4ERQA

X-ray structure of wdr5-mll2 win motif peptide binary complex
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
304
structure length
304
Chain Sequence
b'VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Structural basis for WDR5 interaction (Win) motif recognition in human SET1 family histone methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transferase
total genus 103
structure length 304
sequence length 304
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4erqA00
2IURA 4CY3A 1SQJA 4ZOVA 4PXWA 2W18A 4R7AB 2HKMA 4JT6C 3IJ1A 5EMJB 2B4EA 2J56H 1K32A 2I0TA 4J82A 4A11A 4AEZA 5FLXg 3I7LA 1L0QA 2GC7A 3PE7A 3PSLA 2H47A 2YNOA 3UVNA 5KDOB 2TRCB 5HE2B 4JSXC 1FWXA 4PBZA 4LGNA 3U4YA 3SBRA 3N0DA 3EI2B 3SFZA 2B5NA 2OK4A 3VGZA 2H3XA 2AQ5A 3SVWD 4LG8A 2P9NC 2IAAA 2GNQA 4FAVD 1JJUB 2HESX 5EM2B 3KRWB 3OTTA 1XHMA 5AJAA 3W15A 4XEIC 5IGQA 2CO0A 1JMZB 3VA6A 3OW8A 4AOWA 4A09B 3J80g 3K27A 5CXBA 4A0BA 3RMZD 4J84A 3UKRC 3GREA 4FA5D 1K8KC 3MMYA 4I79A 1NEXB 4L3HD 4O1QD 1PEVA 3OKYA 4PNKB 4ERYA 4CI1A 3UVLA 1PBYB 3EWEA 2YNPA 4K3JB 1OMWB 5HE1B 4A0AB 3JB9L 1GP2B 4HDJA 1GG2B 3OKTA 3IIWA 5IGOA 4Y7RA 2AGXA 3SJLD 4CI8A 2H6NA 4O45A 2Z2OA 5TEFA 4CY2A 3MKQA 2GC4A 4JXMA 2XL3A 3PXTD 3JZHA 4JSNC 3IJCA 4MK0B 3SBPA 4E5ZA 4CY1A 1JOFA 2QXVA 4X61B 5CXCA 5GSAA 3RFHA 2I0SA 2P9PC 4FA1D 2XU7A 4E54A 2OVPB 3BWSA 4Y5RD 4L3GD 3V9FA 4OWRA 2PM9B 1VYHC 3EI4A 1PI6A 3E0CA 5HE3B 2CNXA 4XYHA 2J57G 4IMMA 1N6EA 3OL2A 2AH1A 3DM0A 3ORVD 4CZXA 3V5WB 3C75H 4U7AA 4FA4D 2YB8B 1TBGA 2CE9A 1B9YA 3NVXA 4BL0A 1U2VC 3I7HA 2H6KA 1OLZA 3CFSB 2Z2NA 5H14A 2AGYA 2H13A 2H9MA 4CZVA 5I5IA 4GM3A 2YMUA 1GOTB 4GQ1A 5THAA 2XL2A 1JMXB 2IWFA 4J0XA 5FKQA 3V7DB 4A11B 3EG6A 5TDHB 3BG1A 4A7JA 1YFQA 4GGAA 3FRXA 5CYKA 3UR4A 3SCYA 2IUVA 4QL1A 3JZNA 1NR0A 3IKOA 4GM8A 2BCJB 4J8GA 2H6QA 1S4UX 2O9KA 3C5MA 1GXRA 3JRPA 4LG9A 2CO0C 2AGWA 3SMRA 4O3UB 1XKSA 4JD2C 3NVNA 3RFGA 4ERZA 4ZOZA 5TEEA 4X63B 3JZGA 4X60B 3I7NA 2I0RA 5EMKB 4FAND 3I89A 5CXBB 1RI6A 2H9PA 4XYIA 3AL8B 4A0BB 4O3TB 4BH6A 3AH8B 1A0RB 1ERJA 5HQGA 4GZ8A 3L4MD 4TZ4A 4IA9A 3OKYB 4JT5C 3I8CA 4D0KA 4KFMB 5FKSA 5I5JA 4PSXB 5A2Qg 4QQEA 4GQ2P 1MG2A 3I8EA 3PSCB 4D6VA 3HFQA 3MXXA 3I7PA 3I2NA 2G9AA 3DXKC 3RSEC 2OVQB 5K1CC 1R5MA 3DWLC 5TF2A 5GMKn 3EMHA 4E5ZB 4O9DA 3F3FA 4QRJA 5CXCB 4E54B 4J8BA 3PXWD 2B5LA 3RN1D 3EI4B 2QC5A 3NVQA 2OK6A 3JPXA 4CY5A 2B5MA 3OL2B 4CI2A 4PC0A 3EI3A 3GFCA 2I3SA 5EARA 5FKRA 2HXCA 1B9XA 4J77A 4U1EI 4J79A 4GGCA 5HE0B 2CE8A 2AGZA 5JWZA 1Q47A 3UVMA 4ZOYA 3SHFA 3CFVA 3L4OD 5C9ZB 2OJYA 3RLMD 3UKUC 5C2WB 2H9NA 2YBAA 2P9UC 4CC9A 4ES0A 4FHLA 4ERQA 3MZKA 4Z8LA 5CYKB 3UVOA 2AGLA 4K3ID 4UI9R 3SLED 5GXIA 1MDAH 1U4CA 2MTAH 2G99A 3KRXB 2PM6B 4J86A 3EI1A 4J78A 2HJ4A 2HJBA 3DXMC 4OZUA 3IJ0A 3F3GA 3C9CA 4J81A 4CI3A 4FB1D 2PM7B 3ODTA 1SHYB 3PVUB 4A2LA 4H5JA 4A08A 2J55H 2H9LA 3I7KA 2IUQA 4H5IA 4FWWA 1MG3A 5C2VB 4N14A 2HKRA 5SXMA 1N6DA 5FXYA 2UZXB 4ZN4A 1P22A 4JSPC 4A2MA 3P4FA 3JROA 3VH0A 3RRMC 3J81g 3CIKB 5AFU3 2P9LC 2OVRB 5K19A 5EMLB 5EAPA 4J73A 5IC7A 4PBYA 4GQBB 3JAMg 3AL9A 2BBKH 3MZLA 3SWSD 2HYEA 2IUPA 2CN2A 2I3TA 5FQDA 4JSVC 3SXTD 3MKSB 3EI2A 2EBSA 4GMBA 4L9OA 4X3EA 2IWKA 3DSMA 4G56B 4ESGA 4L1QD 4CZYA 5EM2A 1QNIA 5H17A 5GXHA 3N0EA 1TYQC 2CN3A 3AL8A 3PXSD 4YVDA 5AMSA 5IJ8E 4EWRA 4A09A 3F3PA 2OIZA 2H14A 3FGBA 5I5MA 3EI3B 3AFCA 5B4WA 3FM0A 4PSWB 2UZYB 3RN0D 5EMMB 3PVWB 2H68A 5HYNB 4QT8A 4FA9D 5H1MA 5IJ7E 4A0AA 2XYIA 4GGDA 3EU7A 1SQ9A 5EALA 2Q7QA 4ZOXA 2P9KC 5IT9g 3A0FA 3SBQA 3B7FA 2YNNA 4J87A 3IIYA 3K26A 3BG0A 1PGUA 5FA5B 3ZWLB 2PBIB 3EI1B 3C99A 3I7OA 5EAMA 2PM9A 5FKTA 1N6FA 4GM9A 2AH0A 4J0WA 4BUJC 3UVKA 2P9SC 3OKWA 4A08B 3SN6B 3ULEC 2Z2PA 4NSXA 2P9IC 1XIPA
