4ES1A

Double-stranded endonuclease activity in b. halodurans clustered regularly interspaced short palindromic repeats (crispr)-associated cas2 protein
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
100
structure length
95
Chain Sequence
GSHMMLVLITYDVQTSSMGGTKRLRKVAKACQNYGQRVQNSVFECIVDSTQLTSLKLELTSLIDEEKDSLRIYRLGNNYKTKVEHIGAKPSPLIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Double-stranded endonuclease activity in Bacillus halodurans clustered regularly interspaced short palindromic repeats (CRISPR)-associated Cas2 protein.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase
molecule keywords BH0342 protein
total genus 18
structure length 95
sequence length 100
ec nomenclature ec 3.1.-.-:
pdb deposition date 2012-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09827 CRISPR_Cas2 CRISPR associated protein Cas2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4es1A00
1ZPWX 2IVYA 1ZM4A 2XEXA 4TNOA 4MAKA 3B82A 1ZM9A 2I0XA 2I8EA 1DARA 4MYTA 5G4DA 3B78A 3EXCX 1KTVA 3E3XA 4ES1A 3UI3A 2KDOA 2EFGA 4QR1A 1ELOA 4ZCLA 1ZM3A 4ES2A 2CVEA 3ZZ0A 1U2RA 4FN5A 2NPFA 1ZM2A 4QR0A 3ZZTA 2E1RA 4MYUA 2J7KA 2BV3A 3B8HA 2L9NA 1VI7A 1T95A 3OQ2A 1N0UA 1N0VC 3LH2S 2BM0A 2WBMA 2BM1A 4ZCMA 4ZCIA 4QR2A 4M1KA 2ZITA 4ZCKA 3ZZUA 1FNMA 1P9QC 4ES3A
chains in the Genus database with same CATH superfamily
4I2QB 3OHAA 1E6YA 2BJ1A 2XEXA 1UWAA 2KT2A 1IJEB 1VJWA 4CM2A 2HFNA 3V4MA 4B08A 3JS9A 2DY1A 3QFWA 3MEEA 4WE1B 3FK4A 1Q7LB 2MDAA 4IFVA 3VVTA 4LF8J 2CQ4A 4ZJLA 2DHAA 2CG4A 3R5GA 1ROFA 4PABA 4Q0BB 1WC3A 2NCKL 3CMQA 2IY5B 4X4NA 1GX5A 2H65B 4ECZA 4MYUA 2F4VJ 4K2JA 3I96A 2AYBA 5F8JA 1M1KT 1QY7A 2OPSB 3D66A 3ILLA 1VMBA 2A2CA 2W2PP 4P10A 2GVDA 2J9CA 3CJTA 2HBYB 1S1VB 3FFIB 4ZP9A 5ETQA 1XMOJ 4NX9A 1WG1A 3R6LB 2BZ2A 2ROPA 4ES3A 3BPDA 2M5YA 4UW2A 4ZVRB 2AP6A 3UVJA 