4ES0A

X-ray structure of wdr5-setd1b win motif peptide binary complex
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Structural basis for WDR5 interaction (Win) motif recognition in human SET1 family histone methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transferase
total genus 102
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2012-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4es0A00
4FA4D 5HE2B 4CI8A 3BWSA 4E5ZA 1TYQC 3PXSD 2HJBA 5FKQA 5SXMA 1GG2B 3BG0A 3E0CA 3A0FA 1PGUA 2TRCB 4A0BA 2UZYB 4IMMA 5EMJB 4A2MA 4J0XA 4YVDA 2H9NA 4CI2A 1MDAH 5IGQA 2P9LC 3IKOA 4L3HD 2YNNA 5EMLB 2I3SA 1GP2B 2H6NA 3I7PA 4GZ8A 2I3TA 1SQJA 3SFZA 4A0AA 4PSXB 3RMZD 2AGWA 3EI3B 3I8CA 2AGZA 2H68A 3IJ1A 4PSWB 2CE9A 4J78A 4BL0A 1MG2A 3J81g 1NEXB 2H3XA 3RFGA 2GNQA 3NVNA 4CZYA 1YFQA 3I8EA 1K32A 3OTTA 5I5JA 4AOWA 1PBYB 4CZXA 3SCYA 3I7KA 4FB1D 2BCJB 2QC5A 2PBIB 3RN1D 5KDOB 4X60B 3N0DA 1ERJA 5CXCB 4OWRA 2PM7B 3J80g 3EI3A 5FQDA 4FA9D 3RFHA 3I7LA 4K3JB 4AEZA 2G9AA 3JROA 2OVQB 2CNXA 1GOTB 5EMKB 5HYNB 3KRXB 3UVKA 4I79A 3EI2B 5AJAA 1Q47A 4A09A 3DXMC 5AFU3 5TF2A 2IUVA 3IIYA 3IJCA 3EWEA 3DXKC 3FGBA 3P4FA 5CXBB 2CO0A 1VYHC 4JSPC 5CXCA 3MKSB 4GQ2P 3UKUC 3V5WB 3ORVD 4A08A 3BG1A 1XHMA 3MZKA 4EWRA 1FWXA 4ERQA 4FWWA 5HE3B 2Z2OA 4J8GA 2CN2A 3ZWLB 4GGCA 2HJ4A 2H9PA 3V9FA 2AH1A 3CFVA 3OW8A 2PM9B 3SN6B 3F3PA 4X3EA 2P9IC 5C2WB 3EI4A 4BH6A 3PVUB 3MXXA 4J84A 3L4OD 4GQBB 5H14A 3PXWD 4ERZA 2GC7A 5EM2B 3SJLD 2Z2NA 2Z2PA 5THAA 4K3ID 2YBAA 4A0AB 4PBYA 5TEEA 2IAAA 3I7NA 1XIPA 4N14A 2H14A 3N0EA 5HE0B 4L3GD 2PM9A 3UVLA 3JPXA 4PC0A 5CYKA 4ZOYA 3EU7A 3F3FA 4GGDA 4CY3A 3JAMg 4QQEA 3SLED 4JD2C 3DSMA 4CY2A 5C9ZB 4Z8LA 2IWKA 4CY1A 5EM2A 4E54B 5I5MA 2YNPA 4L9OA 3I7HA 2XYIA 4O3TB 3I7OA 4ZN4A 3OKYB 3EG6A 4J8BA 5GMKn 3EI1A 4XEIC 3UVNA 2P9UC 3AH8B 5EAPA 3RRMC 3I2NA 4MK0B 2H13A 3FRXA 3AL9A 2P9SC 4QRJA 5GSAA 5I5IA 4JT6C 1U4CA 4D0KA 4A09B 3PVWB 1JJUB 4E54A 3PE7A 5TEFA 4CY5A 2AQ5A 3RN0D 4GM8A 4J0WA 1PEVA 3OKYA 3W15A 4A08B 4BUJC 1L0QA 2G99A 3PXTD 3MKQA 3UVOA 4ZOVA 5FLXg 4J79A 1JOFA 4FA1D 3EMHA 3UR4A 5B4WA 2OK4A 1RI6A 4QL1A 1A0RB 1N6FA 3F3GA 4ZOXA 2J55H 5JWZA 3EI4B 2OVRB 3PSLA 4D6VA 1P22A 4U7AA 4FA5D 4A11B 4ES0A 2PM6B 1MG3A 3C9CA 2Q7QA 5GXIA 3VH0A 2I0TA 5EAMA 3RLMD 3B7FA 3L4MD 4LG9A 4GM3A 4JXMA 3JZNA 5A2Qg 4QT8A 3SWSD 3AFCA 3NVQA 3NVXA 3AL8B 2B5MA 1PI6A 3CIKB 4J86A 5CYKB 3VA6A 4PNKB 3GREA 2IUQA 4A11A 3FM0A 4O3UB 2AH0A 4ESGA 2YMUA 2OVPB 1B9XA 4LG8A 2AGLA 5AMSA 3OKTA 2O9KA 2HKRA 4J87A 1SQ9A 2J56H 3SVWD 4O1QD 4CI1A 3ODTA 4H5IA 2OK6A 3JZGA 1K8KC 3AL8A 4X63B 2QXVA 2UZXB 4A2LA 2W18A 3EI1B 2CE8A 2P9PC 5K19A 1XKSA 1JMXB 3VGZA 2HXCA 3C5MA 2AGXA 1N6EA 4PBZA 4A7JA 2IUPA 4XYIA 2I0SA 2H6QA 4KFMB 2P9KC 5EARA 4GM9A 3SBRA 2H6KA 4IA9A 3K26A 2YB8B 5K1CC 3JZHA 4XYHA 4OZUA 5IC7A 4U1EI 1U2VC 3C75H 3KRWB 3RSEC 3GFCA 5IGOA 2AGYA 4HDJA 4Y7RA 5EMMB 4J82A 1S4UX 4CC9A 4FAVD 3OKWA 4J81A 3SBPA 3C99A 4X61B 2J57G 1NR0A 5IJ7E 2OJYA 1B9YA 2GC4A 1OLZA 4O9DA 2HKMA 4TZ4A 3K27A 5FA5B 3SXTD 5IJ8E 2XL2A 3IJ0A 4JSNC 2XL3A 5H1MA 4J73A 5FXYA 4H5JA 5FKSA 5C2VB 4JSVC 2B4EA 1OMWB 2H47A 2HESX 2BBKH 1R5MA 4ZOZA 4CZVA 2B5NA 2OIZA 3PSCB 3V7DB 3DWLC 3OL2B 4PXWA 2XU7A 4GGAA 5FKTA 5HQGA 3IIWA 4UI9R 2CN3A 4FAND 4GMBA 5FKRA 3MMYA 2B5LA 3HFQA 3I89A 4L1QD 3CFSB 1TBGA 1SHYB 2H9LA 2IURA 4LGNA 2H9MA 4R7AB 5HE1B 4Y5RD 2HYEA 3U4YA 4G56B 3OL2A 1GXRA 5H17A 3SMRA 3ULEC 3UKRC 4E5ZB 4NSXA 3UVMA 3MZLA 3JB9L 2MTAH 2P9NC 4J77A 3JRPA 2CO0C 5IT9g 1QNIA 1N6DA 3SHFA 4A0BB 2IWFA 3EI2A 5GXHA 4GQ1A 2YNOA 4JT5C 5EALA 4JSXC 5TDHB 2I0RA 4ERYA 5CXBA 3DM0A 3SBQA 1JMZB 4FHLA 4CI3A 4O45A 2EBSA