chains in the Genus database with same CATH superfamily
2IURA 4CY3A 1U8CA 1SQJA 4ZOVA 4PXWA 2W18A 4R7AB 2HKMA 4JT6C 3IJ1A 5EMJB 3V4VA 2B4EA 2J56H 1K32A 2VDOA 2I0TA 4J82A 5E6RA 2VDNA 4A11A 4AEZA 5FLXg 4DNVA 3I7LA 2VDLA 1L0QA 2GC7A 3PE7A 3PSLA 2H47A 2YNOA 3UVNA 5KDOB 2TRCB 5HE2B 3IUQA 4JSXC 1FWXA 5M5SA 4PBZA 4LGNA 3U4YA 3ZDZA 4AN1A 3SBRA 3N0DA 4MMYA 3EI2B 3SFZA 2B5NA 2OK4A 3VGZA 2H3XA 2AQ5A 3SVWD 4LG8A 2P9NC 4WK2A 2IAAA 2GNQA 1GOGA 1JJUB 2HESX 3O4IA 4FAVD 5EM2B 5C86A 3KRWB 3EQ9A 2HU8A 4NAAA 3IUNA 3OTTA 1XHMA 5AJAA 3W15A 3MUNA 3MVDK 4XEIC 5IGQA 2CO0A 1JMZB 3VA6A 1M1XA 2XDWA 3IURA 3OW8A 4AOWA 1K3IA 4A09B 3J80g 3K27A 5CXBA 4A0BA 3QI0A 1UOPA 3RMZD 4J84A 3UKRC 5E6UA 3GREA 3FCSA 4FA5D 1K8KC 4G1EA 3MMYA 4I79A 1NEXB 4L3HD 4O1QD 1PEVA 3OKYA 4PNKB 4MMZA 4ERYA 4CI1A 3UVLA 1PBYB 4AX4A 3EWEA 3ZE1A 2YNPA 4K3JB 1OMWB 5HE1B 4A0AB 5C92A 1GP2B 3JB9L 3EQ7A 4HDJA 1GG2B 3OKTA 3VI3A 3IIWA 5IGOA 4NBMA 4Y7RA 2AGXA 3SJLD 4CI8A 2H6NA 4O45A 2Z2OA 5TEFA 4CY2A 3MKQA 2GC4A 4JXMA 2XL3A 3PXTD 3JZHA 2VDPA 3IJCA 4JSNC 4MK0B 3SBPA 4E5ZA 1QFMA 4CY1A 1JOFA 2QXVA 4X61B 5CXCA 5GSAA 3RFHA 4Z7QA 2I0SA 4WK0A 2P9PC 4FA1D 2XU7A 4E54A 2OVPB 3BWSA 4Y5RD 4L3GD 1O6FA 3V9FA 2PM9B 4OWRA 1VYHC 3EI4A 1PI6A 3E0CA 5HE3B 2CNXA 4XYHA 2J57G 3IULA 4IMMA 1N6EA 3OL2A 2AH1A 3DM0A 3ORVD 4CZXA 3V5WB 3C75H 4U7AA 4FA4D 2YB8B 1TBGA 2CE9A 1B9YA 3NVXA 5HDBA 1I2MB 3QHYB 4BL0A 1U2VC 3I7HA 2H6KA 1OLZA 3CFSB 2Z2NA 5H14A 2AGYA 2H13A 2H9MA 4CZVA 2EICA 5I5IA 4GM3A 2YMUA 1GOTB 4GQ1A 5THAA 2XL2A 1JMXB 2IWFA 4J0XA 3ZDYA 5FKQA 5M5VA 1VE7A 3V7DB 4A11B 3EG6A 5M5RA 4QAMA 5TDHB 3BG1A 4A7JA 1YFQA 4GGAA 1VZ3A 3FRXA 2VDRA 5CYKA 4DNWA 3UR4A 3SCYA 2IUVA 4QL1A 3JZNA 1NR0A 3IKOA 4GM8A 4Z7OA 3IVMA 2BCJB 2VDMA 4J8GA 2H6QA 4AN0A 1S4UX 2O9KA 3C5MA 1GXRA 3JRPA 4LG9A 2CO0C 4AMZA 1YR2A 2AGWA 1GOHA 3SMRA 4O3UB 1XKSA 4JD2C 1UOQA 5FFGA 3NVNA 1H2YA 2XZGA 3RFGA 1GOFA 4ERZA 4ZOZA 5TEEA 4X63B 3JZGA 4X60B 1C9LA 3I7NA 2I0RA 5EMKB 4FAND 3I89A 4JHPC 5CXBB 1RI6A 1E8NA 2H9PA 4XYIA 2VDQA 3AL8B 4A0BB 4G1MA 4O3TB 4BH6A 3AH8B 1A0RB 1ERJA 3FCUA 5HQGA 4GZ8A 2HU5A 3L4MD 4TZ4A 1VZ2A 4IA9A 3OKYB 4JT5C 3I8CA 1E8MA 3ZE2A 4D0KA 4KFMB 1H2ZA 3GC3B 5FKSA 5I5JA 4PSXB 5A2Qg 4QQEA 2HU7A 4GQ2P 1MG2A 3K71A 1UOOA 3I8EA 3PSCB 3IUJA 3EQ8A 4NC4A 4D6VA 3HFQA 3MXXA 3I7PA 3I2NA 2G9AA 3DXKC 3RSEC 2OVQB 1JV2A 1R5MA 3DWLC 5K1CC 5TF2A 5GMKn 3EMHA 4E5ZB 4O9DA 4MMXA 3F3FA 4QRJA 5CXCB 3V4PA 3VI4A 4E54B 4D9SA 4J8BA 3PXWD 2B5LA 3RN1D 3EI4B 2QC5A 3NVQA 2OK6A 3JPXA 4CY5A 2B5MA 3OL2B 4CI2A 4UM8A 4PC0A 3EI3A 3K6SA 3GFCA 2I3SA 5EARA 5FKRA 3O4HA 2HXCA 4BP9A 1B9XA 4J77A 4BP8A 4U1EI 4J79A 4GGCA 5HE0B 2CE8A 2AGZA 5JWZA 1Q47A 4G55A 3UVMA 4ZOYA 5M5TA 3SHFA 4BCDA 3CFVA 3GD1I 3L4OD 2OJYA 3RLMD 3UKUC 5C2WB 5C9ZB 1H2WA 1A12A 2H9NA 1VE6A 3NIDA 4AMYA 2YBAA 2P9UC 4CC9A 4Z7NA 4ES0A 4FHLA 4ERQA 3MZKA 4Z8LA 3K72A 5CYKB 3UVOA 1C9IA 2AGLA 2VZ3A 4K3ID 4UI9R 3SLED 5GXIA 1MDAH 1U4CA 2MTAH 2G99A 3KRXB 1E5TA 2PM6B 4J86A 2JKXA 3EI1A 4J78A 5M61A 3T3MA 2HJ4A 2HJBA 3DXMC 4OZUA 3IJ0A 4IRZA 3F3GA 3C9CA 4J81A 4CI3A 4FB1D 2PM7B 3ODTA 1SHYB 3PVUB 4A2LA 4RE5A 4H5JA 4A08A 2J55H 