4ES0A

X-ray structure of wdr5-setd1b win motif peptide binary complex
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for WDR5 interaction (Win) motif recognition in human SET1 family histone methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transferase
molecule keywords WD repeat-containing protein 5
total genus 102
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2012-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4es0A00
2IUVA 2AQ5A 2YB8B 5EALA 3F3FA 3PVUB 3RLMD 1K32A 4PXWA 2PBIB 4BL0A 4K3ID 4JXMA 3IIWA 3RFGA 4AOWA 4CI3A 3RFHA 4E54B 3DWLC 3IJCA 3U4YA 1QNIA 3I7LA 3SHFA 4GM3A 1B9YA 5H17A 3EI2A 2XU7A 4QT8A 3SLED 1ERJA 2Z2PA 5GMKn 3DM0A 4CZYA 4O3UB 5EMKB 3UVMA 3MKSB 3EI2B 3EI4B 3BG0A 3K27A 5TF2A 4LG8A 4U7AA 4J81A 5IGQA 2J56H 1PGUA 3EU7A 3PE7A 1P22A 3I7PA 4G56B 4J8BA 1MG3A 2P9NC 3I8EA 5C2WB 4E5ZA 4GGDA 4ERYA 3ODTA 3JRPA 1XHMA 4FHLA 2HXCA 2H6KA 4D6VA 3JZNA 5C9ZB 5TDHB 4ESGA 5CXCB 3ORVD 1JMZB 2H47A 4FA5D 4GQ1A 3SBRA 3OKTA 3EG6A 2OK4A 3RN0D 2IUPA 1FWXA 3C75H 2PM9B 4JT5C 4PBYA 4E54A 3KRWB 3OW8A 2I3TA 2TRCB 4PBZA 5EMLB 3AL9A 3N0EA 5EM2B 4QL1A 1OLZA 1Q47A 4EWRA 3V9FA 3KRXB 3V5WB 1VYHC 3J81g 1L0QA 2Q7QA 3A0FA 4KFMB 2HESX 2AGXA 3B7FA 3I7HA 3MKQA 5CYKA 2HKRA 2O9KA 3EI1B 5AFU3 1TYQC 2PM9A 1GG2B 2PM7B 3SBPA 4A11A 4J78A 2P9IC 4CY3A 1K8KC 5HE2B 3UVKA 2CE8A 2I0TA 4O45A 4H5IA 4ZOVA 2XYIA 2H68A 2IUQA 2IAAA 2GC4A 3RMZD 4CI1A 3GREA 4J84A 3SCYA 2W18A 5SXMA 4E5ZB 3EI1A 1XIPA 4ZOXA 4A09B 3MZLA 4L3HD 1N6FA 4A2LA 3AH8B 4A11B 5JWZA 1PI6A 2QC5A 3I2NA 1GP2B 4X63B 5IT9g 3N0DA 2HKMA 3MZKA 3OKYA 5I5MA 5CXBA 5EAPA 2HJBA 4I79A 5FKRA 3PXSD 4PC0A 3UVLA 3OKYB 2P9KC 3IKOA 2H3XA 3JROA 3W15A 2EBSA 1SHYB 4O3TB 3ZWLB 3E0CA 3NVNA 5FA5B 2UZXB 1R5MA 5HE0B 3JB9L 2OIZA 3IJ1A 2OK6A 3K26A 2H14A 4A7JA 2AGLA 2YNPA 2G99A 4U1EI 4FA9D 3PXTD 4XYIA 2YBAA 2BCJB 3C5MA 3SBQA 4A0BB 1PEVA 2CNXA 4FB1D 4ES0A 1N6EA 3I7KA 5EARA 4GM9A 2H9LA 3CIKB 4J8GA 4FA1D 4XYHA 5K1CC 4ERQA 5EAMA 3FGBA 2P9UC 3I8CA 4HDJA 4ZN4A 5FKTA 3PSCB 4PSXB 4ZOYA 1NR0A 4Z8LA 3OKWA 4J79A 3C99A 2PM6B 2YNNA 5H14A 4CI8A 4K3JB 4O1QD 2B5LA 4FA4D 3FRXA 4A0AA 2B4EA 2CO0C 2H6NA 4X61B 3RN1D 4GQ2P 4J77A 3I7NA 4NSXA 3MMYA 2BBKH 4GGCA 2XL3A 3UVOA 5K19A 3NVXA 5GSAA 5FKSA 2IURA 3F3PA 4A0AB 5HE3B 4BH6A 5HQGA 4J0XA 3VGZA 3OTTA 4XEIC 2OJYA 5GXIA 3SFZA 3AFCA 2IWFA 4R7AB 3F3GA 3V7DB 2H6QA 2AGWA 4FWWA 4CI2A 3DXKC 2P9SC 2AH1A 2OVPB 3C9CA 1GOTB 5A2Qg 4YVDA 2AGZA 4PSWB 3CFVA 4UI9R 3DSMA 4JSVC 3AL8B 4D0KA 2MTAH 3SXTD 5IJ8E 4ZOZA 5TEFA 5IGOA 5KDOB 4GMBA 4A08A 3RSEC 4J82A 4CZXA 4BUJC 3L4OD 2OVQB 3IJ0A 3EWEA 3DXMC 5EMMB 1U2VC 4IMMA 3GFCA 3VH0A 3P4FA 4MK0B 4FAND 4A0BA 5FXYA 4CY5A 1JJUB 2P9LC 4JSNC 4PNKB 4ERZA 5IC7A 5THAA 3UKUC 5CXCA 4Y7RA 3JAMg 1JMXB 2GNQA 3BG1A 2B5MA 1NEXB 1MG2A 4IA9A 5AJAA 4AEZA 3VA6A 3J80g 3SWSD 2CE9A 4LG9A 1MDAH 2I3SA 2OVRB 5HYNB 1PBYB 3HFQA 4JSPC 4A09A 4O9DA 3IIYA 4CY1A 4QQEA 1U4CA 3ULEC 2H13A 2J55H 3EI3A 5CXBB 4QRJA 2Z2OA 5I5IA 2IWKA 5FLXg 1XKSA 5GXHA 1S4UX 3PVWB 4LGNA 1OMWB 2XL2A 4A2MA 4JSXC 1N6DA 3FM0A 2AH0A 1SQJA 4J73A 4CY2A 3OL2A 4GGAA 3EI4A 2UZYB 5HE1B 3SJLD 2H9NA 2J57G 4GM8A 3SVWD 3CFSB 4JT6C 5H1MA 1RI6A 3JZHA 1JOFA 2YMUA 2B5NA 4Y5RD 2P9PC 3EI3B 2AGYA 3UVNA 1GXRA 5EMJB 5C2VB 4JD2C 1SQ9A 4FAVD 5EM2A 4L1QD 2HYEA 3RRMC 2H9MA 2I0RA 4TZ4A 4CC9A 4A08B 5IJ7E 3UKRC 2CO0A 5FKQA 2H9PA 5FQDA 3I7OA 3AL8A 3I89A 5B4WA 3JPXA 3SMRA 2HJ4A 5TEEA 2I0SA 1YFQA 2G9AA 1A0RB 4H5JA 2GC7A 4GZ8A 2Z2NA 4L9OA 4X60B 2CN2A 3MXXA 3PSLA 2CN3A 4CZVA 3PXWD 3OL2B 3EMHA 4N14A 3UR4A 3L4MD 5CYKB 1TBGA 4X3EA 3NVQA 4GQBB 3BWSA 4J86A 4OWRA 5AMSA 3SN6B 1B9XA 2YNOA 2QXVA 4L3GD 5I5JA 4J87A 3JZGA 4J0WA 4OZUA