chains in the Genus database with same CATH superfamily
4FA4D 4G1MA 5HE2B 3K72A 4CI8A 3BWSA 4E5ZA 1TYQC 2VDMA 3PXSD 2HJBA 5FKQA 5SXMA 1GG2B 3BG0A 3E0CA 3A0FA 1PGUA 2TRCB 4A0BA 2UZYB 4IMMA 5EMJB 4A2MA 4WJKA 4J0XA 4YVDA 1VZ3A 2H9NA 4CI2A 3FCUA 1MDAH 4BP9A 5IGQA 2P9LC 3IKOA 4L3HD 2YNNA 3VI3A 5EMLB 2I3SA 1GP2B 5M5RA 1E5TA 2H6NA 1T2XA 4MMZA 1U8CA 2VDRA 3I7PA 4GZ8A 3VI4A 2I3TA 4BCBA 1SQJA 4RE6A 3SFZA 4UM8A 2VDQA 4A0AA 4PSXB 3RMZD 2AGWA 2VZ1A 3EI3B 3I8CA 2AGZA 2H68A 3IJ1A 4PSWB 2CE9A 4J78A 4BL0A 1VZ2A 1MG2A 3J81g 3MUNA 4DNVA 1NEXB 2H3XA 3RFGA 2GNQA 3IUNA 3NVNA 4CZYA 1YFQA 3I8EA 3K71A 1K32A 3OTTA 1A12A 1BPOA 3O4JA 5I5JA 4AOWA 1PBYB 1H2YA 4CZXA 3ZE1A 3SCYA 3I7KA 4FB1D 2VC2A 2BCJB 2QC5A 2PBIB 3RN1D 5KDOB 4X60B 3N0DA 3ZDZA 1ERJA 5CXCB 4OWRA 2PM7B 3GD1I 2XE4A 3J80g 3EI3A 5FQDA 2HU7A 4FA9D 3RFHA 3I7LA 4K3JB 4AEZA 4NBMA 2G9AA 3JROA 3NIFA 2OVQB 2CNXA 1GOTB 5EMKB 5HYNB 3KRXB 3UVKA 4I79A 3EI2B 5AJAA 1Q47A 2VDOA 4A09A 3DXMC 5AFU3 5TF2A 2IUVA 3IIYA 3IJCA 3EWEA 4QAMA 3DXKC 3FGBA 3EQ7A 3P4FA 4Z7QA 5CXBB 2CO0A 1VYHC 5FFGA 4JSPC 5CXCA 3MKSB 4GQ2P 3UKUC 3V5WB 3ORVD 4A08A 3BG1A 5FFOA 3EQ8A 4DNWA 1XHMA 3ZE2A 3MZKA 4EWRA 1FWXA 4ERQA 4FWWA 1H2WA 3ZDXA 5HE3B 2Z2OA 4J8GA 2CN2A 3ZWLB 2VDLA 4GGCA 2HJ4A 2H9PA 2VZ3A 1QFSA 3V9FA 2AH1A 3CFVA 3OW8A 2PM9B 3SN6B 3F3PA 4X3EA 1O6FA 2P9IC 5C2WB 3EI4A 4BH6A 3PVUB 3MXXA 4G1EA 4WK0A 4J84A 3L4OD 2VDPA 1M1XA 4GQBB 5H14A 3V4PA 3PXWD 3IUMA 4ERZA 2GC7A 2WQ8A 3SJLD 2Z2NA 4BCDA 5EM2B 4IRZA 2Z2PA 3O4IA 5THAA 4K3ID 1E8NA 2YBAA 4A0AB 4PBYA 5TEEA 4AMYA 2IAAA 3FCSA 1UOQA 3I7NA 1XIPA 4N14A 2H14A 2XDWA 3N0EA 5HE0B 4L3GD 2PM9A 3UVLA 3JPXA 4PC0A 5CYKA 3ZE0A 4ZOYA 3EU7A 3F3FA 4GGDA 4NAAA 4CY3A 3JAMg 4QQEA 4D9SA 3SLED 4JD2C 3DSMA 4CY2A 5C9ZB 4Z8LA 2IWKA 4CY1A 5EM2A 4E54B 1UOPA 5I5MA 2YNPA 2HU5A 4L9OA 2EIBA 3I7HA 3IUQA 2HU8A 3IULA 2XYIA 4O3TB 3I7OA 3GC3B 4Z7OA 4ZN4A 3KCIA 3OKYB 3EG6A 4J8BA 5GMKn 4O2WA 3EI1A 4XEIC 3UVNA 5M61A 2P9UC 3AH8B 5EAPA 3RRMC 5M5SA 3I2NA 4MK0B 2H13A 2BKLA 3FRXA 3AL9A 2P9SC 4QRJA 5GSAA 5I5IA 4JT6C 1U4CA 4D0KA 4A09B 3PVWB 1JJUB 4E54A 3PE7A 5TEFA 4CY5A 2AQ5A 3RN0D 4GM8A 4J0WA 1PEVA 3OKYA 3W15A 4A08B 5M5UA 4BUJC 3O4HA 1L0QA 2G99A 4UM9A 3PXTD 3MKQA 3UVOA 4WK2A 1H2XA 4ZOVA 3QI0A 1GOGA 5FLXg 4J79A 2EIEA 1JOFA 4FA1D 3EMHA 3UR4A 5B4WA 2OK4A 2QZPA 1RI6A 4QL1A 4AN1A 1A0RB 3OF7A 1N6FA 4NC4A 3F3GA 4O02A 4ZOXA 2J55H 5JWZA 3EI4B 2OVRB 3PSLA 4D6VA 1P22A 4U7AA 4FA5D 4A11B 4ES0A 2PM6B 1MG3A 3IURA 3C9CA 2Q7QA 5GXIA 4L1MA 3VH0A 2I0TA 5EAMA 3RLMD 4NENA 3B7FA 3L4MD 3MUOA 5E6UA 4LG9A 4GM3A 4JXMA 3QHYB 3JZNA 3IVMA 5A2Qg 4QT8A 1JV2A 3SWSD 3AFCA 3NVQA 3T3PA 3NVXA 3AL8B 2B5MA 1PI6A 3CIKB 4J86A 5CYKB 3VA6A 4PNKB 2EICA 3GREA 3O4GA 2IUQA 4A11A 3FM0A 4O3UB 2AH0A 4MMXA 2YMUA 4ESGA 2OVPB 1B9XA 1GOFA 4LG8A 2QR5A 3K6SA 1YR2A 2AGLA 5AMSA 3OKTA 2O9KA 2HKRA 4J87A 1SQ9A 2J56H 3SVWD 4O1QD 4JHNA 3ODTA 4CI1A 4H5IA 2OK6A 3JZGA 1K8KC 1H2ZA 3AL8A 2VDNA 3NIGA 4X63B 2QXVA 2UZXB 4A2LA 2W18A 3EI1B 2CE8A 2P9PC 5K19A 4MMYA 1XKSA 1JMXB 3VGZA 2HXCA 5C86A 3C5MA 2AGXA 1N6EA 4PBZA 4A7JA 1TYEA 2IUPA 4XYIA 2I0SA 2H6QA 4KFMB 2P9KC 5EARA 4GM9A 3SBRA 2H6KA 4IA9A 3K26A 2YB8B 5K1CC 1QFMA 4DNUA 3JZHA 4BCCA 