1Y3KA 4IG3A 1KDNA 3T3FA 4BS2A 1NM2A 2J0WA 2PC6A 2RQ4A 4LT6A 2IDEA 3I0RA 4K4YA 4ZP6A 3CD0A 1AT1B 1U1KA 3MI7X 2FD2A 2UUTA 4RW7B 4OX8A 2HHVA 2Z2YB 1UVIA 3FEYB 3NNAA 1RHJB 3N79A 4MKAA 5L8RC 2FY1A 2UUAJ 1RTJA 1IM4A 2VBXA 4KGKA 2KM8C 3CDUA 5AE2A 1RT3B 1WOSA 1XC9A 3M8SA 1KTQA 2MSTA 3PV8A 2BE2B 3Q8YA 4G1QA 3W1YC 3SYZA 1RT1A 4X65J 3A3NB 1LOUA 3BEGB 1RTDA 3BGFA 1VR6A 3D3CJ 2DGUA 1UCNA 3OR1B 3W60A 1HPZB 2H4YB 4I6YA 5BXIA 4J90A 4WFAQ 1AUDA 2M9KA 3BPSP 4DN9A 2UUWA 2C28A 1FDNA 3HHDA 1X60A 1IUJA 3M8PB 1S9FA 3FQLA 4ZOSA 2WVBA 1UVLA 4DUZF 1B7YB 2DD8S 5IQQA 4KH0B 4ZIWA 1F9HA 1FRLA 3OFEA 5FIIA 4A48A 5K14B 2BW7A 3KTQA 1GMWA 4K4ZA 3QWPA 3ZZPA 3KLGB 3T1YJ 1SIWB 1YX2A 3IC1A 4EZ6A 1VQ6S 5LM7E 3QBCA 3HD2A 2B0GA 4USVA 2W8KA 2ZH3A 3P3DA 3LTOA 4WTYA 4TU7A 2WTFA 4B3TJ 3TAPA 2IA6A 1FNOA 2Y0BB 3AJ1A 2BRLA 4ZMMA 4LF7J 5LXYA 2R7UA 3LH2S 4WFYA 4AYBD 5KFMA 2GMJA 4EYIB 2YVSA 3I0SB 4XPCA 2ZZMA 1JK9B 3GV8B 1ZYQA 3P5BP 1KC8T 2IJNA 1TUWA 2GGPA 1RYRA 4NXNJ 4AL5A 5K8OA 1AYEA 4WPAA 1RWKB 1WELA 2HWTA 3PYEA 2LU1A 3OL9A 3TUZC 3R1LA 3JAMY 1NHUA 2PEHA 3MEDA 4DL5A 2FJWA 3RR7A 1EP4A 1DARA 4KO0B 4RUAA 4IG0B 2ALYB 3V4IA 2XMTA 3G4SS 2IRYA 2WOMA 2AX0A 2WSFC 2ZC4A 3E3XA 1JXEA 3K7RA 4PG5A 1CJTA 5DGBA 1D8YA 4B3OB 2LA4A 4DV1F 1D9DA 4IOBA 2JH3A 4DV5J 4GO5X 2M88A 5A76A 2BANA 3DC2A 1HD1A 3MEGB 1AXQA 4IFYB 4DV0F 1YRUA 1YVFA 4YB5A 4RU9A 1K44A 2FJBB 3CDEA 3MUTP 4F0HA 3D4JA 1N32F 2J9DA 1GXUA 1S9GB 4B3SF 1CQMA 3V2UC 4OZLA 1X4BA 5C42B 1KQGB 1N0VC 4CLSA 3K8WA 3TJ9A 4UQTA 2ATLA 1NKCA 2A6OA 2IVYA 3ENAA 2MZQA 4Y2KA 4YFUA 4B9VA 1VDHA 2Z2LA 3KLEB 2B5JB 2C2KB 2BACA 3UNYA 3TJAA 5KT3A 3I4HX 3E2EA 3DRRA 4J9UE 4CTAB 4YDDB 1SC1B 1NK5A 5ETLA 2C2OB 3PO5A 1MN7A 1C0UA 1D3WA 3BGUA 1FE4A 4FPIA 3Q23A 5KFFA 2DTJA 3R27A 1HWKA 4NEYA 1JLEA 2HIYA 3AD9C 3HVTA 4OHZA 1U0SA 2QN6B 3ZTPA 3CD5A 4YUDA 3MURP 3FBBA 4OYZA 3V6DB 5EHHA 1U1RA 