chains in the Genus database with same CATH superfamily
2IUVA 2AQ5A 4AMZA 2YB8B 5EALA 3F3FA 3PVUB 3RLMD 1K32A 4PXWA 2PBIB 4BL0A 4K3ID 4JXMA 3IIWA 3RFGA 1YR2A 4AOWA 4CI3A 1O6FA 3RFHA 2VDLA 3K72A 4AN0A 4E54B 3DWLC 3IJCA 4D9SA 3U4YA 1QNIA 3I7LA 3SHFA 4GM3A 1B9YA 5H17A 3EI2A 2XU7A 1E8NA 4WK2A 4L1MA 4QT8A 4NC4A 5FFGA 3SLED 1ERJA 2Z2PA 5GMKn 3DM0A 4CZYA 1H2ZA 4O3UB 5EMKB 3UVMA 4WK0A 3MKSB 3EI2B 3EI4B 3BG0A 1H2YA 3K27A 5M5UA 5TF2A 4LG8A 2EIBA 4U7AA 4J81A 5IGQA 1VE7A 2J56H 1PGUA 3EU7A 3PE7A 1UOPA 4MMZA 1UTCA 3IUMA 1P22A 3I7PA 1VE6A 4BP9A 1E5TA 4O2WA 4G56B 4J8BA 1MG3A 2P9NC 3I8EA 5C2WB 4E5ZA 3K6SA 4GGDA 4ERYA 3ODTA 4BCBA 3QI0A 3ZE1A 3JRPA 1XHMA 4FHLA 2HXCA 3IVMA 4WK4A 1JV2A 2H6KA 4D6VA 3JZNA 4AN1A 5C9ZB 5TDHB 4ESGA 2EIDA 5CXCB 3ORVD 2VDMA 2BKLA 1JMZB 2H47A 4FA5D 2QZPA 4GQ1A 3SBRA 3OKTA 3EG6A 2OK4A 1E8MA 1BPOA 3RN0D 2IUPA 1FWXA 3C75H 2PM9B 4JT5C 4PBYA 4E54A 3KRWB 3OW8A 2I3TA 2TRCB 4PBZA 5EMLB 3AL9A 3N0EA 5EM2B 4QL1A 1OLZA 1Q47A 4EWRA 3V9FA 4BP8A 3KRXB 4Z7QA 3V5WB 1VYHC 3J81g 1L0QA 2Q7QA 4RE5A 3A0FA 4KFMB 2HESX 2AGXA 3O4IA 3B7FA 3I7HA 3MKQA 4UM9A 5E6SA 5CYKA 2HKRA 1U8CA 2O9KA 3EI1B 5AFU3 1TYQC 2PM9A 3T3PA 1GG2B 1TYEA 2PM7B 3SBPA 4A11A 3IJEA 4J78A 2P9IC 4CY3A 1K8KC 4AX4A 5HE2B 3UVKA 2CE8A 2I0TA 4O45A 4H5IA 4ZOVA 2XYIA 2VDQA 2H68A 2IUQA 1UOQA 2IAAA 2GC4A 3RMZD 4CI1A 3GREA 4J84A 3SCYA 3V4PA 2W18A 5SXMA 4E5ZB 3EI1A 1XIPA 4ZOXA 4A09B 3MZLA 4L3HD 1N6FA 4A2LA 3AH8B 4A11B 5JWZA 1PI6A 2QC5A 3I2NA 1GP2B 4X63B 5IT9g 3GD1I 2VC2A 3N0DA 2HKMA 3MZKA 3OKYA 5I5MA 5CXBA 5EAPA 2HJBA 4I79A 5FKRA 1GOHA 3PXSD 4PC0A 3UVLA 3OKYB 2P9KC 3IKOA 2H3XA 4DNUA 3JROA 3EQ7A 3W15A 2EBSA 3K71A 4O3TB 3ZWLB 3E0CA 3NVNA 5FA5B 2UZXB 1R5MA 5HE0B 3JB9L 2OIZA 3IJ1A 2OK6A 3ZE0A 3K26A 5E6RA 2H14A 2VDNA 4A7JA 2AGLA 2YNPA 2G99A 4U1EI 2EIEA 3IUJA 4FA9D 1I2MB 5C92A 3PXTD 4XYIA 2VDRA 1QFSA 2XDWA 2YBAA 2BCJB 1H2XA 2QR5A 3C5MA 3SBQA 4A0BB 1PEVA 2CNXA 3NIFA 4IRZA 5M5RA 4FB1D 4ES0A 1N6EA 3I7KA 5EARA 4GM9A 2H9LA 3CIKB 2XE4A 4J8GA 4FA1D 1UOOA 4XYHA 3O4JA 5K1CC 4ERQA 5EAMA 3FGBA 2P9UC 4DNVA 3I8CA 4HDJA 4ZN4A 5FKTA 3PSCB 4PSXB 4ZOYA 4OZUA 1NR0A 4MMXA 3OKWA 3C99A 4J79A 4Z8LA 2PM6B 2YNNA 5H14A 2HU7A 3OF7A 2XZGA 4K3JB 4CI8A 4O1QD 2B5LA 4FA4D 3FRXA 4A0AA 2B4EA 3ZDYA 2CO0C 2VZ1A 1JTDB 3O4HA 2H6NA 4X61B 3RN1D 4GQ2P 4J77A 3I7NA 4NSXA 5M61A 3MMYA 2BBKH 4GGCA 2XL3A 5M5TA 3UVOA 5K19A 3NVXA 5GSAA 5FKSA 2IURA 3F3PA 4A0AB 5HE3B 4BH6A 3VI4A 1H2WA 5HQGA 4J0XA 3VGZA 3OTTA 4XEIC 2OJYA 3IUQA 2VDOA 5GXIA 3SFZA 4UM8A 1GOFA 3AFCA 2IWFA 4R7AB 3F3GA 3V7DB 1L5GA 2H6QA 2HU5A 2AGWA 2VDPA 1O6GA 2VZ3A 3O4GA 4FWWA 4CI2A 3DXKC 4BCCA 2P9SC 2AH1A 2OVPB 3C9CA 1GOTB 4QAMA 5A2Qg 4YVDA 2AGZA 4PSWB 3CFVA 3FCUA 4UI9R 3DSMA 4JSVC 3AL8B 4D0KA 2MTAH 3SXTD 5IJ8E 5E6UA 4G55A 3FCSA 4ZOZA 5TEFA 4JHNA 5IGOA 5KDOB 4GMBA 4A08A 2HU8A 3RSEC 4J82A 4CZXA 4BUJC 3L4OD 2OVQB 3IJ0A 1GOGA 3EWEA 3DXMC 5EMMB 1U2VC 4IMMA 3GFCA 3NIGA 3VH0A 3P4FA 4MK0B 4FAND 4A0BA 1T2XA 1VZ3A 5FXYA 4CY5A 1JJUB 3ZE2A 2P9LC 4JSNC 4PNKB 4ERZA 3EQ8A 5IC7A 4Z7OA 2JKXA 5THAA 3UKUC 5CXCA 3KCIA 4Y7RA 3T3MA 3JAMg 1JMXB 2GNQA 3BG1A 4G1EA 4BCDA 2B5MA 1NEXB 1MG2A 4IA9A 5AJAA 4AEZA 3VA6A 