4XYHA 4Z7NA 4OZUA 5IC7A 4U1EI 1U2VC 3C75H 3KRWB 1L5GA 3RSEC 3GFCA 1GOHA 5IGOA 2AGYA 4HDJA 4Y7RA 5EMMB 4J82A 1S4UX 4CC9A 4FAVD 3IJEA 4WK4A 3OKWA 3EQ9A 4J81A 3SBPA 1K3IA 3C99A 4X61B 2J57G 1NR0A 5IJ7E 2OJYA 3IUJA 1B9YA 5E6RA 2GC4A 1OLZA 4O9DA 2HKMA 4TZ4A 3K27A 3T3MA 4JHPC 5FA5B 3SXTD 5IJ8E 2XL2A 3IJ0A 4JSNC 2XL3A 5H1MA 4J73A 5FXYA 4H5JA 5FKSA 4AN0A 5C2VB 4JSVC 4AMZA 2B4EA 1OMWB 2H47A 2HESX 2BBKH 1R5MA 4ZOZA 4CZVA 2B5NA 2OIZA 3MVDK 3PSCB 1C9LA 3V7DB 3DWLC 3ZDYA 1JTDB 3OL2B 4PXWA 5C92A 4RE5A 2XU7A 4GGAA 5FKTA 5HQGA 3IIWA 4UI9R 2CN3A 3DDUA 4FAND 4GMBA 5FKRA 3MMYA 2B5LA 5HDBA 2VDKA 3HFQA 1O6GA 3I89A 4L1QD 2JKXA 3CFSB 1TBGA 1SHYB 2H9LA 3NIDA 2XZGA 2IURA 1C9IA 4LGNA 5E6SA 2H9MA 4R7AB 5HE1B 1I2MB 4Y5RD 2HYEA 3U4YA 1UTCA 3OL2A 4G56B 1GXRA 1E8MA 1VE7A 5H17A 4BP8A 3SMRA 3ULEC 3UKRC 4E5ZB 4NSXA 3UVMA 3MZLA 3V4VA 2MTAH 4G55A 3JB9L 2P9NC 4J77A 2EIDA 5M5VA 3JRPA 2CO0C 5IT9g 1QNIA 1N6DA 3SHFA 4A0BB 2IWFA 3EI2A 5GXHA 5M5TA 4GQ1A 1VE6A 2YNOA 4JT5C 5EALA 4JSXC 5TDHB 2I0RA 4ERYA 5CXBA 3DM0A 3SBQA 1JMZB 1UOOA 4AX4A 4FHLA 4CI3A 4O45A 2EBSA
chains in the Genus database with same CATH topology
4FA4D 5HE2B 4CI8A 3BWSA 4E5ZA 1TYQC 3PXSD 2HJBA 5FKQA 5SXMA 1GG2B 3BG0A 3E0CA 3A0FA 1PGUA 2TRCB 4A0BA 2UZYB 4IMMA 5EMJB 4A2MA 4J0XA 4YVDA 2H9NA 4CI2A 1MDAH 5IGQA 2P9LC 3IKOA 4L3HD 2YNNA 5EMLB 2I3SA 1GP2B 2H6NA 3I7PA 4GZ8A 2I3TA 1SQJA 3SFZA 4A0AA 4PSXB 3RMZD 2AGWA 3EI3B 3I8CA 2AGZA 2H68A 3IJ1A 4PSWB 2CE9A 4J78A 4BL0A 1MG2A 3J81g 1NEXB 2H3XA 3RFGA 2GNQA 3NVNA 4CZYA 1YFQA 3I8EA 1K32A 3OTTA 5I5JA 4AOWA 1PBYB 4CZXA 3SCYA 3I7KA 4FB1D 2BCJB 2QC5A 2PBIB 3RN1D 5KDOB 4X60B 3N0DA 1ERJA 5CXCB 4OWRA 2PM7B 3J80g 3EI3A 5FQDA 4FA9D 3RFHA 3I7LA 4K3JB 4AEZA 2G9AA 3JROA 2OVQB 2CNXA 1GOTB 5EMKB 5HYNB 3KRXB 3UVKA 4I79A 3EI2B 5AJAA 1Q47A 4A09A 3DXMC 5AFU3 5TF2A 2IUVA 3IIYA 3IJCA 3EWEA 3DXKC 3FGBA 3P4FA 5CXBB 2CO0A 1VYHC 4JSPC 5CXCA 3MKSB 4GQ2P 3UKUC 3V5WB 3ORVD 4A08A 3BG1A 1XHMA 3MZKA 4EWRA 1FWXA 4ERQA 4FWWA 5HE3B 2Z2OA 4J8GA 2CN2A 3ZWLB 4GGCA 2HJ4A 2H9PA 3V9FA 2AH1A 3CFVA 3OW8A 2PM9B 3SN6B 3F3PA 4X3EA 2P9IC 5C2WB 3EI4A 4BH6A 3PVUB 3MXXA 4J84A 3L4OD 4GQBB 5H14A 3PXWD 4ERZA 2GC7A 5EM2B 3SJLD 2Z2NA 2Z2PA 5THAA 4K3ID 2YBAA 4A0AB 4PBYA 5TEEA 2IAAA 3I7NA 1XIPA 4N14A 2H14A 3N0EA 5HE0B 4L3GD 2PM9A 3UVLA 3JPXA 4PC0A 5CYKA 4ZOYA 3EU7A 3F3FA 4GGDA 4CY3A 3JAMg 4QQEA 3SLED 4JD2C 3DSMA 4CY2A 5C9ZB 4Z8LA 2IWKA 4CY1A 5EM2A 4E54B 5I5MA 2YNPA 4L9OA 3I7HA 2XYIA 4O3TB 3I7OA 4ZN4A 3OKYB 3EG6A 4J8BA 5GMKn 3EI1A 4XEIC 3UVNA 2P9UC 3AH8B 5EAPA 3RRMC 3I2NA 4MK0B 2H13A 3FRXA 3AL9A 2P9SC 4QRJA 5GSAA 5I5IA 4JT6C 1U4CA 4D0KA 4A09B 3PVWB 1JJUB 4E54A 3PE7A 5TEFA 4CY5A 2AQ5A 3RN0D 4GM8A 4J0WA 1PEVA 3OKYA 3W15A 4A08B 4BUJC 1L0QA 2G99A 3PXTD 3MKQA 3UVOA 4ZOVA 5FLXg 4J79A 1JOFA 4FA1D 3EMHA 3UR4A 5B4WA 2OK4A 1RI6A 4QL1A 1A0RB 1N6FA 3F3GA 4ZOXA 2J55H 5JWZA 3EI4B 2OVRB 3PSLA 4D6VA 1P22A 4U7AA 4FA5D 4A11B 4ES0A 2PM6B 1MG3A 3C9CA 2Q7QA 5GXIA 3VH0A 2I0TA 5EAMA 3RLMD 3B7FA 3L4MD 4LG9A 4GM3A 4JXMA 3JZNA 5A2Qg 4QT8A 3SWSD 3AFCA 3NVQA 3NVXA 3AL8B 2B5MA 1PI6A 3CIKB 4J86A 5CYKB 3VA6A 4PNKB 3GREA 2IUQA 4A11A 3FM0A 4O3UB 2AH0A 4ESGA 2YMUA 2OVPB 1B9XA 4LG8A 2AGLA 5AMSA 3OKTA 2O9KA 2HKRA 4J87A 1SQ9A 2J56H 3SVWD 4O1QD 4CI1A 3ODTA 4H5IA 2OK6A 3JZGA 1K8KC 3AL8A 4X63B 2QXVA 2UZXB 4A2LA 2W18A 3EI1B 2CE8A 2P9PC 5K19A 1XKSA 1JMXB 3VGZA 2HXCA 3C5MA 2AGXA 1N6EA 4PBZA 4A7JA 