1HQUB 2HFSA 2IC3B 1VRQC 2B9WA 2CZ4A 1BC6A 1MN9A 2XNQA 2ZH9A 1VQOS 2ZBPA 1PILA 4EO8A 3O1LA 3TZWA 4YB1P 2NQPA 3BGRA 1PC5A 3TVYA 2AV5A 2WOMB 4ZP7A 5KAKA 2XWXA 3Q8QB 3EZUA 4WYLA 2BJ8A 3J7Z5 4ZVGA 2UU9F 4JBCA 4K59A 3N5BA 5CA5A 3OL8A 3VQSA 4IO9Q 4HT5A 2KU7A 3FEXB 4MYTA 5E33A 3GJSB 1R89A 3GFZA 2FZGB 1XBWA 4R8UA 4F67A 3K58A 2E9TA 2DNNA 2GNKA 4A4JA 1JXLA 2CQGA 1H72C 4X4VA 4NMLA 2QIFA 4WFXA 2DNYA 5A6WA 1VRTB 2MKHA 3K5OA 5SZTA 3HJFA 2GO9A 2QLWA 3KHGA 2GJIA 1S1UA 3QO9B 4ZN1A 3BQ1A 1RTIA 2IMWP 2NYIA 2RF2A 4ETZA 3UR3C 3MUVP 1KVIA 3G96A 4P52A 2R7OA 5HLFB 1APSA 2HGLA 1WEZA 2AEFA 1IR1A 4DL7A 1H38A 4ZPDA 1UJ5A 2KRRA 2DO4A 1HNZJ 3D1OA 3L09A 1XQIA 4X65F 1JLCB 3PW7A 1ZETA 2QG9B 4DV2F 2K1RA 4M63A 2C42A 1X5PA 1Q0NA 5LXRA 4JI4F 4Q8FA 2AEJA 1TFYA 3OPKA 1Z1ZA 3UNGC 1UVNA 2AWZA 1KTVA 1IQZA 1XMQF 1VHIA 2JEIA 4WKRA 2DGQA 2IAJB 4KGXB 3R5DA 4EBDA 1S0NA 5GAHI 3RR8A 2GHWA 2XMUA 2HEKA 2F63A 3J7AN 4RUBA 3JXOA 3VTIA 2Q79A 1QE1B 2J7KA 3G86A 2F1FA 2WK4A 1NH7A 2ZM6J 1JNZB 1Y10A 2JL9A 2OMLA 3W64A 4I4BA 4JI2F 4ZHRA 4WP9A 1GMUA 2QLJB 1NDLA 4FP9A 4P2XA 2FGOA 5HJXA 4MKYA 1FD8A 3A8KA 3MM9A 3NAHA 1VQ8S 2AJFE 2KG1A 3PR4A 1VCTA 1NEEA 3T5KA 4ZLPA 2MY8A 2W8LA 5M2UA 4PQUA 4P2MA 4C0BA 2QJ3A 2R8GA 4ZIVA 4O3QA 3BBFA 5KFYA 2Z4PA 4J9OA 4ECYA 1B70B 3SFUA 5KG7A 1G7CB 5DQHA 1AUSL 4CYUB 2UUCJ 2J7WA 3DN9A 1WDDA 1JXVA 3IO1A 3SEOA 1FJ7A 1YKWA 1YJUA 2DR6A 1TK0A 4CP5A 4P6QA 2R4FA 5AT1B 4F4AA 5IWAJ 2YBVA 2ZUGA 2ZHOA 5GAGI 3VAGA 2HQCA 4GVLA 5M2RA 3DLGB 4CM0A 3M30A 4JI5J 4PR6A 4X4UA 1S57A 4KKOB 5HMZA 4P74A 4GKJF 2JJ4D 1HNXF 2KXHA 2WBMA 2KFNA 4I6WA 3H98A 1KONA 3M6XA 4PPZA 4DCOB 1U02A 5JVGQ 1J5OA 3T1YF 3RAMA 2MKCA 5F8HA 3FQKA 4MK8A 2Z30B 3M05A 3S6EA 1WDTA 4RW4A 2GIRA 4OQJA 3PR5B 5CYMB 2EFPA 3QT6A 1U2CA 3C16A 2W4DA 2GZOA 5I3PA 3DXBA 2KKHA 1NZAA 1ULRA 4NLXA 3SQOP 3QGIA 4RUCA 3TNVA 3J80U 4YY3F 1S48A 3LUYA 2YKQA 