3J80g 3SWSD 2CE9A 4LG9A 3NIDA 1MDAH 2I3SA 2OVRB 5HYNB 3DDUA 1PBYB 3HFQA 4JSPC 4O02A 4A09A 1K3IA 4O9DA 3IIYA 4CY1A 4QQEA 5HDBA 1U4CA 3ULEC 2H13A 2J55H 3EI3A 5CXBB 4QRJA 2Z2OA 5I5IA 2IWKA 5FLXg 1XKSA 5GXHA 1S4UX 3PVWB 4LGNA 1OMWB 2XL2A 4A2MA 4JSXC 1N6DA 3FM0A 2AH0A 1SQJA 4J73A 4CY2A 3OL2A 4GGAA 3GC3B 3EI4A 2UZYB 5HE1B 3SJLD 2H9NA 2J57G 3IULA 4GM8A 4RE6A 3SVWD 4Z7NA 3CFSB 1QFMA 2VDKA 4JT6C 4NENA 5H1MA 1RI6A 3JZHA 1JOFA 2YMUA 1C9IA 2B5NA 4Y5RD 5M5VA 2P9PC 3EI3B 4NBMA 2AGYA 2WQ8A 3UVNA 1GXRA 5EMJB 5C2VB 1A12A 4JD2C 1SQ9A 4FAVD 4MMYA 5EM2A 4L1QD 2HYEA 3RRMC 2H9MA 4NAAA 2I0RA 4TZ4A 4CC9A 2EICA 3V4VA 4A08B 1C9LA 5IJ7E 3UKRC 2CO0A 5FKQA 2H9PA 4JHPC 3I7OA 5FQDA 4WJKA 3IUNA 3IURA 3AL8A 3ZDXA 3ZDZA 3I89A 5B4WA 3JPXA 3SMRA 2HJ4A 4AMYA 5TEEA 3VI3A 2I0SA 1YFQA 2G9AA 1A0RB 4H5JA 2GC7A 4GZ8A 2Z2NA 4L9OA 4X60B 3MUNA 5FFOA 2CN2A 3QHYB 3MXXA 3PSLA 1M1XA 2CN3A 4CZVA 3PXWD 4G1MA 3OL2B 4DNWA 3EMHA 4N14A 3UR4A 3EQ9A 3L4MD 1VZ2A 5CYKB 1TBGA 4X3EA 3NVQA 4GQBB 3MUOA 3BWSA 4J86A 4OWRA 5AMSA 3SN6B 5C86A 1B9XA 2YNOA 5M5SA 2QXVA 4L3GD 5I5JA 3MVDK 4J87A 3JZGA 4J0WA 1SHYB
chains in the Genus database with same CATH topology
2IUVA 2AQ5A 2YB8B 5EALA 3F3FA 3PVUB 3RLMD 1K32A 4PXWA 2PBIB 4BL0A 4K3ID 4JXMA 3IIWA 3RFGA 4AOWA 4CI3A 3RFHA 4E54B 3DWLC 3IJCA 3U4YA 1QNIA 3I7LA 3SHFA 4GM3A 1B9YA 5H17A 3EI2A 2XU7A 4QT8A 3SLED 1ERJA 2Z2PA 5GMKn 3DM0A 4CZYA 4O3UB 5EMKB 3UVMA 3MKSB 3EI2B 3EI4B 3BG0A 3K27A 5TF2A 4LG8A 4U7AA 4J81A 5IGQA 2J56H 1PGUA 3EU7A 3PE7A 1P22A 3I7PA 4G56B 4J8BA 1MG3A 2P9NC 3I8EA 5C2WB 4E5ZA 4GGDA 4ERYA 3ODTA 3JRPA 1XHMA 4FHLA 2HXCA 2H6KA 4D6VA 3JZNA 5C9ZB 5TDHB 4ESGA 5CXCB 3ORVD 1JMZB 2H47A 4FA5D 4GQ1A 3SBRA 3OKTA 3EG6A 2OK4A 3RN0D 2IUPA 1FWXA 3C75H 2PM9B 4JT5C 4PBYA 4E54A 3KRWB 3OW8A 2I3TA 2TRCB 4PBZA 5EMLB 3AL9A 3N0EA 5EM2B 4QL1A 1OLZA 1Q47A 4EWRA 3V9FA 3KRXB 3V5WB 1VYHC 3J81g 1L0QA 2Q7QA 3A0FA 4KFMB 2HESX 2AGXA 3B7FA 3I7HA 3MKQA 5CYKA 2HKRA 2O9KA 3EI1B 5AFU3 1TYQC 2PM9A 1GG2B 2PM7B 3SBPA 4A11A 4J78A 2P9IC 4CY3A 1K8KC 5HE2B 3UVKA 2CE8A 2I0TA 4O45A 4H5IA 4ZOVA 2XYIA 2H68A 2IUQA 2IAAA 2GC4A 3RMZD 4CI1A 3GREA 4J84A 3SCYA 2W18A 5SXMA 4E5ZB 3EI1A 1XIPA 4ZOXA 4A09B 3MZLA 4L3HD 1N6FA 4A2LA 3AH8B 4A11B 5JWZA 1PI6A 2QC5A 3I2NA 1GP2B 4X63B 5IT9g 3N0DA 2HKMA 3MZKA 3OKYA 5I5MA 5CXBA 5EAPA 2HJBA 4I79A 5FKRA 3PXSD 4PC0A 3UVLA 3OKYB 2P9KC 3IKOA 2H3XA 3JROA 3W15A 2EBSA 1SHYB 4O3TB 3ZWLB 3E0CA 3NVNA 5FA5B 2UZXB 1R5MA 5HE0B 3JB9L 2OIZA 3IJ1A 2OK6A 3K26A 2H14A 4A7JA 2AGLA 2YNPA 2G99A 4U1EI 4FA9D 3PXTD 4XYIA 2YBAA 2BCJB 3C5MA 3SBQA 4A0BB 1PEVA 2CNXA 4FB1D 4ES0A 1N6EA 3I7KA 5EARA 4GM9A 2H9LA 3CIKB 4J8GA 4FA1D 4XYHA 5K1CC 4ERQA 5EAMA 3FGBA 2P9UC 3I8CA 4HDJA 4ZN4A 5FKTA 3PSCB 4PSXB 4ZOYA 1NR0A 4Z8LA 3OKWA 4J79A 3C99A 2PM6B 2YNNA 5H14A 4CI8A 4K3JB 4O1QD 2B5LA 4FA4D 3FRXA 4A0AA 2B4EA 2CO0C 2H6NA 4X61B 3RN1D 4GQ2P 4J77A 3I7NA 4NSXA 3MMYA 2BBKH 4GGCA 2XL3A 3UVOA 5K19A 3NVXA 5GSAA 5FKSA 2IURA 3F3PA 4A0AB 5HE3B 4BH6A 5HQGA 4J0XA 3VGZA 3OTTA 4XEIC 2OJYA 5GXIA 3SFZA 3AFCA 2IWFA 4R7AB 3F3GA 3V7DB 2H6QA 2AGWA 4FWWA 4CI2A 3DXKC 2P9SC 2AH1A 2OVPB 3C9CA 1GOTB 5A2Qg 4YVDA 2AGZA 4PSWB 3CFVA 4UI9R 3DSMA 4JSVC 3AL8B 4D0KA 2MTAH 3SXTD 5IJ8E 4ZOZA 5TEFA 5IGOA 5KDOB 4GMBA 4A08A 3RSEC 4J82A 4CZXA 4BUJC 3L4OD 2OVQB 3IJ0A 3EWEA 3DXMC 5EMMB 1U2VC 4IMMA 3GFCA 3VH0A 3P4FA 4MK0B 4FAND 4A0BA 5FXYA 4CY5A 1JJUB 2P9LC 4JSNC 4PNKB 4ERZA 5IC7A 