2IUPA 4XYIA 2I0SA 2H6QA 4KFMB 2P9KC 5EARA 4GM9A 3SBRA 2H6KA 4IA9A 3K26A 2YB8B 5K1CC 3JZHA 4XYHA 4OZUA 5IC7A 4U1EI 1U2VC 3C75H 3KRWB 3RSEC 3GFCA 5IGOA 2AGYA 4HDJA 4Y7RA 5EMMB 4J82A 1S4UX 4CC9A 4FAVD 3OKWA 4J81A 3SBPA 3C99A 4X61B 2J57G 1NR0A 5IJ7E 2OJYA 1B9YA 2GC4A 1OLZA 4O9DA 2HKMA 4TZ4A 3K27A 5FA5B 3SXTD 5IJ8E 2XL2A 3IJ0A 4JSNC 2XL3A 5H1MA 4J73A 5FXYA 4H5JA 5FKSA 5C2VB 4JSVC 2B4EA 1OMWB 2H47A 2HESX 2BBKH 1R5MA 4ZOZA 4CZVA 2B5NA 2OIZA 3PSCB 3V7DB 3DWLC 3OL2B 4PXWA 2XU7A 4GGAA 5FKTA 5HQGA 3IIWA 4UI9R 2CN3A 4FAND 4GMBA 5FKRA 3MMYA 2B5LA 3HFQA 3I89A 4L1QD 3CFSB 1TBGA 1SHYB 2H9LA 2IURA 4LGNA 2H9MA 4R7AB 5HE1B 4Y5RD 2HYEA 3U4YA 4G56B 3OL2A 1GXRA 5H17A 3SMRA 3ULEC 3UKRC 4E5ZB 4NSXA 3UVMA 3MZLA 3JB9L 2MTAH 2P9NC 4J77A 3JRPA 2CO0C 5IT9g 1QNIA 1N6DA 3SHFA 4A0BB 2IWFA 3EI2A 5GXHA 4GQ1A 2YNOA 4JT5C 5EALA 4JSXC 5TDHB 2I0RA 4ERYA 5CXBA 3DM0A 3SBQA 1JMZB 4FHLA 4CI3A 4O45A 2EBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FA4 D;  5HE2 B;  4CI8 A;  3BWS A;  4E5Z A;  1TYQ C;  3PXS D;  2HJB A;  5FKQ A;  5SXM A;  1GG2 B;  3BG0 A;  3E0C A;  3A0F A;  1PGU A;  2TRC B;  4A0B A;  2UZY B;  4IMM A;  5EMJ B;  4A2M A;  4J0X A;  4YVD A;  2H9N A;  4CI2 A;  1MDA H;  5IGQ A;  2P9L C;  3IKO A;  4L3H D;  2YNN A;  5EML B;  2I3S A;  1GP2 B;  2H6N A;  3I7P A;  4GZ8 A;  2I3T A;  1SQJ A;  3SFZ A;  4A0A A;  4PSX B;  3RMZ D;  2AGW A;  3EI3 B;  3I8C A;  2AGZ A;  2H68 A;  3IJ1 A;  4PSW B;  2CE9 A;  4J78 A;  4BL0 A;  1MG2 A;  3J81 g;  1NEX B;  2H3X A;  3RFG A;  2GNQ A;  3NVN A;  4CZY A;  1YFQ A;  3I8E A;  1K32 A;  3OTT A;  5I5J A;  4AOW A;  1PBY B;  4CZX A;  3SCY A;  3I7K A;  4FB1 D;  2BCJ B;  2QC5 A;  2PBI B;  3RN1 D;  5KDO B;  4X60 B;  3N0D A;  1ERJ A;  5CXC B;  4OWR A;  2PM7 B;  3J80 g;  3EI3 A;  5FQD A;  4FA9 D;  3RFH A;  3I7L A;  4K3J B;  4AEZ A;  2G9A A;  3JRO A;  2OVQ B;  2CNX A;  1GOT B;  5EMK B;  5HYN B;  3KRX B;  3UVK A;  4I79 A;  3EI2 B;  5AJA A;  1Q47 A;  4A09 A;  3DXM C;  5AFU 3;  5TF2 A;  2IUV A;  3IIY A;  3IJC A;  3EWE A;  3DXK C;  3FGB A;  3P4F A;  5CXB B;  2CO0 A;  1VYH C;  4JSP C;  5CXC A;  3MKS B;  4GQ2 P;  3UKU C;  3V5W B;  3ORV D;  4A08 A;  3BG1 A;  1XHM A;  3MZK A;  4EWR A;  1FWX A;  4ERQ A;  4FWW A;  5HE3 B;  2Z2O A;  4J8G A;  2CN2 A;  3ZWL B;  4GGC A;  2HJ4 A;  2H9P A;  3V9F A;  2AH1 A;  3CFV A;  3OW8 A;  2PM9 B;  3SN6 B;  3F3P A;  4X3E A;  2P9I C;  5C2W B;  3EI4 A;  4BH6 A;  3PVU B;  3MXX A;  4J84 A;  3L4O D;  4GQB B;  5H14 A;  3PXW D;  4ERZ A;  2GC7 A;  5EM2 B;  3SJL D;  2Z2N A;  2Z2P A;  5THA A;  4K3I D;  2YBA A;  4A0A B;  4PBY A;  5TEE A;  2IAA A;  3I7N A;  1XIP A;  4N14 A;  2H14 A;  3N0E A;  5HE0 B;  4L3G D;  2PM9 A;  3UVL A;  3JPX A;  4PC0 A;  5CYK A;  4ZOY A;  3EU7 A;  3F3F A;  4GGD A;  4CY3 A;  3JAM g;  4QQE A;  3SLE D;  4JD2 C;  3DSM A;  4CY2 A;  5C9Z B;  4Z8L A;  2IWK A;  4CY1 A;  5EM2 A;  4E54 B;  5I5M A;  2YNP A;  4L9O A;  3I7H A;  2XYI A;  4O3T B;  3I7O A;  4ZN4 A;  3OKY B;  3EG6 A;  4J8B A;  5GMK n;  3EI1 A;  4XEI C;  3UVN A;  2P9U C;  3AH8 B;  5EAP A;  3RRM C;  3I2N A;  4MK0 B;  2H13 A;  3FRX A;  3AL9 A;  2P9S C;  4QRJ A;  5GSA A;  5I5I A;  4JT6 C;  1U4C A;  4D0K A;  4A09 B;  3PVW B;  1JJU B;  4E54 A;  3PE7 A;  5TEF A;  4CY5 A;  2AQ5 A;  3RN0 D;  4GM8 A;  4J0W A;  1PEV A;  3OKY A;  3W15 A;  4A08 B;  4BUJ C;  1L0Q A;  2G99 A;  3PXT D;  3MKQ A;  3UVO A;  4ZOV