2H9LA 4L1MA 3I7KA 1L5GA 2IUQA 3ZDXA 4H5IA 4FWWA 1MG3A 2BKLA 5C2VB 3IJEA 4N14A 2HKRA 1JTDB 3NIGA 5SXMA 1N6DA 5FXYA 2EIDA 2UZXB 4ZN4A 1P22A 4JSPC 4A2MA 3P4FA 3JROA 3VH0A 3RRMC 3J81g 3CIKB 5AFU3 2P9LC 2OVRB 5K19A 5EMLB 5EAPA 4J73A 5IC7A 4PBYA 4GQBB 3JAMg 3AL9A 2BBKH 3MZLA 3SWSD 2EIBA 2HYEA 2IUPA 2CN2A 2I3TA 5FQDA 4JSVC 5M5UA 4JHNA 4O2WA 3SXTD 3MKSB 3EI2A 2VDKA 3ZE0A 2EBSA 1BPOA 4GMBA 4L9OA 4X3EA 5E6SA 2IWKA 4UM9A 3DSMA 4G56B 4ESGA 3MUOA 4L1QD 4CZYA 4BCCA 5FFOA 5EM2A 1QNIA 5H17A 5GXHA 3N0EA 3IUMA 3O4JA 1TYQC 2CN3A 3AL8A 2XE4A 3PXSD 4YVDA 5AMSA 2QZPA 5IJ8E 4RE6A 4EWRA 2QR5A 2WQ8A 4A09A 3F3PA 1TYEA 2OIZA 2H14A 3FGBA 2VZ1A 5I5MA 3EI3B 3AFCA 5B4WA 2EIEA 3FM0A 4PSWB 2UZYB 4WJKA 3RN0D 4DNUA 5EMMB 3PVWB 3OF7A 3KCIA 2H68A 3NIFA 5HYNB 4QT8A 2VC2A 4O02A 4BCBA 4FA9D 5H1MA 5IJ7E 4A0AA 2XYIA 4GGDA 3EU7A 1SQ9A 5EALA 1H2XA 1UTCA 2Q7QA 4ZOXA 2P9KC 5IT9g 3A0FA 3SBQA 3B7FA 2YNNA 4J87A 3IIYA 3K26A 3BG0A 4NENA 1PGUA 5FA5B 1O6GA 3ZWLB 2PBIB 3EI1B 3C99A 3I7OA 1QFSA 2PM9A 5EAMA 5FKTA 1N6FA 4GM9A 2AH0A 3O4GA 4J0WA 4BUJC 3UVKA 4WK4A 2P9SC 3OKWA 3DDUA 4A08B 3SN6B 3T3PA 3ULEC 2Z2PA 1T2XA 4NSXA 2P9IC 1XIPA
chains in the Genus database with same CATH topology
2IURA 4CY3A 1SQJA 4ZOVA 4PXWA 2W18A 4R7AB 2HKMA 4JT6C 3IJ1A 5EMJB 2B4EA 2J56H 1K32A 2I0TA 4J82A 4A11A 4AEZA 5FLXg 3I7LA 1L0QA 2GC7A 3PE7A 3PSLA 2H47A 2YNOA 3UVNA 5KDOB 2TRCB 5HE2B 4JSXC 1FWXA 4PBZA 4LGNA 3U4YA 3SBRA 3N0DA 3EI2B 3SFZA 2B5NA 2OK4A 3VGZA 2H3XA 2AQ5A 3SVWD 4LG8A 2P9NC 2IAAA 2GNQA 4FAVD 1JJUB 2HESX 5EM2B 3KRWB 3OTTA 1XHMA 5AJAA 3W15A 4XEIC 5IGQA 2CO0A 1JMZB 3VA6A 3OW8A 4AOWA 4A09B 3J80g 3K27A 5CXBA 4A0BA 3RMZD 4J84A 3UKRC 3GREA 4FA5D 1K8KC 3MMYA 4I79A 1NEXB 4L3HD 4O1QD 1PEVA 3OKYA 4PNKB 4ERYA 4CI1A 3UVLA 1PBYB 3EWEA 2YNPA 4K3JB 1OMWB 5HE1B 4A0AB 3JB9L 1GP2B 4HDJA 1GG2B 3OKTA 3IIWA 5IGOA 4Y7RA 2AGXA 3SJLD 4CI8A 2H6NA 4O45A 2Z2OA 5TEFA 4CY2A 3MKQA 2GC4A 4JXMA 2XL3A 3PXTD 3JZHA 4JSNC 3IJCA 4MK0B 3SBPA 4E5ZA 4CY1A 1JOFA 2QXVA 4X61B 5CXCA 5GSAA 3RFHA 2I0SA 2P9PC 4FA1D 2XU7A 4E54A 2OVPB 3BWSA 4Y5RD 4L3GD 3V9FA 4OWRA 2PM9B 1VYHC 3EI4A 1PI6A 3E0CA 5HE3B 2CNXA 4XYHA 2J57G 4IMMA 1N6EA 3OL2A 2AH1A 3DM0A 3ORVD 4CZXA 3V5WB 3C75H 4U7AA 4FA4D 2YB8B 1TBGA 2CE9A 1B9YA 3NVXA 4BL0A 1U2VC 3I7HA 2H6KA 1OLZA 3CFSB 2Z2NA 5H14A 2AGYA 2H13A 2H9MA 4CZVA 5I5IA 4GM3A 2YMUA 1GOTB 4GQ1A 5THAA 2XL2A 1JMXB 2IWFA 4J0XA 5FKQA 3V7DB 4A11B 3EG6A 5TDHB 3BG1A 4A7JA 1YFQA 4GGAA 3FRXA 5CYKA 3UR4A 3SCYA 2IUVA 4QL1A 3JZNA 1NR0A 3IKOA 4GM8A 2BCJB 4J8GA 2H6QA 1S4UX 2O9KA 3C5MA 1GXRA 3JRPA 4LG9A 2CO0C 2AGWA 3SMRA 4O3UB 1XKSA 4JD2C 3NVNA 3RFGA 4ERZA 4ZOZA 5TEEA 4X63B 3JZGA 4X60B 3I7NA 2I0RA 5EMKB 4FAND 3I89A 5CXBB 1RI6A 2H9PA 4XYIA 3AL8B 4A0BB 4O3TB 4BH6A 3AH8B 1A0RB 1ERJA 5HQGA 4GZ8A 3L4MD 4TZ4A 4IA9A 3OKYB 4JT5C 3I8CA 4D0KA 4KFMB 5FKSA 5I5JA 4PSXB 5A2Qg 4QQEA 4GQ2P 1MG2A 3I8EA 3PSCB 4D6VA 3HFQA 3MXXA 3I7PA 3I2NA 2G9AA 3DXKC 3RSEC 2OVQB 5K1CC 1R5MA 3DWLC 5TF2A 5GMKn 3EMHA 4E5ZB 4O9DA 3F3FA 4QRJA 5CXCB 4E54B 4J8BA 3PXWD 2B5LA 3RN1D 3EI4B 2QC5A 3NVQA 2OK6A 3JPXA 4CY5A 2B5MA 3OL2B 4CI2A 4PC0A 3EI3A 3GFCA 2I3SA 5EARA 5FKRA 2HXCA 1B9XA 4J77A 4U1EI 4J79A 4GGCA 5HE0B 2CE8A 2AGZA 5JWZA 1Q47A 3UVMA 4ZOYA 3SHFA 3CFVA 3L4OD 5C9ZB 2OJYA 3RLMD 3UKUC 5C2WB 2H9NA 2YBAA 2P9UC 4CC9A 4ES0A 4FHLA 4ERQA 3MZKA 4Z8LA 5CYKB 3UVOA 2AGLA 4K3ID 4UI9R 3SLED 5GXIA 1MDAH 1U4CA 2MTAH 2G99A 3KRXB 2PM6B 4J86A 