5THAA 3UKUC 5CXCA 4Y7RA 3JAMg 1JMXB 2GNQA 3BG1A 2B5MA 1NEXB 1MG2A 4IA9A 5AJAA 4AEZA 3VA6A 3J80g 3SWSD 2CE9A 4LG9A 1MDAH 2I3SA 2OVRB 5HYNB 1PBYB 3HFQA 4JSPC 4A09A 4O9DA 3IIYA 4CY1A 4QQEA 1U4CA 3ULEC 2H13A 2J55H 3EI3A 5CXBB 4QRJA 2Z2OA 5I5IA 2IWKA 5FLXg 1XKSA 5GXHA 1S4UX 3PVWB 4LGNA 1OMWB 2XL2A 4A2MA 4JSXC 1N6DA 3FM0A 2AH0A 1SQJA 4J73A 4CY2A 3OL2A 4GGAA 3EI4A 2UZYB 5HE1B 3SJLD 2H9NA 2J57G 4GM8A 3SVWD 3CFSB 4JT6C 5H1MA 1RI6A 3JZHA 1JOFA 2YMUA 2B5NA 4Y5RD 2P9PC 3EI3B 2AGYA 3UVNA 1GXRA 5EMJB 5C2VB 4JD2C 1SQ9A 4FAVD 5EM2A 4L1QD 2HYEA 3RRMC 2H9MA 2I0RA 4TZ4A 4CC9A 4A08B 5IJ7E 3UKRC 2CO0A 5FKQA 2H9PA 5FQDA 3I7OA 3AL8A 3I89A 5B4WA 3JPXA 3SMRA 2HJ4A 5TEEA 2I0SA 1YFQA 2G9AA 1A0RB 4H5JA 2GC7A 4GZ8A 2Z2NA 4L9OA 4X60B 2CN2A 3MXXA 3PSLA 2CN3A 4CZVA 3PXWD 3OL2B 3EMHA 4N14A 3UR4A 3L4MD 5CYKB 1TBGA 4X3EA 3NVQA 4GQBB 3BWSA 4J86A 4OWRA 5AMSA 3SN6B 1B9XA 2YNOA 2QXVA 4L3GD 5I5JA 4J87A 3JZGA 4J0WA 4OZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUV A;  2AQ5 A;  2YB8 B;  5EAL A;  3F3F A;  3PVU B;  3RLM D;  1K32 A;  4PXW A;  2PBI B;  4BL0 A;  4K3I D;  4JXM A;  3IIW A;  3RFG A;  4AOW A;  4CI3 A;  3RFH A;  4E54 B;  3DWL C;  3IJC A;  3U4Y A;  1QNI A;  3I7L A;  3SHF A;  4GM3 A;  1B9Y A;  5H17 A;  3EI2 A;  2XU7 A;  4QT8 A;  3SLE D;  1ERJ A;  2Z2P A;  5GMK n;  3DM0 A;  4CZY A;  4O3U B;  5EMK B;  3UVM A;  3MKS B;  3EI2 B;  3EI4 B;  3BG0 A;  3K27 A;  5TF2 A;  4LG8 A;  4U7A A;  4J81 A;  5IGQ A;  2J56 H;  1PGU A;  3EU7 A;  3PE7 A;  1P22 A;  3I7P A;  4G56 B;  4J8B A;  1MG3 A;  2P9N C;  3I8E A;  5C2W B;  4E5Z A;  4GGD A;  4ERY A;  3ODT A;  3JRP A;  1XHM A;  4FHL A;  2HXC A;  2H6K A;  4D6V A;  3JZN A;  5C9Z B;  5TDH B;  4ESG A;  5CXC B;  3ORV D;  1JMZ B;  2H47 A;  4FA5 D;  4GQ1 A;  3SBR A;  3OKT A;  3EG6 A;  2OK4 A;  3RN0 D;  2IUP A;  1FWX A;  3C75 H;  2PM9 B;  4JT5 C;  4PBY A;  4E54 A;  3KRW B;  3OW8 A;  2I3T A;  2TRC B;  4PBZ A;  5EML B;  3AL9 A;  3N0E A;  5EM2 B;  4QL1 A;  1OLZ A;  1Q47 A;  4EWR A;  3V9F A;  3KRX B;  3V5W B;  1VYH C;  3J81 g;  1L0Q A;  2Q7Q A;  3A0F A;  4KFM B;  2HES X;  2AGX A;  3B7F A;  3I7H A;  3MKQ A;  5CYK A;  2HKR A;  2O9K A;  3EI1 B;  5AFU 3;  1TYQ C;  2PM9 A;  1GG2 B;  2PM7 B;  3SBP A;  4A11 A;  4J78 A;  2P9I C;  4CY3 A;  1K8K C;  5HE2 B;  3UVK A;  2CE8 A;  2I0T A;  4O45 A;  4H5I A;  4ZOV A;  2XYI A;  2H68 A;  2IUQ A;  2IAA A;  2GC4 A;  3RMZ D;  4CI1 A;  3GRE A;  4J84 A;  3SCY A;  2W18 A;  5SXM A;  4E5Z B;  3EI1 A;  1XIP A;  4ZOX A;  4A09 B;  3MZL A;  4L3H D;  1N6F A;  4A2L A;  3AH8 B;  4A11 B;  5JWZ A;  1PI6 A;  2QC5 A;  3I2N A;  1GP2 B;  4X63 B;  5IT9 g;  3N0D A;  2HKM A;  3MZK A;  3OKY A;  5I5M A;  5CXB A;  5EAP A;  2HJB A;  4I79 A;  5FKR A;  3PXS D;  4PC0 A;  3UVL A;  3OKY B;  2P9K C;  3IKO A;  2H3X A;  3JRO A;  3W15 A;  2EBS A;  1SHY B;  4O3T B;  3ZWL B;  3E0C A;  3NVN A;  5FA5 B;  2UZX B;  1R5M A;  5HE0 B;  3JB9 L;  2OIZ A;  3IJ1 A;  2OK6 A;  3K26 A;  2H14 A;  4A7J A;  2AGL A;  2YNP A;  2G99 A;  4U1E I;  4FA9 D;  3PXT D;  4XYI A;  2YBA A;  2BCJ B;  3C5M A;  3SBQ A;  4A0B B;  1PEV A;  2CNX A;  4FB1 D;  4ES0 A;  1N6E A;  3I7K A;  5EAR A;  4GM9 A;  2H9L A;  3CIK B;  4J8G A;  4FA1 D;  4XYH A;  5K1C C;  4ERQ A;  5EAM A;  3FGB A;  2P9U C;  3I8C A;  4HDJ A;  4ZN4 A;  5FKT A;  3PSC B;  4PSX B;  4ZOY A;  1NR0 A;  4Z8L A;  3OKW A;  4J79 A;  3C99 A;  2PM6 B;  2YNN