A;  5FLX g;  4J79 A;  1JOF A;  4FA1 D;  3EMH A;  3UR4 A;  5B4W A;  2OK4 A;  1RI6 A;  4QL1 A;  1A0R B;  1N6F A;  3F3G A;  4ZOX A;  2J55 H;  5JWZ A;  3EI4 B;  2OVR B;  3PSL A;  4D6V A;  1P22 A;  4U7A A;  4FA5 D;  4A11 B;  4ES0 A;  2PM6 B;  1MG3 A;  3C9C A;  2Q7Q A;  5GXI A;  3VH0 A;  2I0T A;  5EAM A;  3RLM D;  3B7F A;  3L4M D;  4LG9 A;  4GM3 A;  4JXM A;  3JZN A;  5A2Q g;  4QT8 A;  3SWS D;  3AFC A;  3NVQ A;  3NVX A;  3AL8 B;  2B5M A;  1PI6 A;  3CIK B;  4J86 A;  5CYK B;  3VA6 A;  4PNK B;  3GRE A;  2IUQ A;  4A11 A;  3FM0 A;  4O3U B;  2AH0 A;  4ESG A;  2YMU A;  2OVP B;  1B9X A;  4LG8 A;  2AGL A;  5AMS A;  3OKT A;  2O9K A;  2HKR A;  4J87 A;  1SQ9 A;  2J56 H;  3SVW D;  4O1Q D;  4CI1 A;  3ODT A;  4H5I A;  2OK6 A;  3JZG A;  1K8K C;  3AL8 A;  4X63 B;  2QXV A;  2UZX B;  4A2L A;  2W18 A;  3EI1 B;  2CE8 A;  2P9P C;  5K19 A;  1XKS A;  1JMX B;  3VGZ A;  2HXC A;  3C5M A;  2AGX A;  1N6E A;  4PBZ A;  4A7J A;  2IUP A;  4XYI A;  2I0S A;  2H6Q A;  4KFM B;  2P9K C;  5EAR A;  4GM9 A;  3SBR A;  2H6K A;  4IA9 A;  3K26 A;  2YB8 B;  5K1C C;  3JZH A;  4XYH A;  4OZU A;  5IC7 A;  4U1E I;  1U2V C;  3C75 H;  3KRW B;  3RSE C;  3GFC A;  5IGO A;  2AGY A;  4HDJ A;  4Y7R A;  5EMM B;  4J82 A;  1S4U X;  4CC9 A;  4FAV D;  3OKW A;  4J81 A;  3SBP A;  3C99 A;  4X61 B;  2J57 G;  1NR0 A;  5IJ7 E;  2OJY A;  1B9Y A;  2GC4 A;  1OLZ A;  4O9D A;  2HKM A;  4TZ4 A;  3K27 A;  5FA5 B;  3SXT D;  5IJ8 E;  2XL2 A;  3IJ0 A;  4JSN C;  2XL3 A;  5H1M A;  4J73 A;  5FXY A;  4H5J A;  5FKS A;  5C2V B;  4JSV C;  2B4E A;  1OMW B;  2H47 A;  2HES X;  2BBK H;  1R5M A;  4ZOZ A;  4CZV A;  2B5N A;  2OIZ A;  3PSC B;  3V7D B;  3DWL C;  3OL2 B;  4PXW A;  2XU7 A;  4GGA A;  5FKT A;  5HQG A;  3IIW A;  4UI9 R;  2CN3 A;  4FAN D;  4GMB A;  5FKR A;  3MMY A;  2B5L A;  3HFQ A;  3I89 A;  4L1Q D;  3CFS B;  1TBG A;  1SHY B;  2H9L A;  2IUR A;  4LGN A;  2H9M A;  4R7A B;  5HE1 B;  4Y5R D;  2HYE A;  3U4Y A;  4G56 B;  3OL2 A;  1GXR A;  5H17 A;  3SMR A;  3ULE C;  3UKR C;  4E5Z B;  4NSX A;  3UVM A;  3MZL A;  3JB9 L;  2MTA H;  2P9N C;  4J77 A;  3JRP A;  2CO0 C;  5IT9 g;  1QNI A;  1N6D A;  3SHF A;  4A0B B;  2IWF A;  3EI2 A;  5GXH A;  4GQ1 A;  2YNO A;  4JT5 C;  5EAL A;  4JSX C;  5TDH B;  2I0R A;  4ERY A;  5CXB A;  3DM0 A;  3SBQ A;  1JMZ B;  4FHL A;  4CI3 A;  4O45 A;  2EBS A; 
#chains in the Genus database with same CATH topology
 4FA4 D;  4G1M A;  5HE2 B;  3K72 A;  4CI8 A;  3BWS A;  4E5Z A;  1TYQ C;  2VDM A;  3PXS D;  2HJB A;  5FKQ A;  5SXM A;  1GG2 B;  3BG0 A;  3E0C A;  3A0F A;  1PGU A;  2TRC B;  4A0B A;  2UZY B;  4IMM A;  5EMJ B;  4A2M A;  4WJK A;  4J0X A;  4YVD A;  1VZ3 A;  2H9N A;  4CI2 A;  3FCU A;  1MDA H;  4BP9 A;  5IGQ A;  2P9L C;  3IKO A;  4L3H D;  2YNN A;  3VI3 A;  5EML B;  2I3S A;  1GP2 B;  5M5R A;  1E5T A;  2H6N A;  1T2X A;  4MMZ A;  1U8C A;  2VDR A;  3I7P A;  4GZ8 A;  3VI4 A;  2I3T A;  4BCB A;  1SQJ A;  4RE6 A;  3SFZ A;  4UM8 A;  2VDQ A;  4A0A A;  4PSX B;  3RMZ D;  2AGW A;  2VZ1 A;  3EI3 B;  3I8C A;  2AGZ A;  2H68 A;  3IJ1 A;  4PSW B;  2CE9 A;  4J78 A;  4BL0 A;  1VZ2 A;  1MG2 A;  3J81 g;  3MUN A;  4DNV A;  1NEX B;  2H3X A;  3RFG A;  2GNQ A;  3IUN A;  3NVN A;  4CZY A;  1YFQ A;  3I8E A;  3K71 A;  1K32 A;  3OTT A;  1A12 A;  1BPO A;  3O4J A;  5I5J A;  4AOW A;  1PBY B;  1H2Y A;  4CZX A;  3ZE1 A;  3SCY A;  3I7K A;  4FB1 D;  2VC2 A;  2BCJ B;  2QC5 