3EI1A 4J78A 2HJ4A 2HJBA 3DXMC 4OZUA 3IJ0A 3F3GA 3C9CA 4J81A 4CI3A 4FB1D 2PM7B 3ODTA 1SHYB 3PVUB 4A2LA 4H5JA 4A08A 2J55H 2H9LA 3I7KA 2IUQA 4H5IA 4FWWA 1MG3A 5C2VB 4N14A 2HKRA 5SXMA 1N6DA 5FXYA 2UZXB 4ZN4A 1P22A 4JSPC 4A2MA 3P4FA 3JROA 3VH0A 3RRMC 3J81g 3CIKB 5AFU3 2P9LC 2OVRB 5K19A 5EMLB 5EAPA 4J73A 5IC7A 4PBYA 4GQBB 3JAMg 3AL9A 2BBKH 3MZLA 3SWSD 2HYEA 2IUPA 2CN2A 2I3TA 5FQDA 4JSVC 3SXTD 3MKSB 3EI2A 2EBSA 4GMBA 4L9OA 4X3EA 2IWKA 3DSMA 4G56B 4ESGA 4L1QD 4CZYA 5EM2A 1QNIA 5H17A 5GXHA 3N0EA 1TYQC 2CN3A 3AL8A 3PXSD 4YVDA 5AMSA 5IJ8E 4EWRA 4A09A 3F3PA 2OIZA 2H14A 3FGBA 5I5MA 3EI3B 3AFCA 5B4WA 3FM0A 4PSWB 2UZYB 3RN0D 5EMMB 3PVWB 2H68A 5HYNB 4QT8A 4FA9D 5H1MA 5IJ7E 4A0AA 2XYIA 4GGDA 3EU7A 1SQ9A 5EALA 2Q7QA 4ZOXA 2P9KC 5IT9g 3A0FA 3SBQA 3B7FA 2YNNA 4J87A 3IIYA 3K26A 3BG0A 1PGUA 5FA5B 3ZWLB 2PBIB 3EI1B 3C99A 3I7OA 5EAMA 2PM9A 5FKTA 1N6FA 4GM9A 2AH0A 4J0WA 4BUJC 3UVKA 2P9SC 3OKWA 4A08B 3SN6B 3ULEC 2Z2PA 4NSXA 2P9IC 1XIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUR A;  4CY3 A;  1SQJ A;  4ZOV A;  4PXW A;  2W18 A;  4R7A B;  2HKM A;  4JT6 C;  3IJ1 A;  5EMJ B;  2B4E A;  2J56 H;  1K32 A;  2I0T A;  4J82 A;  4A11 A;  4AEZ A;  5FLX g;  3I7L A;  1L0Q A;  2GC7 A;  3PE7 A;  3PSL A;  2H47 A;  2YNO A;  3UVN A;  5KDO B;  2TRC B;  5HE2 B;  4JSX C;  1FWX A;  4PBZ A;  4LGN A;  3U4Y A;  3SBR A;  3N0D A;  3EI2 B;  3SFZ A;  2B5N A;  2OK4 A;  3VGZ A;  2H3X A;  2AQ5 A;  3SVW D;  4LG8 A;  2P9N C;  2IAA A;  2GNQ A;  4FAV D;  1JJU B;  2HES X;  5EM2 B;  3KRW B;  3OTT A;  1XHM A;  5AJA A;  3W15 A;  4XEI C;  5IGQ A;  2CO0 A;  1JMZ B;  3VA6 A;  3OW8 A;  4AOW A;  4A09 B;  3J80 g;  3K27 A;  5CXB A;  4A0B A;  3RMZ D;  4J84 A;  3UKR C;  3GRE A;  4FA5 D;  1K8K C;  3MMY A;  4I79 A;  1NEX B;  4L3H D;  4O1Q D;  1PEV A;  3OKY A;  4PNK B;  4ERY A;  4CI1 A;  3UVL A;  1PBY B;  3EWE A;  2YNP A;  4K3J B;  1OMW B;  5HE1 B;  4A0A B;  3JB9 L;  1GP2 B;  4HDJ A;  1GG2 B;  3OKT A;  3IIW A;  5IGO A;  4Y7R A;  2AGX A;  3SJL D;  4CI8 A;  2H6N A;  4O45 A;  2Z2O A;  5TEF A;  4CY2 A;  3MKQ A;  2GC4 A;  4JXM A;  2XL3 A;  3PXT D;  3JZH A;  4JSN C;  3IJC A;  4MK0 B;  3SBP A;  4E5Z A;  4CY1 A;  1JOF A;  2QXV A;  4X61 B;  5CXC A;  5GSA A;  3RFH A;  2I0S A;  2P9P C;  4FA1 D;  2XU7 A;  4E54 A;  2OVP B;  3BWS A;  4Y5R D;  4L3G D;  3V9F A;  4OWR A;  2PM9 B;  1VYH C;  3EI4 A;  1PI6 A;  3E0C A;  5HE3 B;  2CNX A;  4XYH A;  2J57 G;  4IMM A;  1N6E A;  3OL2 A;  2AH1 A;  3DM0 A;  3ORV D;  4CZX A;  3V5W B;  3C75 H;  4U7A A;  4FA4 D;  2YB8 B;  1TBG A;  2CE9 A;  1B9Y A;  3NVX A;  4BL0 A;  1U2V C;  3I7H A;  2H6K A;  1OLZ A;  3CFS B;  2Z2N A;  5H14 A;  2AGY A;  2H13 A;  2H9M A;  4CZV A;  5I5I A;  4GM3 A;  2YMU A;  1GOT B;  4GQ1 A;  5THA A;  2XL2 A;  1JMX B;  2IWF A;  4J0X A;  5FKQ A;  3V7D B;  4A11 B;  3EG6 A;  5TDH B;  3BG1 A;  4A7J A;  1YFQ A;  4GGA A;  3FRX A;  5CYK A;  3UR4 A;  3SCY A;  2IUV A;  4QL1 A;  3JZN A;  1NR0 A;  3IKO A;  4GM8 A;  2BCJ B;  4J8G A;  2H6Q A;  1S4U X;  2O9K A;  3C5M A;  1GXR A;  3JRP A;  4LG9 A;  2CO0 C;  2AGW A;  3SMR A;  4O3U B;  1XKS A;  4JD2 C;  3NVN A;  3RFG A;  4ERZ A;  4ZOZ A;  5TEE A;  4X63 B;  3JZG A;  4X60 B;  3I7N A;  2I0R A;  5EMK B;  4FAN D;  3I89 A;  5CXB B;  1RI6 A;  2H9P A;  4XYI A;  3AL8 B;  4A0B B;  4O3T B;  4BH6 A;  3AH8 B;  1A0R B;  1ERJ A;  5HQG A;  4GZ8 A;  3L4M D;  4TZ4 A;  4IA9 A;  3OKY B;  