2IRUA 3G82B 2U2FA 1R3NA 4ES1A 5CZXA 2Q43A 3FSYA 4ZPVR 4DG1B 3OVSA 2QA4G 3SI8A 3HHLD 4LRCA 1P1LA 5J1EB 1QAIA 4N41A 3U1LA 5DJBA 2PMHA 3ILOA 2UVWA 1GEHA 2FJAB 4N47A 1DTQB 2BJ9A 4ZVHA 3RB0A 1LXJA 1WHYA 1HFEL 1T95A 4C11B 1M5SA 1B99A 1HWLA 5A8WB 2YQ0A 2C2DA 2V6AA 1YJWS 4NXMF 2H51B 3NWGA 1PGZA 4L73A 3NGTA 4YN3B 2RS8A 3K17A 4ZCKA 4F04B 4DR4F 3IRXA 3KLFA 2GJ2A 1A9NB 1T05A 5G0RA 5CYQA 5E3AA 3CDAA 3CCQS 2AGQA 5IT0A 1KHVA 1XNQJ 4F4XA 5IT9Y 1VK3A 2BOAA 2C2NA 5H1SV 1OY6A 4OX6A 1S9EA 5F0WA 3M1VA 4R5PB 2UU9J 1SQGA 1WSVA 4LQ9A 2CVEA 1TV6B 1HARA 4Y2CA 4URGA 2RJZA 3G9CA 1NJZA 2NXNA 5K8MA 3P5TL 1OQ6A 1VQYA 4YHHF 4LFCF 2C22A 1Q78A 2HZCA 1H3DA 2OGUA 4KGMA 3NMRA 2BE7D 2ZITA 3FCVA 1MROB 2UUAF 3NS6A 2RHSB 3BREA 3RGIA 5IS2A 3PFOA 1FXDA 3NGKA 3NMAA 2MGZA 2JFKA 4MK7A 2F8HA 3JSBA 4F0MA 2IMOA 3KMSA 1O5JA 1X4FA 3THTA 3NBPA 2WBRA 3BSNA 2EC2A 1X5TA 1Q79A 2UUBF 4B3RF 1NK0A 3ZNUA 4FVCA 2NSCA 2XHCA 3EDQB 3K8VA 3MPVA 4OZ0A 5I3UB 3NLCA 3LP1A 5KFQA 4YR2A 4AQYF 5E3RA 3QGGA 2CQ0A 2HRYA 1VRUB 3DGVA 1HNWF 5L1JA 2RDJA 3HFKA 3O3LA 4FS2A 1FXRA 2CVIA 3W63A 3R5CA 1U6BA 2DKOB 2HURA 3CJ3A 4NLWA 3HMJG 2Z0GA 2DJWA 4H4KC 6FD1A 1T9WA 5DDRC 3ONQA 3TA0A 1EHWA 3OT9A 2G4BA 2HHTA 2OO4A 2Y1IA 3FZ2A 2X1GA 1T94A 2DIVA 2ZVIA 3A8EA 4DUTA 4NLVA 5B09A 1VBZA 2VG7B 4ZPAA 4NA3A 1S6UA 2J76E 3CJ8A 4B9LA 4PPDA 1IBLF 1HD0A 3AB4B 2FUG9 2XWYA 3A4TA 4ICLB 3LA0A 3LANA 4JI6J 1TVRA 3JSMA 4ED2A 4W98A 1BWEA 1HBNB 2BE2A 1EETB 2PIIA 2ZBCA 4B9SA 1F5CA 5KFVA 2P6SA 1R8BA 4ZCLA 2W9BA 4WJBA 1S6QA 3C15A 2E44A 4A8MP 1WACA 5KFIA 4JV2A 2QA1A 2ZWPA 3LPEA 4JI4J 2DIUA 3Q8UA 2CWKA 5KG3A 1H0HB 4DR3J 5KFTA 4KGVB 2MB0B 3HFVA 3W2WA 4K4UA 2FLNA 1JLBB 3QT8A 4EFAC 1EJ7L 4LBIA 4EGLA 4GO7X 1KD1T 2B7BB 1RDRA 1HNXJ 3A3PB 3K0JA 1J2VA 3MM6B 5F9LA 3DRSB 2VA3A 5ETOA 5L1IA 3OD2A 4MFBA 3PW2A 4LFAF 3N6LA 2JVRA 4MAKA 1LEOA 1S12A 2ZNZA 4ANDA 4WBFA 2YWEA 2OKQA 