A;  5H14 A;  4CI8 A;  4K3J B;  4O1Q D;  2B5L A;  4FA4 D;  3FRX A;  4A0A A;  2B4E A;  2CO0 C;  2H6N A;  4X61 B;  3RN1 D;  4GQ2 P;  4J77 A;  3I7N A;  4NSX A;  3MMY A;  2BBK H;  4GGC A;  2XL3 A;  3UVO A;  5K19 A;  3NVX A;  5GSA A;  5FKS A;  2IUR A;  3F3P A;  4A0A B;  5HE3 B;  4BH6 A;  5HQG A;  4J0X A;  3VGZ A;  3OTT A;  4XEI C;  2OJY A;  5GXI A;  3SFZ A;  3AFC A;  2IWF A;  4R7A B;  3F3G A;  3V7D B;  2H6Q A;  2AGW A;  4FWW A;  4CI2 A;  3DXK C;  2P9S C;  2AH1 A;  2OVP B;  3C9C A;  1GOT B;  5A2Q g;  4YVD A;  2AGZ A;  4PSW B;  3CFV A;  4UI9 R;  3DSM A;  4JSV C;  3AL8 B;  4D0K A;  2MTA H;  3SXT D;  5IJ8 E;  4ZOZ A;  5TEF A;  5IGO A;  5KDO B;  4GMB A;  4A08 A;  3RSE C;  4J82 A;  4CZX A;  4BUJ C;  3L4O D;  2OVQ B;  3IJ0 A;  3EWE A;  3DXM C;  5EMM B;  1U2V C;  4IMM A;  3GFC A;  3VH0 A;  3P4F A;  4MK0 B;  4FAN D;  4A0B A;  5FXY A;  4CY5 A;  1JJU B;  2P9L C;  4JSN C;  4PNK B;  4ERZ A;  5IC7 A;  5THA A;  3UKU C;  5CXC A;  4Y7R A;  3JAM g;  1JMX B;  2GNQ A;  3BG1 A;  2B5M A;  1NEX B;  1MG2 A;  4IA9 A;  5AJA A;  4AEZ A;  3VA6 A;  3J80 g;  3SWS D;  2CE9 A;  4LG9 A;  1MDA H;  2I3S A;  2OVR B;  5HYN B;  1PBY B;  3HFQ A;  4JSP C;  4A09 A;  4O9D A;  3IIY A;  4CY1 A;  4QQE A;  1U4C A;  3ULE C;  2H13 A;  2J55 H;  3EI3 A;  5CXB B;  4QRJ A;  2Z2O A;  5I5I A;  2IWK A;  5FLX g;  1XKS A;  5GXH A;  1S4U X;  3PVW B;  4LGN A;  1OMW B;  2XL2 A;  4A2M A;  4JSX C;  1N6D A;  3FM0 A;  2AH0 A;  1SQJ A;  4J73 A;  4CY2 A;  3OL2 A;  4GGA A;  3EI4 A;  2UZY B;  5HE1 B;  3SJL D;  2H9N A;  2J57 G;  4GM8 A;  3SVW D;  3CFS B;  4JT6 C;  5H1M A;  1RI6 A;  3JZH A;  1JOF A;  2YMU A;  2B5N A;  4Y5R D;  2P9P C;  3EI3 B;  2AGY A;  3UVN A;  1GXR A;  5EMJ B;  5C2V B;  4JD2 C;  1SQ9 A;  4FAV D;  5EM2 A;  4L1Q D;  2HYE A;  3RRM C;  2H9M A;  2I0R A;  4TZ4 A;  4CC9 A;  4A08 B;  5IJ7 E;  3UKR C;  2CO0 A;  5FKQ A;  2H9P A;  5FQD A;  3I7O A;  3AL8 A;  3I89 A;  5B4W A;  3JPX A;  3SMR A;  2HJ4 A;  5TEE A;  2I0S A;  1YFQ A;  2G9A A;  1A0R B;  4H5J A;  2GC7 A;  4GZ8 A;  2Z2N A;  4L9O A;  4X60 B;  2CN2 A;  3MXX A;  3PSL A;  2CN3 A;  4CZV A;  3PXW D;  3OL2 B;  3EMH A;  4N14 A;  3UR4 A;  3L4M D;  5CYK B;  1TBG A;  4X3E A;  3NVQ A;  4GQB B;  3BWS A;  4J86 A;  4OWR A;  5AMS A;  3SN6 B;  1B9X A;  2YNO A;  2QXV A;  4L3G D;  5I5J A;  4J87 A;  3JZG A;  4J0W A;  4OZU A; 
#chains in the Genus database with same CATH topology
 2IUV A;  2AQ5 A;  4AMZ A;  2YB8 B;  5EAL A;  3F3F A;  3PVU B;  3RLM D;  1K32 A;  4PXW A;  2PBI B;  4BL0 A;  4K3I D;  4JXM A;  3IIW A;  3RFG A;  1YR2 A;  4AOW A;  4CI3 A;  1O6F A;  3RFH A;  2VDL A;  3K72 A;  4AN0 A;  4E54 B;  3DWL C;  3IJC A;  4D9S A;  3U4Y A;  1QNI A;  3I7L A;  3SHF A;  4GM3 A;  1B9Y A;  5H17 A;  3EI2 A;  2XU7 A;  1E8N A;  4WK2 A;  4L1M A;  4QT8 A;  4NC4 A;  5FFG A;  3SLE D;  1ERJ A;  2Z2P A;  5GMK n;  3DM0 A;  4CZY A;  1H2Z A;  4O3U B;  5EMK B;  3UVM A;  4WK0 A;  3MKS B;  3EI2 B;  3EI4 B;  3BG0 A;  1H2Y A;  3K27 A;  5M5U A;  5TF2 A;  4LG8 A;  2EIB A;  4U7A A;  4J81 A;  5IGQ A;  1VE7 A;  2J56 H;  1PGU A;  3EU7 A;  3PE7 A;  1UOP A;  4MMZ A;  1UTC A;  3IUM A;  1P22 A;  3I7P A;  1VE6 A;  4BP9 A;  1E5T A;  4O2W A;  4G56 B;  4J8B A;  1MG3 A;  2P9N C;  3I8E A;  5C2W B;  4E5Z A;  3K6S A;  4GGD A;  4ERY A;  3ODT A;  4BCB A;  3QI0 A;  3ZE1 A;  3JRP A;  1XHM A;  4FHL A;  2HXC A;  3IVM A;  4WK4 A;  1JV2 A;  2H6K