4JT5 C;  3I8C A;  4D0K A;  4KFM B;  5FKS A;  5I5J A;  4PSX B;  5A2Q g;  4QQE A;  4GQ2 P;  1MG2 A;  3I8E A;  3PSC B;  4D6V A;  3HFQ A;  3MXX A;  3I7P A;  3I2N A;  2G9A A;  3DXK C;  3RSE C;  2OVQ B;  5K1C C;  1R5M A;  3DWL C;  5TF2 A;  5GMK n;  3EMH A;  4E5Z B;  4O9D A;  3F3F A;  4QRJ A;  5CXC B;  4E54 B;  4J8B A;  3PXW D;  2B5L A;  3RN1 D;  3EI4 B;  2QC5 A;  3NVQ A;  2OK6 A;  3JPX A;  4CY5 A;  2B5M A;  3OL2 B;  4CI2 A;  4PC0 A;  3EI3 A;  3GFC A;  2I3S A;  5EAR A;  5FKR A;  2HXC A;  1B9X A;  4J77 A;  4U1E I;  4J79 A;  4GGC A;  5HE0 B;  2CE8 A;  2AGZ A;  5JWZ A;  1Q47 A;  3UVM A;  4ZOY A;  3SHF A;  3CFV A;  3L4O D;  5C9Z B;  2OJY A;  3RLM D;  3UKU C;  5C2W B;  2H9N A;  2YBA A;  2P9U C;  4CC9 A;  4ES0 A;  4FHL A;  4ERQ A;  3MZK A;  4Z8L A;  5CYK B;  3UVO A;  2AGL A;  4K3I D;  4UI9 R;  3SLE D;  5GXI A;  1MDA H;  1U4C A;  2MTA H;  2G99 A;  3KRX B;  2PM6 B;  4J86 A;  3EI1 A;  4J78 A;  2HJ4 A;  2HJB A;  3DXM C;  4OZU A;  3IJ0 A;  3F3G A;  3C9C A;  4J81 A;  4CI3 A;  4FB1 D;  2PM7 B;  3ODT A;  1SHY B;  3PVU B;  4A2L A;  4H5J A;  4A08 A;  2J55 H;  2H9L A;  3I7K A;  2IUQ A;  4H5I A;  4FWW A;  1MG3 A;  5C2V B;  4N14 A;  2HKR A;  5SXM A;  1N6D A;  5FXY A;  2UZX B;  4ZN4 A;  1P22 A;  4JSP C;  4A2M A;  3P4F A;  3JRO A;  3VH0 A;  3RRM C;  3J81 g;  3CIK B;  5AFU 3;  2P9L C;  2OVR B;  5K19 A;  5EML B;  5EAP A;  4J73 A;  5IC7 A;  4PBY A;  4GQB B;  3JAM g;  3AL9 A;  2BBK H;  3MZL A;  3SWS D;  2HYE A;  2IUP A;  2CN2 A;  2I3T A;  5FQD A;  4JSV C;  3SXT D;  3MKS B;  3EI2 A;  2EBS A;  4GMB A;  4L9O A;  4X3E A;  2IWK A;  3DSM A;  4G56 B;  4ESG A;  4L1Q D;  4CZY A;  5EM2 A;  1QNI A;  5H17 A;  5GXH A;  3N0E A;  1TYQ C;  2CN3 A;  3AL8 A;  3PXS D;  4YVD A;  5AMS A;  5IJ8 E;  4EWR A;  4A09 A;  3F3P A;  2OIZ A;  2H14 A;  3FGB A;  5I5M A;  3EI3 B;  3AFC A;  5B4W A;  3FM0 A;  4PSW B;  2UZY B;  3RN0 D;  5EMM B;  3PVW B;  2H68 A;  5HYN B;  4QT8 A;  4FA9 D;  5H1M A;  5IJ7 E;  4A0A A;  2XYI A;  4GGD A;  3EU7 A;  1SQ9 A;  5EAL A;  2Q7Q A;  4ZOX A;  2P9K C;  5IT9 g;  3A0F A;  3SBQ A;  3B7F A;  2YNN A;  4J87 A;  3IIY A;  3K26 A;  3BG0 A;  1PGU A;  5FA5 B;  3ZWL B;  2PBI B;  3EI1 B;  3C99 A;  3I7O A;  5EAM A;  2PM9 A;  5FKT A;  1N6F A;  4GM9 A;  2AH0 A;  4J0W A;  4BUJ C;  3UVK A;  2P9S C;  3OKW A;  4A08 B;  3SN6 B;  3ULE C;  2Z2P A;  4NSX A;  2P9I C;  1XIP A; 
#chains in the Genus database with same CATH topology
 2IUR A;  4CY3 A;  1U8C A;  1SQJ A;  4ZOV A;  4PXW A;  2W18 A;  4R7A B;  2HKM A;  4JT6 C;  3IJ1 A;  5EMJ B;  3V4V A;  2B4E A;  2J56 H;  1K32 A;  2VDO A;  2I0T A;  4J82 A;  5E6R A;  2VDN A;  4A11 A;  4AEZ A;  5FLX g;  4DNV A;  3I7L A;  2VDL A;  1L0Q A;  2GC7 A;  3PE7 A;  3PSL A;  2H47 A;  2YNO A;  3UVN A;  5KDO B;  2TRC B;  5HE2 B;  3IUQ A;  4JSX C;  1FWX A;  5M5S A;  4PBZ A;  4LGN A;  3U4Y A;  3ZDZ A;  4AN1 A;  3SBR A;  3N0D A;  4MMY A;  3EI2 B;  3SFZ A;  2B5N A;  2OK4 A;  3VGZ A;  2H3X A;  2AQ5 A;  3SVW D;  4LG8 A;  2P9N C;  4WK2 A;  2IAA A;  2GNQ A;  1GOG A;  1JJU B;  2HES X;  3O4I A;  4FAV D;  5EM2 B;  5C86 A;  3KRW B;  3EQ9 A;  2HU8 A;  4NAA A;  3IUN A;  3OTT A;  1XHM A;  5AJA A;  3W15 A;  3MUN A;  3MVD K;  4XEI C;  5IGQ A;  2CO0 A;  1JMZ B;  3VA6 A;  1M1X A;  2XDW A;  3IUR A;  3OW8 A;  4AOW A;  1K3I A;  4A09 B;  3J80 g;  3K27 A;  5CXB A;  4A0B A;  3QI0 A;  1UOP A;  3RMZ D;  4J84 A;  3UKR C;  5E6U