1U6FA 1JLQA 3M9NB 1EQ0A 1R6YA 2N3LA 5LJ3Y 2B7CB 3OBIA 5D4OA 1W7WA 3PY8A 1BHNA 4YB6A 4USWA 5CCMA 4LF9F 3AAWB 3O2IA 3M2UA 1FJEB 5F0UA 3MTJA 1VISA 1R8PA 4NA1A 1SL1A 1G6BA 1WWHA 4C9DA 4V1Ak 4JP8A 3MXHP 5DLFA 2HLUA 6AT1B 3P49B 4C8KA 4IRKA 3V81A 5I42B 4X4OA 3TAMA 1GK8A 3C16B 2QA2A 3Q83A 1EKSA 3GV5B 2HQFA 4KIAA 3DHWC 2HNYB 1UJ4A 5K9FA 3ENVA 4O4GA 3OHBA 5LMUF 2UXCJ 2ZEJA 5ETNA 3W2WB 1RWOB 1DZ5A 3P45B 1ACMB 1RU1A 1NUEA 4NASA 4NOHA 3UD4P 2CWXA 4Q8EA 2XS2A 4NCGB 2CIMA 1JLFA 3CJ2A 4DX8H 3QT7A 2WW8A 1Y11A 4ID5B 4CLKA 4F26A 2AHOB 3W5XA 4A46A 2ALZA 3C46A 5A6PA 1JLGA 1T9VA 3C15B 1IWGA 3DLKA 2BV3A 2HGMA 1U8WA 3CCWA 4ECUA 1C4CA 1BQMB 2B6AA 3KG1A 4J37A 4ZCMA 2PFFB 4NYOA 4TVAB 4ZK7M 2VC1A 2AZ3A 2CJBA 4WU3A 3TQEA 2EFVA 1VC0A 1K0TA 3QT5A 4KHPJ 1HHQA 2HMIA 1WUUA 3W61A 1FX4A 3W5YA 3AB2B 3ZZRA 5A8RB 4F3MA 1RAJA 5T14A 3OUYB 3BYRA 1DY3A 4LRFA 3R97A 1RCXB 3MZIA 1T3NA 1KRPA 2KO1A 4N8NA 2MSSA 2MPUA 3JTOA 1N5YA 2POKA 2OIHA 5D6GA 3TOQA 2DYAA 2XQCA 3FVYA 3HXMA 2B9EA 2FVCA 2DHXA 3JQKA 5CZVA 4BC9A 1KOOA 1FKAF 3MOJB 4M5GA 4ALZA 1KBRA 2AD9A 4DR4J 1V3ZA 4BWMA 4HL9A 2B51A 3L4BC 1BWVA 1X7VA 2HS3A 3KKFA 5J2PA 3HM9A 3IRWP 2J0SD 3DDNA 1X5OA 2F3JA 1NSAA 1GT8A 1X8DA 2DNKA 2XB2D 4M5JA 2GVZA 3PJXA 4E8UA 1REGX 4M1KA 1OS5A 5F3ZA 2DRDA 4NZ6A 4ANEA 2W7OA 4HTIA 3QSYB 1JB0C 2K1RB 1PSDA 2LMIA 2RKIB 3DMJA 3D28A 1UL3A 3MFIA 1Q8LA 3D6MB 1Q4RA 2FZKB 2ILYA 3H90A 3I31A 4DX7A 2UXBJ 2E5IA 2ZE2A 5KFBA 3KUGA 1FRHA 2R7QA 2IM0A 2XMJA 3VZIA 4CRJA 3MAQA 5HLFA 1T7PA 2HNYA 3F73A 2VKRA 3EVMA 1KLNA 2V9KA 1QJHA 1U8SA 4CQ1A 3MPYA 3KWMA 5KFDA 2IRXA 3KJVA 1HNIA 4ECSA 2ADBA 1L5UA 2PA8D 2DISA 1KR4A 4X62J 2HNDA 2BYCA 3FMWA 1IN0A 4DBQA 5I3QA 4TU8A 2Q6CA 2EXUA 2F9JA 3CEDA 4P75A 4RNOA 1TQLA 3BSCA 5C25A 1YITS 1SJFA 2DR7A 5CD4H 3IM8A 1FO1A 1KLMA 2XI3A 3PNIA 5JVHQ 1JLEB 4RNMA 4DX6A 2FYXA 2BM0A 4O0NA 1YJ7A 4XTTA 1L3UA 2UUBJ 