A;  4D6V A;  3JZN A;  4AN1 A;  5C9Z B;  5TDH B;  4ESG A;  2EID A;  5CXC B;  3ORV D;  2VDM A;  2BKL A;  1JMZ B;  2H47 A;  4FA5 D;  2QZP A;  4GQ1 A;  3SBR A;  3OKT A;  3EG6 A;  2OK4 A;  1E8M A;  1BPO A;  3RN0 D;  2IUP A;  1FWX A;  3C75 H;  2PM9 B;  4JT5 C;  4PBY A;  4E54 A;  3KRW B;  3OW8 A;  2I3T A;  2TRC B;  4PBZ A;  5EML B;  3AL9 A;  3N0E A;  5EM2 B;  4QL1 A;  1OLZ A;  1Q47 A;  4EWR A;  3V9F A;  4BP8 A;  3KRX B;  4Z7Q A;  3V5W B;  1VYH C;  3J81 g;  1L0Q A;  2Q7Q A;  4RE5 A;  3A0F A;  4KFM B;  2HES X;  2AGX A;  3O4I A;  3B7F A;  3I7H A;  3MKQ A;  4UM9 A;  5E6S A;  5CYK A;  2HKR A;  1U8C A;  2O9K A;  3EI1 B;  5AFU 3;  1TYQ C;  2PM9 A;  3T3P A;  1GG2 B;  1TYE A;  2PM7 B;  3SBP A;  4A11 A;  3IJE A;  4J78 A;  2P9I C;  4CY3 A;  1K8K C;  4AX4 A;  5HE2 B;  3UVK A;  2CE8 A;  2I0T A;  4O45 A;  4H5I A;  4ZOV A;  2XYI A;  2VDQ A;  2H68 A;  2IUQ A;  1UOQ A;  2IAA A;  2GC4 A;  3RMZ D;  4CI1 A;  3GRE A;  4J84 A;  3SCY A;  3V4P A;  2W18 A;  5SXM A;  4E5Z B;  3EI1 A;  1XIP A;  4ZOX A;  4A09 B;  3MZL A;  4L3H D;  1N6F A;  4A2L A;  3AH8 B;  4A11 B;  5JWZ A;  1PI6 A;  2QC5 A;  3I2N A;  1GP2 B;  4X63 B;  5IT9 g;  3GD1 I;  2VC2 A;  3N0D A;  2HKM A;  3MZK A;  3OKY A;  5I5M A;  5CXB A;  5EAP A;  2HJB A;  4I79 A;  5FKR A;  1GOH A;  3PXS D;  4PC0 A;  3UVL A;  3OKY B;  2P9K C;  3IKO A;  2H3X A;  4DNU A;  3JRO A;  3EQ7 A;  3W15 A;  2EBS A;  3K71 A;  4O3T B;  3ZWL B;  3E0C A;  3NVN A;  5FA5 B;  2UZX B;  1R5M A;  5HE0 B;  3JB9 L;  2OIZ A;  3IJ1 A;  2OK6 A;  3ZE0 A;  3K26 A;  5E6R A;  2H14 A;  2VDN A;  4A7J A;  2AGL A;  2YNP A;  2G99 A;  4U1E I;  2EIE A;  3IUJ A;  4FA9 D;  1I2M B;  5C92 A;  3PXT D;  4XYI A;  2VDR A;  1QFS A;  2XDW A;  2YBA A;  2BCJ B;  1H2X A;  2QR5 A;  3C5M A;  3SBQ A;  4A0B B;  1PEV A;  2CNX A;  3NIF A;  4IRZ A;  5M5R A;  4FB1 D;  4ES0 A;  1N6E A;  3I7K A;  5EAR A;  4GM9 A;  2H9L A;  3CIK B;  2XE4 A;  4J8G A;  4FA1 D;  1UOO A;  4XYH A;  3O4J A;  5K1C C;  4ERQ A;  5EAM A;  3FGB A;  2P9U C;  4DNV A;  3I8C A;  4HDJ A;  4ZN4 A;  5FKT A;  3PSC B;  4PSX B;  4ZOY A;  4OZU A;  1NR0 A;  4MMX A;  3OKW A;  3C99 A;  4J79 A;  4Z8L A;  2PM6 B;  2YNN A;  5H14 A;  2HU7 A;  3OF7 A;  2XZG A;  4K3J B;  4CI8 A;  4O1Q D;  2B5L A;  4FA4 D;  3FRX A;  4A0A A;  2B4E A;  3ZDY A;  2CO0 C;  2VZ1 A;  1JTD B;  3O4H A;  2H6N A;  4X61 B;  3RN1 D;  4GQ2 P;  4J77 A;  3I7N A;  4NSX A;  5M61 A;  3MMY A;  2BBK H;  4GGC A;  2XL3 A;  5M5T A;  3UVO A;  5K19 A;  3NVX A;  5GSA A;  5FKS A;  2IUR A;  3F3P A;  4A0A B;  5HE3 B;  4BH6 A;  3VI4 A;  1H2W A;  5HQG A;  4J0X A;  3VGZ A;  3OTT A;  4XEI C;  2OJY A;  3IUQ A;  2VDO A;  5GXI A;  3SFZ A;  4UM8 A;  1GOF A;  3AFC A;  2IWF A;  4R7A B;  3F3G A;  3V7D B;  1L5G A;  2H6Q A;  2HU5 A;  2AGW A;  2VDP A;  1O6G A;  2VZ3 A;  3O4G A;  4FWW A;  4CI2 A;  3DXK C;  4BCC A;  2P9S C;  2AH1 A;  2OVP B;  3C9C A;  1GOT B;  4QAM A;  5A2Q g;  4YVD A;  2AGZ A;  4PSW B;  3CFV A;  3FCU A;  4UI9 R;  3DSM A;  4JSV C;  3AL8 B;  4D0K A;  2MTA H;  3SXT D;  5IJ8 E;  5E6U A;  4G55 A;  3FCS A;  4ZOZ A;  5TEF A;  4JHN A;  5IGO A;  5KDO B;  4GMB A;  4A08 A;  2HU8 A;  3RSE C;  4J82 A;  4CZX A;  4BUJ C;  3L4O D;  2OVQ B;  3IJ0 A;  1GOG A;  3EWE A;  3DXM C;  5EMM B;  1U2V C;  4IMM A;  3GFC A;  3NIG A;  3VH0 A;  3P4F A;  4MK0 B;  4FAN D;  4A0B A;  1T2X A;  1VZ3 A;  5FXY A;  4CY5 A;  1JJU B;  3ZE2 A;  