAA A;  3AH8 B;  2OVP B;  1N6E A;  2J57 G;  4AOW A;  3UKU C;  3W15 A;  5JWZ A;  3I89 A;  1RI6 A;  3HFQ A;  5EM2 B;  4X60 B;  5IT9 g;  4J8G A;  3DXK C;  3PVU B;  4J77 A;  4J0W A;  3AL9 A;  3I7K A;  4JSV C;  4QQE A;  4L3H D;  2H3X A;  2H6K A;  1B9X A;  4FA4 D;  2Q7Q A;  4LGN A;  4E54 B;  5TF2 A;  4ZN4 A;  4CY2 A;  4PC0 A;  2OJY A;  3PSC B;  4E5Z A;  5FA5 B;  4BH6 A;  2PM7 B;  2H9L A;  1ERJ A;  5CXC B;  4J0X A;  2H9P A;  3OTT A;  4A7J A;  5EAP A;  4Y7R A;  3F3G A;  4JSP C;  4PBY A;  4A0A B;  2HKM A;  3JZG A;  5CYK B;  4GQ1 A;  5SXM A;  4GMB A;  4TZ4 A;  3N0D A;  3C5M A;  3F3F A;  3I8E A;  2B5L A;  4ERQ A;  4PSW B;  5A2Q g;  3E0C A;  3OL2 B;  2P9U C;  4JSX C;  1GP2 B;  4O3U B;  5EML B;  5C9Z B;  4O9D A;  3V5W B;  4ZOV A;  3PVW B;  3MZL A;  2AH1 A;  3PSL A;  3I7N A;  4QL1 A;  3RRM C;  4A0B B;  4FAV D;  2YBA A;  3EWE A;  2Z2O A;  5IGO A;  3EI3 A;  3SLE D;  1B9Y A;  2OK6 A;  3ORV D;  3IKO A;  5TEE A;  3JZN A;  2CE8 A;  3IIY A;  2AGZ A;  2HXC A;  1XKS A;  2G9A A;  2PM9 B;  3NVN A;  4GM9 A;  1MG2 A;  5H1M A;  4JT6 C;  1TBG A;  3CFS B;  3OKY B;  4O1Q D;  4J81 A;  3JB9 L;  1N6F A;  5CXB A;  2BBK H;  4CY5 A;  2GC7 A;  4CI2 A;  4G56 B;  3PE7 A;  4EWR A;  4JT5 C;  4GGD A;  4U7A A;  3V9F A;  1R5M A;  4K3J B;  2AQ5 A;  3MXX A;  3RN1 D;  4L1Q D;  4O3T B;  5I5M A;  1Q47 A;  4A08 A;  2YNP A;  3MKQ A;  4AEZ A;  3DM0 A;  5EAM A;  2HYE A;  4KFM B;  5HE2 B;  2HES X;  5TDH B;  2YNO A;  5FKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...