2YH0A 4HACA 4B3RJ 4L76A 3DXSX 3EGNA 2XZWA 5E5NA 3THPA 5GAEI 2VODA 1X4DA 3CCVS 1PYSB 2V69A 2QYGA 3ZZZA 2WSEC 3CSKA 1N34F 1DRZA 4J9PA 3W5ZA 3BBCA 3KLFB 3A1YG 3PYGA 3BZQA 2BJ3A 1M5OC 1FKPB 2JLEA 3BYPA 3B78A 1UZHA 3F44A 3UE2A 1WOOA 1SQFA 1S49A 3NKYA 2R3VA 1J5EJ 1JLBA 3GYNA 2MKYA 4RBVA 2BJEA 1X4GA 4LMZA 3EVWA 4KFBA 2G13A 2H5JB 4KSEB 4QPTA 4LIRA 1XNRF 3LALA 2IBOA 1YZ7A 1NNDA 3ZXWA 1YHQS 4DFPA 4HDGA 2XMMA 1BXNA 2OUGA 3J7YI 1ICEB 4CT8A 4WTOB 1HBMB 1MU2A 1Y7PA 3DM2A 5F41A 2VC0A 3KLHA 3MR7A 2VPZB 4C97A 2R8KA 4NRUA 3RRKA 3JSMB 2GO8A 2FVPA 4KHPF 1W2IA 4K7QA 3CJQA 2YY3A 1TKTA 2NZ4A 1J5OB 2H4WB 3S7RA 3KDOA 3T1AA 1D0EA 4NEZA 4B9MA 2XC9A 4EZ9A 2MQOA 2G0CA 4JV5J 1S1TB 5T41A 4DR3F 2GGPB 2JHEA 1PBAA 2KDOA 2ROEA 4V19J 2ACYA 5ADZA 2X1BA 2VKZG 2AMCB 4QBUA 4LF5F 4KHMA 4FYYB 3MMCA 1LQ9A 4KYZA 4QIVA 4U67Q 4M95A 3BJYA 3QLHA 1FTCA 5ITHA 1OQ3A 3IAS9 3KJFB 3DRPA 2YPZA 1SKUB 5HROA 3BH7B 3D2WA 1EP4B 1P9QC 4H4OA 2F5GA 3AQOA 4BHQA 3N28A 2MXYA 2UXDF 2HHPA 3C14B 4K4TA 2VOOA 3EM1A 2GV1A 2ASYA 4CNZA 4OI3A 4NLTA 3TZXA 3Q2TC 1IM6A 3UO0A 2DT9A 4Z7CA 5AJ3J 3H5SA 3KJNB 5B0AA 3CNQP 1LK5A 3BH6B 2XLKA 4DPTA 1LXNA 5KFCA 5DDPC 2VFVA 1Y9OA 3EDRB 5HMWA 4OL8A 1MSWD 2ZH6A 4C6AA 4N77A 2BABA 3MECA 2LDIA 4M5MA 2YWKA 2I5JA 1OJ4A 2RT3A 2VL1A 3HDSA 3ZC4A 1RTDB 2B6AB 1VQSA 3PJWA 1ZS6A 5KFWA 2CAJA 2AEMA 1TL7B 2LXUA 5ETKA 3FSIA 2FJVA 1WORA 4ELUA 4MKBA 3CO9A 3DLKB 1S10A 3AODA 2KFZA 2BA9A 2JEJA 1CJKB 3MCNA 5CAAA 2W2OP 5AXNA 1H2VZ 4DR7F 4NE9C 2M0GB 3ILIA 3S8SA 2QT7A 5L1LA 4DUYF 1TKDA 1HL6A 3MMAB 5EWFA 3W65A 1Q8BA 1SB6A 1ZPWX 1RAAB 3I0RB 2CQDA 4OJ3A 2FC9A 1FHTA 4TY9A 1N54B 3KLVA 1NBEB 1K8AT 1RADB 3NGDA 2UV8A 1JQGA 3E01A 4LBHA 3HT3A 4B9UA 1NPKA 1YJRA 3TAMB 1IKYB 4JI5F 2B4PA 1RCOB 1RT3A 2GVDB 3NGRA 4DXLA 3AH6A 1TFWA 2WVCA 5B0FA 2C3PA 1WC6A 4C11A 1S1WB 1Y5LB 3WX4A 8RUCA 2BEFA 5HBMB 1OMSA 5E0OA 3CCLS 3TWZA 