2P9L C;  4JSN C;  4PNK B;  4ERZ A;  3EQ8 A;  5IC7 A;  4Z7O A;  2JKX A;  5THA A;  3UKU C;  5CXC A;  3KCI A;  4Y7R A;  3T3M A;  3JAM g;  1JMX B;  2GNQ A;  3BG1 A;  4G1E A;  4BCD A;  2B5M A;  1NEX B;  1MG2 A;  4IA9 A;  5AJA A;  4AEZ A;  3VA6 A;  3J80 g;  3SWS D;  2CE9 A;  4LG9 A;  3NID A;  1MDA H;  2I3S A;  2OVR B;  5HYN B;  3DDU A;  1PBY B;  3HFQ A;  4JSP C;  4O02 A;  4A09 A;  1K3I A;  4O9D A;  3IIY A;  4CY1 A;  4QQE A;  5HDB A;  1U4C A;  3ULE C;  2H13 A;  2J55 H;  3EI3 A;  5CXB B;  4QRJ A;  2Z2O A;  5I5I A;  2IWK A;  5FLX g;  1XKS A;  5GXH A;  1S4U X;  3PVW B;  4LGN A;  1OMW B;  2XL2 A;  4A2M A;  4JSX C;  1N6D A;  3FM0 A;  2AH0 A;  1SQJ A;  4J73 A;  4CY2 A;  3OL2 A;  4GGA A;  3GC3 B;  3EI4 A;  2UZY B;  5HE1 B;  3SJL D;  2H9N A;  2J57 G;  3IUL A;  4GM8 A;  4RE6 A;  3SVW D;  4Z7N A;  3CFS B;  1QFM A;  2VDK A;  4JT6 C;  4NEN A;  5H1M A;  1RI6 A;  3JZH A;  1JOF A;  2YMU A;  1C9I A;  2B5N A;  4Y5R D;  5M5V A;  2P9P C;  3EI3 B;  4NBM A;  2AGY A;  2WQ8 A;  3UVN A;  1GXR A;  5EMJ B;  5C2V B;  1A12 A;  4JD2 C;  1SQ9 A;  4FAV D;  4MMY A;  5EM2 A;  4L1Q D;  2HYE A;  3RRM C;  2H9M A;  4NAA A;  2I0R A;  4TZ4 A;  4CC9 A;  2EIC A;  3V4V A;  4A08 B;  1C9L A;  5IJ7 E;  3UKR C;  2CO0 A;  5FKQ A;  2H9P A;  4JHP C;  3I7O A;  5FQD A;  4WJK A;  3IUN A;  3IUR A;  3AL8 A;  3ZDX A;  3ZDZ A;  3I89 A;  5B4W A;  3JPX A;  3SMR A;  2HJ4 A;  4AMY A;  5TEE A;  3VI3 A;  2I0S A;  1YFQ A;  2G9A A;  1A0R B;  4H5J A;  2GC7 A;  4GZ8 A;  2Z2N A;  4L9O A;  4X60 B;  3MUN A;  5FFO A;  2CN2 A;  3QHY B;  3MXX A;  3PSL A;  1M1X A;  2CN3 A;  4CZV A;  3PXW D;  4G1M A;  3OL2 B;  4DNW A;  3EMH A;  4N14 A;  3UR4 A;  3EQ9 A;  3L4M D;  1VZ2 A;  5CYK B;  1TBG A;  4X3E A;  3NVQ A;  4GQB B;  3MUO A;  3BWS A;  4J86 A;  4OWR A;  5AMS A;  3SN6 B;  5C86 A;  1B9X A;  2YNO A;  5M5S A;  2QXV A;  4L3G D;  5I5J A;  3MVD K;  4J87 A;  3JZG A;  4J0W A;  1SHY B; 
#chains in the Genus database with same CATH homology
 2IUV A;  2AQ5 A;  2YB8 B;  5EAL A;  3F3F A;  3PVU B;  3RLM D;  1K32 A;  4PXW A;  2PBI B;  4BL0 A;  4K3I D;  4JXM A;  3IIW A;  3RFG A;  4AOW A;  4CI3 A;  3RFH A;  4E54 B;  3DWL C;  3IJC A;  3U4Y A;  1QNI A;  3I7L A;  3SHF A;  4GM3 A;  1B9Y A;  5H17 A;  3EI2 A;  2XU7 A;  4QT8 A;  3SLE D;  1ERJ A;  2Z2P A;  5GMK n;  3DM0 A;  4CZY A;  4O3U B;  5EMK B;  3UVM A;  3MKS B;  3EI2 B;  3EI4 B;  3BG0 A;  3K27 A;  5TF2 A;  4LG8 A;  4U7A A;  4J81 A;  5IGQ A;  2J56 H;  1PGU A;  3EU7 A;  3PE7 A;  1P22 A;  3I7P A;  4G56 B;  4J8B A;  1MG3 A;  2P9N C;  3I8E A;  5C2W B;  4E5Z A;  4GGD A;  4ERY A;  3ODT A;  3JRP A;  1XHM A;  4FHL A;  2HXC A;  2H6K A;  4D6V A;  3JZN A;  5C9Z B;  5TDH B;  4ESG A;  5CXC B;  3ORV D;  1JMZ B;  2H47 A;  4FA5 D;  4GQ1 A;  3SBR A;  3OKT A;  3EG6 A;  2OK4 A;  3RN0 D;  2IUP A;  1FWX A;  3C75 H;  2PM9 B;  4JT5 C;  4PBY A;  4E54 A;  3KRW B;  3OW8 A;  2I3T A;  2TRC B;  4PBZ A;  5EML B;  3AL9 A;  3N0E A;  5EM2 B;  4QL1 A;  1OLZ A;  1Q47 A;  4EWR A;  3V9F A;  3KRX B;  3V5W B;  1VYH C;  3J81 g;  1L0Q A;  2Q7Q A;  3A0F A;  4KFM B;  2HES X;  2AGX A;  3B7F A;  3I7H A;  3MKQ A;  5CYK A;  2HKR A;  2O9K A;  3EI1 B;  5AFU 3;  1TYQ C;  2PM9 A;  1GG2 B;  2PM7 B;  3SBP A;  4A11 A;  4J78 A;  2P9I C;  4CY3 A;  1K8K C;  5HE2 B;  3UVK A;  2CE8 A;  2I0T A;  4O45 A;  4H5I A;  4ZOV A;  2XYI A;  2H68 A;  2IUQ A;  2IAA A;  2GC4 A;  3RMZ D;  