A;  3GRE A;  3FCS A;  4FA5 D;  1K8K C;  4G1E A;  3MMY A;  4I79 A;  1NEX B;  4L3H D;  4O1Q D;  1PEV A;  3OKY A;  4PNK B;  4MMZ A;  4ERY A;  4CI1 A;  3UVL A;  1PBY B;  4AX4 A;  3EWE A;  3ZE1 A;  2YNP A;  4K3J B;  1OMW B;  5HE1 B;  4A0A B;  5C92 A;  1GP2 B;  3JB9 L;  3EQ7 A;  4HDJ A;  1GG2 B;  3OKT A;  3VI3 A;  3IIW A;  5IGO A;  4NBM A;  4Y7R A;  2AGX A;  3SJL D;  4CI8 A;  2H6N A;  4O45 A;  2Z2O A;  5TEF A;  4CY2 A;  3MKQ A;  2GC4 A;  4JXM A;  2XL3 A;  3PXT D;  3JZH A;  2VDP A;  3IJC A;  4JSN C;  4MK0 B;  3SBP A;  4E5Z A;  1QFM A;  4CY1 A;  1JOF A;  2QXV A;  4X61 B;  5CXC A;  5GSA A;  3RFH A;  4Z7Q A;  2I0S A;  4WK0 A;  2P9P C;  4FA1 D;  2XU7 A;  4E54 A;  2OVP B;  3BWS A;  4Y5R D;  4L3G D;  1O6F A;  3V9F A;  2PM9 B;  4OWR A;  1VYH C;  3EI4 A;  1PI6 A;  3E0C A;  5HE3 B;  2CNX A;  4XYH A;  2J57 G;  3IUL A;  4IMM A;  1N6E A;  3OL2 A;  2AH1 A;  3DM0 A;  3ORV D;  4CZX A;  3V5W B;  3C75 H;  4U7A A;  4FA4 D;  2YB8 B;  1TBG A;  2CE9 A;  1B9Y A;  3NVX A;  5HDB A;  1I2M B;  3QHY B;  4BL0 A;  1U2V C;  3I7H A;  2H6K A;  1OLZ A;  3CFS B;  2Z2N A;  5H14 A;  2AGY A;  2H13 A;  2H9M A;  4CZV A;  2EIC A;  5I5I A;  4GM3 A;  2YMU A;  1GOT B;  4GQ1 A;  5THA A;  2XL2 A;  1JMX B;  2IWF A;  4J0X A;  3ZDY A;  5FKQ A;  5M5V A;  1VE7 A;  3V7D B;  4A11 B;  3EG6 A;  5M5R A;  4QAM A;  5TDH B;  3BG1 A;  4A7J A;  1YFQ A;  4GGA A;  1VZ3 A;  3FRX A;  2VDR A;  5CYK A;  4DNW A;  3UR4 A;  3SCY A;  2IUV A;  4QL1 A;  3JZN A;  1NR0 A;  3IKO A;  4GM8 A;  4Z7O A;  3IVM A;  2BCJ B;  2VDM A;  4J8G A;  2H6Q A;  4AN0 A;  1S4U X;  2O9K A;  3C5M A;  1GXR A;  3JRP A;  4LG9 A;  2CO0 C;  4AMZ A;  1YR2 A;  2AGW A;  1GOH A;  3SMR A;  4O3U B;  1XKS A;  4JD2 C;  1UOQ A;  5FFG A;  3NVN A;  1H2Y A;  2XZG A;  3RFG A;  1GOF A;  4ERZ A;  4ZOZ A;  5TEE A;  4X63 B;  3JZG A;  4X60 B;  1C9L A;  3I7N A;  2I0R A;  5EMK B;  4FAN D;  3I89 A;  4JHP C;  5CXB B;  1RI6 A;  1E8N A;  2H9P A;  4XYI A;  2VDQ A;  3AL8 B;  4A0B B;  4G1M A;  4O3T B;  4BH6 A;  3AH8 B;  1A0R B;  1ERJ A;  3FCU A;  5HQG A;  4GZ8 A;  2HU5 A;  3L4M D;  4TZ4 A;  1VZ2 A;  4IA9 A;  3OKY B;  4JT5 C;  3I8C A;  1E8M A;  3ZE2 A;  4D0K A;  4KFM B;  1H2Z A;  3GC3 B;  5FKS A;  5I5J A;  4PSX B;  5A2Q g;  4QQE A;  2HU7 A;  4GQ2 P;  1MG2 A;  3K71 A;  1UOO A;  3I8E A;  3PSC B;  3IUJ A;  3EQ8 A;  4NC4 A;  4D6V A;  3HFQ A;  3MXX A;  3I7P A;  3I2N A;  2G9A A;  3DXK C;  3RSE C;  2OVQ B;  1JV2 A;  1R5M A;  3DWL C;  5K1C C;  5TF2 A;  5GMK n;  3EMH A;  4E5Z B;  4O9D A;  4MMX A;  3F3F A;  4QRJ A;  5CXC B;  3V4P A;  3VI4 A;  4E54 B;  4D9S A;  4J8B A;  3PXW D;  2B5L A;  3RN1 D;  3EI4 B;  2QC5 A;  3NVQ A;  2OK6 A;  3JPX A;  4CY5 A;  2B5M A;  3OL2 B;  4CI2 A;  4UM8 A;  4PC0 A;  3EI3 A;  3K6S A;  3GFC A;  2I3S A;  5EAR A;  5FKR A;  3O4H A;  2HXC A;  4BP9 A;  1B9X A;  4J77 A;  4BP8 A;  4U1E I;  4J79 A;  4GGC A;  5HE0 B;  2CE8 A;  2AGZ A;  5JWZ A;  1Q47 A;  4G55 A;  3UVM A;  4ZOY A;  5M5T A;  3SHF A;  4BCD A;  3CFV A;  3GD1 I;  3L4O D;  2OJY A;  3RLM D;  3UKU C;  5C2W B;  5C9Z B;  1H2W A;  1A12 A;  2H9N A;  1VE6 A;  3NID A;  4AMY A;  2YBA A;  2P9U C;  4CC9 A;  4Z7N A;  4ES0 A;  4FHL A;  4ERQ A;  3MZK A;  4Z8L A;  3K72 A;  5CYK B;  3UVO A;  1C9I A;  2AGL A;  2VZ3 A;  4K3I D;  4UI9 R;  3SLE D;  5GXI A;  1MDA H;  1U4C A;  2MTA H;  2G99 A;  3KRX B;  1E5T A;  2PM6 B;  4J86 A;  2JKX A;  3EI1 A;  4J78 A;  