A;  2PBI B;  3RN1 D;  5KDO B;  4X60 B;  3N0D A;  3ZDZ A;  1ERJ A;  5CXC B;  4OWR A;  2PM7 B;  3GD1 I;  2XE4 A;  3J80 g;  3EI3 A;  5FQD A;  2HU7 A;  4FA9 D;  3RFH A;  3I7L A;  4K3J B;  4AEZ A;  4NBM A;  2G9A A;  3JRO A;  3NIF A;  2OVQ B;  2CNX A;  1GOT B;  5EMK B;  5HYN B;  3KRX B;  3UVK A;  4I79 A;  3EI2 B;  5AJA A;  1Q47 A;  2VDO A;  4A09 A;  3DXM C;  5AFU 3;  5TF2 A;  2IUV A;  3IIY A;  3IJC A;  3EWE A;  4QAM A;  3DXK C;  3FGB A;  3EQ7 A;  3P4F A;  4Z7Q A;  5CXB B;  2CO0 A;  1VYH C;  5FFG A;  4JSP C;  5CXC A;  3MKS B;  4GQ2 P;  3UKU C;  3V5W B;  3ORV D;  4A08 A;  3BG1 A;  5FFO A;  3EQ8 A;  4DNW A;  1XHM A;  3ZE2 A;  3MZK A;  4EWR A;  1FWX A;  4ERQ A;  4FWW A;  1H2W A;  3ZDX A;  5HE3 B;  2Z2O A;  4J8G A;  2CN2 A;  3ZWL B;  2VDL A;  4GGC A;  2HJ4 A;  2H9P A;  2VZ3 A;  1QFS A;  3V9F A;  2AH1 A;  3CFV A;  3OW8 A;  2PM9 B;  3SN6 B;  3F3P A;  4X3E A;  1O6F A;  2P9I C;  5C2W B;  3EI4 A;  4BH6 A;  3PVU B;  3MXX A;  4G1E A;  4WK0 A;  4J84 A;  3L4O D;  2VDP A;  1M1X A;  4GQB B;  5H14 A;  3V4P A;  3PXW D;  3IUM A;  4ERZ A;  2GC7 A;  2WQ8 A;  3SJL D;  2Z2N A;  4BCD A;  5EM2 B;  4IRZ A;  2Z2P A;  3O4I A;  5THA A;  4K3I D;  1E8N A;  2YBA A;  4A0A B;  4PBY A;  5TEE A;  4AMY A;  2IAA A;  3FCS A;  1UOQ A;  3I7N A;  1XIP A;  4N14 A;  2H14 A;  2XDW A;  3N0E A;  5HE0 B;  4L3G D;  2PM9 A;  3UVL A;  3JPX A;  4PC0 A;  5CYK A;  3ZE0 A;  4ZOY A;  3EU7 A;  3F3F A;  4GGD A;  4NAA A;  4CY3 A;  3JAM g;  4QQE A;  4D9S A;  3SLE D;  4JD2 C;  3DSM A;  4CY2 A;  5C9Z B;  4Z8L A;  2IWK A;  4CY1 A;  5EM2 A;  4E54 B;  1UOP A;  5I5M A;  2YNP A;  2HU5 A;  4L9O A;  2EIB A;  3I7H A;  3IUQ A;  2HU8 A;  3IUL A;  2XYI A;  4O3T B;  3I7O A;  3GC3 B;  4Z7O A;  4ZN4 A;  3KCI A;  3OKY B;  3EG6 A;  4J8B A;  5GMK n;  4O2W A;  3EI1 A;  4XEI C;  3UVN A;  5M61 A;  2P9U C;  3AH8 B;  5EAP A;  3RRM C;  5M5S A;  3I2N A;  4MK0 B;  2H13 A;  2BKL A;  3FRX A;  3AL9 A;  2P9S C;  4QRJ A;  5GSA A;  5I5I A;  4JT6 C;  1U4C A;  4D0K A;  4A09 B;  3PVW B;  1JJU B;  4E54 A;  3PE7 A;  5TEF A;  4CY5 A;  2AQ5 A;  3RN0 D;  4GM8 A;  4J0W A;  1PEV A;  3OKY A;  3W15 A;  4A08 B;  5M5U A;  4BUJ C;  3O4H A;  1L0Q A;  2G99 A;  4UM9 A;  3PXT D;  3MKQ A;  3UVO A;  4WK2 A;  1H2X A;  4ZOV A;  3QI0 A;  1GOG A;  5FLX g;  4J79 A;  2EIE A;  1JOF A;  4FA1 D;  3EMH A;  3UR4 A;  5B4W A;  2OK4 A;  2QZP A;  1RI6 A;  4QL1 A;  4AN1 A;  1A0R B;  3OF7 A;  1N6F A;  4NC4 A;  3F3G A;  4O02 A;  4ZOX A;  2J55 H;  5JWZ A;  3EI4 B;  2OVR B;  3PSL A;  4D6V A;  1P22 A;  4U7A A;  4FA5 D;  4A11 B;  4ES0 A;  2PM6 B;  1MG3 A;  3IUR A;  3C9C A;  2Q7Q A;  5GXI A;  4L1M A;  3VH0 A;  2I0T A;  5EAM A;  3RLM D;  4NEN A;  3B7F A;  3L4M D;  3MUO A;  5E6U A;  4LG9 A;  4GM3 A;  4JXM A;  3QHY B;  3JZN A;  3IVM A;  5A2Q g;  4QT8 A;  1JV2 A;  3SWS D;  3AFC A;  3NVQ A;  3T3P A;  3NVX A;  3AL8 B;  2B5M A;  1PI6 A;  3CIK B;  4J86 A;  5CYK B;  3VA6 A;  4PNK B;  2EIC A;  3GRE A;  3O4G A;  2IUQ A;  4A11 A;  3FM0 A;  4O3U B;  2AH0 A;  4MMX A;  2YMU A;  4ESG A;  2OVP B;  1B9X A;  1GOF A;  4LG8 A;  2QR5 A;  3K6S A;  1YR2 A;  2AGL A;  5AMS A;  3OKT A;  2O9K A;  2HKR A;  4J87 A;  1SQ9 A;  2J56 H;  3SVW D;  4O1Q D;  4JHN A;  3ODT A;  4CI1 A;  4H5I A;  2OK6 A;  3JZG A;  1K8K C;  1H2Z A;  3AL8 A;  2VDN A;  3NIG A;  4X63 B;  2QXV A;  2UZX B;  4A2L A;  2W18 A;  3EI1 B;  2CE8 A;  2P9P C;  5K19 A;  