4CI1 A;  3GRE A;  4J84 A;  3SCY A;  2W18 A;  5SXM A;  4E5Z B;  3EI1 A;  1XIP A;  4ZOX A;  4A09 B;  3MZL A;  4L3H D;  1N6F A;  4A2L A;  3AH8 B;  4A11 B;  5JWZ A;  1PI6 A;  2QC5 A;  3I2N A;  1GP2 B;  4X63 B;  5IT9 g;  3N0D A;  2HKM A;  3MZK A;  3OKY A;  5I5M A;  5CXB A;  5EAP A;  2HJB A;  4I79 A;  5FKR A;  3PXS D;  4PC0 A;  3UVL A;  3OKY B;  2P9K C;  3IKO A;  2H3X A;  3JRO A;  3W15 A;  2EBS A;  1SHY B;  4O3T B;  3ZWL B;  3E0C A;  3NVN A;  5FA5 B;  2UZX B;  1R5M A;  5HE0 B;  3JB9 L;  2OIZ A;  3IJ1 A;  2OK6 A;  3K26 A;  2H14 A;  4A7J A;  2AGL A;  2YNP A;  2G99 A;  4U1E I;  4FA9 D;  3PXT D;  4XYI A;  2YBA A;  2BCJ B;  3C5M A;  3SBQ A;  4A0B B;  1PEV A;  2CNX A;  4FB1 D;  4ES0 A;  1N6E A;  3I7K A;  5EAR A;  4GM9 A;  2H9L A;  3CIK B;  4J8G A;  4FA1 D;  4XYH A;  5K1C C;  4ERQ A;  5EAM A;  3FGB A;  2P9U C;  3I8C A;  4HDJ A;  4ZN4 A;  5FKT A;  3PSC B;  4PSX B;  4ZOY A;  1NR0 A;  4Z8L A;  3OKW A;  4J79 A;  3C99 A;  2PM6 B;  2YNN A;  5H14 A;  4CI8 A;  4K3J B;  4O1Q D;  2B5L A;  4FA4 D;  3FRX A;  4A0A A;  2B4E A;  2CO0 C;  2H6N A;  4X61 B;  3RN1 D;  4GQ2 P;  4J77 A;  3I7N A;  4NSX A;  3MMY A;  2BBK H;  4GGC A;  2XL3 A;  3UVO A;  5K19 A;  3NVX A;  5GSA A;  5FKS A;  2IUR A;  3F3P A;  4A0A B;  5HE3 B;  4BH6 A;  5HQG A;  4J0X A;  3VGZ A;  3OTT A;  4XEI C;  2OJY A;  5GXI A;  3SFZ A;  3AFC A;  2IWF A;  4R7A B;  3F3G A;  3V7D B;  2H6Q A;  2AGW A;  4FWW A;  4CI2 A;  3DXK C;  2P9S C;  2AH1 A;  2OVP B;  3C9C A;  1GOT B;  5A2Q g;  4YVD A;  2AGZ A;  4PSW B;  3CFV A;  4UI9 R;  3DSM A;  4JSV C;  3AL8 B;  4D0K A;  2MTA H;  3SXT D;  5IJ8 E;  4ZOZ A;  5TEF A;  5IGO A;  5KDO B;  4GMB A;  4A08 A;  3RSE C;  4J82 A;  4CZX A;  4BUJ C;  3L4O D;  2OVQ B;  3IJ0 A;  3EWE A;  3DXM C;  5EMM B;  1U2V C;  4IMM A;  3GFC A;  3VH0 A;  3P4F A;  4MK0 B;  4FAN D;  4A0B A;  5FXY A;  4CY5 A;  1JJU B;  2P9L C;  4JSN C;  4PNK B;  4ERZ A;  5IC7 A;  5THA A;  3UKU C;  5CXC A;  4Y7R A;  3JAM g;  1JMX B;  2GNQ A;  3BG1 A;  2B5M A;  1NEX B;  1MG2 A;  4IA9 A;  5AJA A;  4AEZ A;  3VA6 A;  3J80 g;  3SWS D;  2CE9 A;  4LG9 A;  1MDA H;  2I3S A;  2OVR B;  5HYN B;  1PBY B;  3HFQ A;  4JSP C;  4A09 A;  4O9D A;  3IIY A;  4CY1 A;  4QQE A;  1U4C A;  3ULE C;  2H13 A;  2J55 H;  3EI3 A;  5CXB B;  4QRJ A;  2Z2O A;  5I5I A;  2IWK A;  5FLX g;  1XKS A;  5GXH A;  1S4U X;  3PVW B;  4LGN A;  1OMW B;  2XL2 A;  4A2M A;  4JSX C;  1N6D A;  3FM0 A;  2AH0 A;  1SQJ A;  4J73 A;  4CY2 A;  3OL2 A;  4GGA A;  3EI4 A;  2UZY B;  5HE1 B;  3SJL D;  2H9N A;  2J57 G;  4GM8 A;  3SVW D;  3CFS B;  4JT6 C;  5H1M A;  1RI6 A;  3JZH A;  1JOF A;  2YMU A;  2B5N A;  4Y5R D;  2P9P C;  3EI3 B;  2AGY A;  3UVN A;  1GXR A;  5EMJ B;  5C2V B;  4JD2 C;  1SQ9 A;  4FAV D;  5EM2 A;  4L1Q D;  2HYE A;  3RRM C;  2H9M A;  2I0R A;  4TZ4 A;  4CC9 A;  4A08 B;  5IJ7 E;  3UKR C;  2CO0 A;  5FKQ A;  2H9P A;  5FQD A;  3I7O A;  3AL8 A;  3I89 A;  5B4W A;  3JPX A;  3SMR A;  2HJ4 A;  5TEE A;  2I0S A;  1YFQ A;  2G9A A;  1A0R B;  4H5J A;  2GC7 A;  4GZ8 A;  2Z2N A;  4L9O A;  4X60 B;  2CN2 A;  3MXX A;  3PSL A;  2CN3 A;  4CZV A;  3PXW D;  3OL2 B;  3EMH A;  4N14 A;  3UR4 A;  3L4M D;  5CYK B;  1TBG A;  4X3E A;  3NVQ A;  4GQB B;  3BWS A;  4J86 A;  4OWR A;  5AMS A;  3SN6 B;  1B9X A;  2YNO A;  2QXV A;  4L3G D;  5I5J A;  4J87 A;  3JZG A;  4J0W A;  4OZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...