5M61 A;  3T3M A;  2HJ4 A;  2HJB A;  3DXM C;  4OZU A;  3IJ0 A;  4IRZ A;  3F3G A;  3C9C A;  4J81 A;  4CI3 A;  4FB1 D;  2PM7 B;  3ODT A;  1SHY B;  3PVU B;  4A2L A;  4RE5 A;  4H5J A;  4A08 A;  2J55 H;  2H9L A;  4L1M A;  3I7K A;  1L5G A;  2IUQ A;  3ZDX A;  4H5I A;  4FWW A;  1MG3 A;  2BKL A;  5C2V B;  3IJE A;  4N14 A;  2HKR A;  1JTD B;  3NIG A;  5SXM A;  1N6D A;  5FXY A;  2EID A;  2UZX B;  4ZN4 A;  1P22 A;  4JSP C;  4A2M A;  3P4F A;  3JRO A;  3VH0 A;  3RRM C;  3J81 g;  3CIK B;  5AFU 3;  2P9L C;  2OVR B;  5K19 A;  5EML B;  5EAP A;  4J73 A;  5IC7 A;  4PBY A;  4GQB B;  3JAM g;  3AL9 A;  2BBK H;  3MZL A;  3SWS D;  2EIB A;  2HYE A;  2IUP A;  2CN2 A;  2I3T A;  5FQD A;  4JSV C;  5M5U A;  4JHN A;  4O2W A;  3SXT D;  3MKS B;  3EI2 A;  2VDK A;  3ZE0 A;  2EBS A;  1BPO A;  4GMB A;  4L9O A;  4X3E A;  5E6S A;  2IWK A;  4UM9 A;  3DSM A;  4G56 B;  4ESG A;  3MUO A;  4L1Q D;  4CZY A;  4BCC A;  5FFO A;  5EM2 A;  1QNI A;  5H17 A;  5GXH A;  3N0E A;  3IUM A;  3O4J A;  1TYQ C;  2CN3 A;  3AL8 A;  2XE4 A;  3PXS D;  4YVD A;  5AMS A;  2QZP A;  5IJ8 E;  4RE6 A;  4EWR A;  2QR5 A;  2WQ8 A;  4A09 A;  3F3P A;  1TYE A;  2OIZ A;  2H14 A;  3FGB A;  2VZ1 A;  5I5M A;  3EI3 B;  3AFC A;  5B4W A;  2EIE A;  3FM0 A;  4PSW B;  2UZY B;  4WJK A;  3RN0 D;  4DNU A;  5EMM B;  3PVW B;  3OF7 A;  3KCI A;  2H68 A;  3NIF A;  5HYN B;  4QT8 A;  2VC2 A;  4O02 A;  4BCB A;  4FA9 D;  5H1M A;  5IJ7 E;  4A0A A;  2XYI A;  4GGD A;  3EU7 A;  1SQ9 A;  5EAL A;  1H2X A;  1UTC A;  2Q7Q A;  4ZOX A;  2P9K C;  5IT9 g;  3A0F A;  3SBQ A;  3B7F A;  2YNN A;  4J87 A;  3IIY A;  3K26 A;  3BG0 A;  4NEN A;  1PGU A;  5FA5 B;  1O6G A;  3ZWL B;  2PBI B;  3EI1 B;  3C99 A;  3I7O A;  1QFS A;  2PM9 A;  5EAM A;  5FKT A;  1N6F A;  4GM9 A;  2AH0 A;  3O4G A;  4J0W A;  4BUJ C;  3UVK A;  4WK4 A;  2P9S C;  3OKW A;  3DDU A;  4A08 B;  3SN6 B;  3T3P A;  3ULE C;  2Z2P A;  1T2X A;  4NSX A;  2P9I C;  1XIP A; 
#chains in the Genus database with same CATH homology
 2IUR A;  4CY3 A;  1SQJ A;  4ZOV A;  4PXW A;  2W18 A;  4R7A B;  2HKM A;  4JT6 C;  3IJ1 A;  5EMJ B;  2B4E A;  2J56 H;  1K32 A;  2I0T A;  4J82 A;  4A11 A;  4AEZ A;  5FLX g;  3I7L A;  1L0Q A;  2GC7 A;  3PE7 A;  3PSL A;  2H47 A;  2YNO A;  3UVN A;  5KDO B;  2TRC B;  5HE2 B;  4JSX C;  1FWX A;  4PBZ A;  4LGN A;  3U4Y A;  3SBR A;  3N0D A;  3EI2 B;  3SFZ A;  2B5N A;  2OK4 A;  3VGZ A;  2H3X A;  2AQ5 A;  3SVW D;  4LG8 A;  2P9N C;  2IAA A;  2GNQ A;  4FAV D;  1JJU B;  2HES X;  5EM2 B;  3KRW B;  3OTT A;  1XHM A;  5AJA A;  3W15 A;  4XEI C;  5IGQ A;  2CO0 A;  1JMZ B;  3VA6 A;  3OW8 A;  4AOW A;  4A09 B;  3J80 g;  3K27 A;  5CXB A;  4A0B A;  3RMZ D;  4J84 A;  3UKR C;  3GRE A;  4FA5 D;  1K8K C;  3MMY A;  4I79 A;  1NEX B;  4L3H D;  4O1Q D;  1PEV A;  3OKY A;  4PNK B;  4ERY A;  4CI1 A;  3UVL A;  1PBY B;  3EWE A;  2YNP A;  4K3J B;  1OMW B;  5HE1 B;  4A0A B;  3JB9 L;  1GP2 B;  4HDJ A;  1GG2 B;  3OKT A;  3IIW A;  5IGO A;  4Y7R A;  2AGX A;  3SJL D;  4CI8 A;  2H6N A;  4O45 A;  2Z2O A;  5TEF A;  4CY2 A;  3MKQ A;  2GC4 A;  4JXM A;  2XL3 A;  3PXT D;  3JZH A;  4JSN C;  3IJC A;  4MK0 B;  3SBP A;  4E5Z A;  4CY1 A;  1JOF A;  2QXV A;  4X61 B;  5CXC A;  5GSA A;  3RFH A;  2I0S A;  2P9P C;  4FA1 D;  2XU7 A;  4E54 A;  2OVP B;  3BWS A;  4Y5R D;  4L3G D;  3V9F A;  4OWR A;  2PM9 B;  1VYH C;  3EI4 A;  1PI6 A;  3E0C A;  5HE3 B;  2CNX A;  4XYH A;  2J57 G;  