4MMY A;  1XKS A;  1JMX B;  3VGZ A;  2HXC A;  5C86 A;  3C5M A;  2AGX A;  1N6E A;  4PBZ A;  4A7J A;  1TYE A;  2IUP A;  4XYI A;  2I0S A;  2H6Q A;  4KFM B;  2P9K C;  5EAR A;  4GM9 A;  3SBR A;  2H6K A;  4IA9 A;  3K26 A;  2YB8 B;  5K1C C;  1QFM A;  4DNU A;  3JZH A;  4BCC A;  4XYH A;  4Z7N A;  4OZU A;  5IC7 A;  4U1E I;  1U2V C;  3C75 H;  3KRW B;  1L5G A;  3RSE C;  3GFC A;  1GOH A;  5IGO A;  2AGY A;  4HDJ A;  4Y7R A;  5EMM B;  4J82 A;  1S4U X;  4CC9 A;  4FAV D;  3IJE A;  4WK4 A;  3OKW A;  3EQ9 A;  4J81 A;  3SBP A;  1K3I A;  3C99 A;  4X61 B;  2J57 G;  1NR0 A;  5IJ7 E;  2OJY A;  3IUJ A;  1B9Y A;  5E6R A;  2GC4 A;  1OLZ A;  4O9D A;  2HKM A;  4TZ4 A;  3K27 A;  3T3M A;  4JHP C;  5FA5 B;  3SXT D;  5IJ8 E;  2XL2 A;  3IJ0 A;  4JSN C;  2XL3 A;  5H1M A;  4J73 A;  5FXY A;  4H5J A;  5FKS A;  4AN0 A;  5C2V B;  4JSV C;  4AMZ A;  2B4E A;  1OMW B;  2H47 A;  2HES X;  2BBK H;  1R5M A;  4ZOZ A;  4CZV A;  2B5N A;  2OIZ A;  3MVD K;  3PSC B;  1C9L A;  3V7D B;  3DWL C;  3ZDY A;  1JTD B;  3OL2 B;  4PXW A;  5C92 A;  4RE5 A;  2XU7 A;  4GGA A;  5FKT A;  5HQG A;  3IIW A;  4UI9 R;  2CN3 A;  3DDU A;  4FAN D;  4GMB A;  5FKR A;  3MMY A;  2B5L A;  5HDB A;  2VDK A;  3HFQ A;  1O6G A;  3I89 A;  4L1Q D;  2JKX A;  3CFS B;  1TBG A;  1SHY B;  2H9L A;  3NID A;  2XZG A;  2IUR A;  1C9I A;  4LGN A;  5E6S A;  2H9M A;  4R7A B;  5HE1 B;  1I2M B;  4Y5R D;  2HYE A;  3U4Y A;  1UTC A;  3OL2 A;  4G56 B;  1GXR A;  1E8M A;  1VE7 A;  5H17 A;  4BP8 A;  3SMR A;  3ULE C;  3UKR C;  4E5Z B;  4NSX A;  3UVM A;  3MZL A;  3V4V A;  2MTA H;  4G55 A;  3JB9 L;  2P9N C;  4J77 A;  2EID A;  5M5V A;  3JRP A;  2CO0 C;  5IT9 g;  1QNI A;  1N6D A;  3SHF A;  4A0B B;  2IWF A;  3EI2 A;  5GXH A;  5M5T A;  4GQ1 A;  1VE6 A;  2YNO A;  4JT5 C;  5EAL A;  4JSX C;  5TDH B;  2I0R A;  4ERY A;  5CXB A;  3DM0 A;  3SBQ A;  1JMZ B;  1UOO A;  4AX4 A;  4FHL A;  4CI3 A;  4O45 A;  2EBS A; 
#chains in the Genus database with same CATH homology
 4FA4 D;  5HE2 B;  4CI8 A;  3BWS A;  4E5Z A;  1TYQ C;  3PXS D;  2HJB A;  5FKQ A;  5SXM A;  1GG2 B;  3BG0 A;  3E0C A;  3A0F A;  1PGU A;  2TRC B;  4A0B A;  2UZY B;  4IMM A;  5EMJ B;  4A2M A;  4J0X A;  4YVD A;  2H9N A;  4CI2 A;  1MDA H;  5IGQ A;  2P9L C;  3IKO A;  4L3H D;  2YNN A;  5EML B;  2I3S A;  1GP2 B;  2H6N A;  3I7P A;  4GZ8 A;  2I3T A;  1SQJ A;  3SFZ A;  4A0A A;  4PSX B;  3RMZ D;  2AGW A;  3EI3 B;  3I8C A;  2AGZ A;  2H68 A;  3IJ1 A;  4PSW B;  2CE9 A;  4J78 A;  4BL0 A;  1MG2 A;  3J81 g;  1NEX B;  2H3X A;  3RFG A;  2GNQ A;  3NVN A;  4CZY A;  1YFQ A;  3I8E A;  1K32 A;  3OTT A;  5I5J A;  4AOW A;  1PBY B;  4CZX A;  3SCY A;  3I7K A;  4FB1 D;  2BCJ B;  2QC5 A;  2PBI B;  3RN1 D;  5KDO B;  4X60 B;  3N0D A;  1ERJ A;  5CXC B;  4OWR A;  2PM7 B;  3J80 g;  3EI3 A;  5FQD A;  4FA9 D;  3RFH A;  3I7L A;  4K3J B;  4AEZ A;  2G9A A;  3JRO A;  2OVQ B;  2CNX A;  1GOT B;  5EMK B;  5HYN B;  3KRX B;  3UVK A;  4I79 A;  3EI2 B;  5AJA A;  1Q47 A;  4A09 A;  3DXM C;  5AFU 3;  5TF2 A;  2IUV A;  3IIY A;  3IJC A;  3EWE A;  3DXK C;  3FGB A;  3P4F A;  5CXB B;  2CO0 A;  1VYH C;  4JSP C;  5CXC A;  3MKS B;  4GQ2 P;  3UKU C;  3V5W B;  3ORV D;  4A08 A;  3BG1 A;  1XHM A;  3MZK A;  4EWR A;  1FWX A;  4ERQ A;  4FWW A;  5HE3 B;  2Z2O A;  4J8G A;  2CN2 A;  3ZWL B;  4GGC A;  2HJ4 A;  2H9P A;  3V9F A;  2AH1 A;  3CFV A;  3OW8 A;  2PM9 B;  3SN6 B;  3F3P A;  4X3E A;  