4IMM A;  1N6E A;  3OL2 A;  2AH1 A;  3DM0 A;  3ORV D;  4CZX A;  3V5W B;  3C75 H;  4U7A A;  4FA4 D;  2YB8 B;  1TBG A;  2CE9 A;  1B9Y A;  3NVX A;  4BL0 A;  1U2V C;  3I7H A;  2H6K A;  1OLZ A;  3CFS B;  2Z2N A;  5H14 A;  2AGY A;  2H13 A;  2H9M A;  4CZV A;  5I5I A;  4GM3 A;  2YMU A;  1GOT B;  4GQ1 A;  5THA A;  2XL2 A;  1JMX B;  2IWF A;  4J0X A;  5FKQ A;  3V7D B;  4A11 B;  3EG6 A;  5TDH B;  3BG1 A;  4A7J A;  1YFQ A;  4GGA A;  3FRX A;  5CYK A;  3UR4 A;  3SCY A;  2IUV A;  4QL1 A;  3JZN A;  1NR0 A;  3IKO A;  4GM8 A;  2BCJ B;  4J8G A;  2H6Q A;  1S4U X;  2O9K A;  3C5M A;  1GXR A;  3JRP A;  4LG9 A;  2CO0 C;  2AGW A;  3SMR A;  4O3U B;  1XKS A;  4JD2 C;  3NVN A;  3RFG A;  4ERZ A;  4ZOZ A;  5TEE A;  4X63 B;  3JZG A;  4X60 B;  3I7N A;  2I0R A;  5EMK B;  4FAN D;  3I89 A;  5CXB B;  1RI6 A;  2H9P A;  4XYI A;  3AL8 B;  4A0B B;  4O3T B;  4BH6 A;  3AH8 B;  1A0R B;  1ERJ A;  5HQG A;  4GZ8 A;  3L4M D;  4TZ4 A;  4IA9 A;  3OKY B;  4JT5 C;  3I8C A;  4D0K A;  4KFM B;  5FKS A;  5I5J A;  4PSX B;  5A2Q g;  4QQE A;  4GQ2 P;  1MG2 A;  3I8E A;  3PSC B;  4D6V A;  3HFQ A;  3MXX A;  3I7P A;  3I2N A;  2G9A A;  3DXK C;  3RSE C;  2OVQ B;  5K1C C;  1R5M A;  3DWL C;  5TF2 A;  5GMK n;  3EMH A;  4E5Z B;  4O9D A;  3F3F A;  4QRJ A;  5CXC B;  4E54 B;  4J8B A;  3PXW D;  2B5L A;  3RN1 D;  3EI4 B;  2QC5 A;  3NVQ A;  2OK6 A;  3JPX A;  4CY5 A;  2B5M A;  3OL2 B;  4CI2 A;  4PC0 A;  3EI3 A;  3GFC A;  2I3S A;  5EAR A;  5FKR A;  2HXC A;  1B9X A;  4J77 A;  4U1E I;  4J79 A;  4GGC A;  5HE0 B;  2CE8 A;  2AGZ A;  5JWZ A;  1Q47 A;  3UVM A;  4ZOY A;  3SHF A;  3CFV A;  3L4O D;  5C9Z B;  2OJY A;  3RLM D;  3UKU C;  5C2W B;  2H9N A;  2YBA A;  2P9U C;  4CC9 A;  4ES0 A;  4FHL A;  4ERQ A;  3MZK A;  4Z8L A;  5CYK B;  3UVO A;  2AGL A;  4K3I D;  4UI9 R;  3SLE D;  5GXI A;  1MDA H;  1U4C A;  2MTA H;  2G99 A;  3KRX B;  2PM6 B;  4J86 A;  3EI1 A;  4J78 A;  2HJ4 A;  2HJB A;  3DXM C;  4OZU A;  3IJ0 A;  3F3G A;  3C9C A;  4J81 A;  4CI3 A;  4FB1 D;  2PM7 B;  3ODT A;  1SHY B;  3PVU B;  4A2L A;  4H5J A;  4A08 A;  2J55 H;  2H9L A;  3I7K A;  2IUQ A;  4H5I A;  4FWW A;  1MG3 A;  5C2V B;  4N14 A;  2HKR A;  5SXM A;  1N6D A;  5FXY A;  2UZX B;  4ZN4 A;  1P22 A;  4JSP C;  4A2M A;  3P4F A;  3JRO A;  3VH0 A;  3RRM C;  3J81 g;  3CIK B;  5AFU 3;  2P9L C;  2OVR B;  5K19 A;  5EML B;  5EAP A;  4J73 A;  5IC7 A;  4PBY A;  4GQB B;  3JAM g;  3AL9 A;  2BBK H;  3MZL A;  3SWS D;  2HYE A;  2IUP A;  2CN2 A;  2I3T A;  5FQD A;  4JSV C;  3SXT D;  3MKS B;  3EI2 A;  2EBS A;  4GMB A;  4L9O A;  4X3E A;  2IWK A;  3DSM A;  4G56 B;  4ESG A;  4L1Q D;  4CZY A;  5EM2 A;  1QNI A;  5H17 A;  5GXH A;  3N0E A;  1TYQ C;  2CN3 A;  3AL8 A;  3PXS D;  4YVD A;  5AMS A;  5IJ8 E;  4EWR A;  4A09 A;  3F3P A;  2OIZ A;  2H14 A;  3FGB A;  5I5M A;  3EI3 B;  3AFC A;  5B4W A;  3FM0 A;  4PSW B;  2UZY B;  3RN0 D;  5EMM B;  3PVW B;  2H68 A;  5HYN B;  4QT8 A;  4FA9 D;  5H1M A;  5IJ7 E;  4A0A A;  2XYI A;  4GGD A;  3EU7 A;  1SQ9 A;  5EAL A;  2Q7Q A;  4ZOX A;  2P9K C;  5IT9 g;  3A0F A;  3SBQ A;  3B7F A;  2YNN A;  4J87 A;  3IIY A;  3K26 A;  3BG0 A;  1PGU A;  5FA5 B;  3ZWL B;  2PBI B;  3EI1 B;  3C99 A;  3I7O A;  5EAM A;  2PM9 A;  5FKT A;  1N6F A;  4GM9 A;  2AH0 A;  4J0W A;  4BUJ C;  3UVK A;  2P9S C;  3OKW A;  4A08 B;  3SN6 B;  3ULE C;  2Z2P A;  4NSX A;  2P9I C;  1XIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...