2P9I C;  5C2W B;  3EI4 A;  4BH6 A;  3PVU B;  3MXX A;  4J84 A;  3L4O D;  4GQB B;  5H14 A;  3PXW D;  4ERZ A;  2GC7 A;  5EM2 B;  3SJL D;  2Z2N A;  2Z2P A;  5THA A;  4K3I D;  2YBA A;  4A0A B;  4PBY A;  5TEE A;  2IAA A;  3I7N A;  1XIP A;  4N14 A;  2H14 A;  3N0E A;  5HE0 B;  4L3G D;  2PM9 A;  3UVL A;  3JPX A;  4PC0 A;  5CYK A;  4ZOY A;  3EU7 A;  3F3F A;  4GGD A;  4CY3 A;  3JAM g;  4QQE A;  3SLE D;  4JD2 C;  3DSM A;  4CY2 A;  5C9Z B;  4Z8L A;  2IWK A;  4CY1 A;  5EM2 A;  4E54 B;  5I5M A;  2YNP A;  4L9O A;  3I7H A;  2XYI A;  4O3T B;  3I7O A;  4ZN4 A;  3OKY B;  3EG6 A;  4J8B A;  5GMK n;  3EI1 A;  4XEI C;  3UVN A;  2P9U C;  3AH8 B;  5EAP A;  3RRM C;  3I2N A;  4MK0 B;  2H13 A;  3FRX A;  3AL9 A;  2P9S C;  4QRJ A;  5GSA A;  5I5I A;  4JT6 C;  1U4C A;  4D0K A;  4A09 B;  3PVW B;  1JJU B;  4E54 A;  3PE7 A;  5TEF A;  4CY5 A;  2AQ5 A;  3RN0 D;  4GM8 A;  4J0W A;  1PEV A;  3OKY A;  3W15 A;  4A08 B;  4BUJ C;  1L0Q A;  2G99 A;  3PXT D;  3MKQ A;  3UVO A;  4ZOV A;  5FLX g;  4J79 A;  1JOF A;  4FA1 D;  3EMH A;  3UR4 A;  5B4W A;  2OK4 A;  1RI6 A;  4QL1 A;  1A0R B;  1N6F A;  3F3G A;  4ZOX A;  2J55 H;  5JWZ A;  3EI4 B;  2OVR B;  3PSL A;  4D6V A;  1P22 A;  4U7A A;  4FA5 D;  4A11 B;  4ES0 A;  2PM6 B;  1MG3 A;  3C9C A;  2Q7Q A;  5GXI A;  3VH0 A;  2I0T A;  5EAM A;  3RLM D;  3B7F A;  3L4M D;  4LG9 A;  4GM3 A;  4JXM A;  3JZN A;  5A2Q g;  4QT8 A;  3SWS D;  3AFC A;  3NVQ A;  3NVX A;  3AL8 B;  2B5M A;  1PI6 A;  3CIK B;  4J86 A;  5CYK B;  3VA6 A;  4PNK B;  3GRE A;  2IUQ A;  4A11 A;  3FM0 A;  4O3U B;  2AH0 A;  4ESG A;  2YMU A;  2OVP B;  1B9X A;  4LG8 A;  2AGL A;  5AMS A;  3OKT A;  2O9K A;  2HKR A;  4J87 A;  1SQ9 A;  2J56 H;  3SVW D;  4O1Q D;  4CI1 A;  3ODT A;  4H5I A;  2OK6 A;  3JZG A;  1K8K C;  3AL8 A;  4X63 B;  2QXV A;  2UZX B;  4A2L A;  2W18 A;  3EI1 B;  2CE8 A;  2P9P C;  5K19 A;  1XKS A;  1JMX B;  3VGZ A;  2HXC A;  3C5M A;  2AGX A;  1N6E A;  4PBZ A;  4A7J A;  2IUP A;  4XYI A;  2I0S A;  2H6Q A;  4KFM B;  2P9K C;  5EAR A;  4GM9 A;  3SBR A;  2H6K A;  4IA9 A;  3K26 A;  2YB8 B;  5K1C C;  3JZH A;  4XYH A;  4OZU A;  5IC7 A;  4U1E I;  1U2V C;  3C75 H;  3KRW B;  3RSE C;  3GFC A;  5IGO A;  2AGY A;  4HDJ A;  4Y7R A;  5EMM B;  4J82 A;  1S4U X;  4CC9 A;  4FAV D;  3OKW A;  4J81 A;  3SBP A;  3C99 A;  4X61 B;  2J57 G;  1NR0 A;  5IJ7 E;  2OJY A;  1B9Y A;  2GC4 A;  1OLZ A;  4O9D A;  2HKM A;  4TZ4 A;  3K27 A;  5FA5 B;  3SXT D;  5IJ8 E;  2XL2 A;  3IJ0 A;  4JSN C;  2XL3 A;  5H1M A;  4J73 A;  5FXY A;  4H5J A;  5FKS A;  5C2V B;  4JSV C;  2B4E A;  1OMW B;  2H47 A;  2HES X;  2BBK H;  1R5M A;  4ZOZ A;  4CZV A;  2B5N A;  2OIZ A;  3PSC B;  3V7D B;  3DWL C;  3OL2 B;  4PXW A;  2XU7 A;  4GGA A;  5FKT A;  5HQG A;  3IIW A;  4UI9 R;  2CN3 A;  4FAN D;  4GMB A;  5FKR A;  3MMY A;  2B5L A;  3HFQ A;  3I89 A;  4L1Q D;  3CFS B;  1TBG A;  1SHY B;  2H9L A;  2IUR A;  4LGN A;  2H9M A;  4R7A B;  5HE1 B;  4Y5R D;  2HYE A;  3U4Y A;  4G56 B;  3OL2 A;  1GXR A;  5H17 A;  3SMR A;  3ULE C;  3UKR C;  4E5Z B;  4NSX A;  3UVM A;  3MZL A;  3JB9 L;  2MTA H;  2P9N C;  4J77 A;  3JRP A;  2CO0 C;  5IT9 g;  1QNI A;  1N6D A;  3SHF A;  4A0B B;  2IWF A;  3EI2 A;  5GXH A;  4GQ1 A;  2YNO A;  4JT5 C;  5EAL A;  4JSX C;  5TDH B;  2I0R A;  4ERY A;  5CXB A;  3DM0 A;  3SBQ A;  1JMZ B;  4FHL A;  4CI3 A;  4O45 A;  2EBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...