3BSOA 2G2OA 4ECRA 4X66J 1K73T 1WG4A 2NXJA 1SL2A 3CTRA 5IFMA 3WDOA 2HHXA 1UWBB 1FNMA 2MLXA 2D41A 4OI6A 4NLRA 1UTAA 4UOHA 3GMGA 1I94J 1HLWA 2OSRA 3RU0A 4D3GA 4WE1A 1R0AB 1OSDA 1SJ1A 3BGRB 2V4JA 3ZTRA 3HULA 5IM0A 4MFBB 2A18A 1RA6A 5K20B 3H2UB 3W8GA 2KFYA 5C24A 3CCSS 1U49A 1F6TA 2YKNB 4QW9A 1VQNS 4U8VA 3HT0A 2IM1A 3HSZA 3IBFB 3ULHA 2N3OA 1RI7A 2OPSA 4QYRA 2IVFB 3M2UB 4A8WA 2E1RA 1RP5A 5HVFA 1HI1A 1J5EF 4C48A 3DDKA 2APOA 1FDBA 1UPMB 1LKZA 1R27B 1WF1A 2G0IA 2Z8QA 4IFVB 1S6QB 3VHQA 2YNHB 4WKYA 4I69A 4Y00A 2RQKA 3M32A 1NJXA 2IHR1 1TUGB 2WHOA 2ZH8A 4MTPA 3NCQA 3DCAA 2AJ2A 1PJ7A 3DOMA 4OMFG 2CJKA 2J8AA 1SH3A 2CYYA 2OEKA 2L9DA 4RLEA 4QWBA 2GIQA 3M2VA 1FFWB 1TL1A 4U95A 3NNCA 2IVMA 2EW9A 4WXOA 1I6JA 3LW5C 3PEJA 1T8EA 2HS0A 4OZ2A 1S7IA 1H98A 5GVQA 4LQ3A 5D4NA 4UOFA 2NSBA 3DLLQ 4F8RA 1HQEB 4I0WA 4DFMA 3N01A 2RVJA 1F2GA 2G2ZA 2HFOA 2C3UA 2KTQA 4LSNB 2CJAA 4F25A 1VRUA 1WKKA 4KO0A 4QR2A 4DI6A 2E7XA 1IR2A 2DHGA 1N36F 1XR6A 1NRKA 1S7HA 4KB7A 2MZ1A 3H2VE 1WF2A 2CFXA 3I9V9 2RUSA 4QW8A 1QLNA 2W7PA 1P27B 3P6YC 4LF6J 2RQMA 5A8KA 1GNKA 2DGXA 4URSA 4XO0A 1F9FA 5T7LA 1Z2ZA 3CF5Q 5DZ7A 2V8GA 4QJVA 2RRBA 5DG9A 1Y5NB 1WC4A 1S6PA 3PM9A 5KFUA 2DR8A 2H9ZA 1F1BB 4F36A 5J2QB 2X1AA 2ADCA 2ZFHA 1S0OA 1IBKF 3A12A 3TANA 1B64A 4JV5F 2Q3PA 3NBPB 4XPEA 2ZDPA 1SKSA 3DOKA 2Y9HA 2DK2A 2HBZB 2VH7A 3TEGA 3EWGA 4USTA 1GXLA 1N5SA 1YRTA 3KJQB 2RQCA 1VC5A 4I67A 2L9WA 2ZH7A 2HVHA 1HPZA 2CQ1A 3CO0P 1HW8A 4KY3A 5IC4B 3R3TA 4ZPCA 2VDHA 3V6HA 4HI1A 2HNZB 2V68A 4PRFA 1FRKA 3L9ZA 4IOAQ 4UY8T 4CH7A 3GE9A 2EFQA 4YMEA 5LSLA 2WB1D 5H9EK 3FCHA 3CULA 3G87A 4FYDA 1BQNA 3AA8A 3VAJA 2R7XA 3ZZTA 1PO6A 2CPXA 2B4VA 1M5HA 3JTPA 3FNNA 1TK5A 1FK9A 1PKUA 4USIA 2SXLA 1S0MA 1DTQA 2O01C 1E6VA 1RWUA 3CJ5A 4KFBB 1FVQA 3VAMA 1DTTB 4TYAA 1B3TA 1EZZB 2IBKA 4NLGA 4DQPA 5HVHA 1RBOB 3UQSA 3DOMB 4FF3A 4XK8C 2JEFA 5G0RB 2A10A 2C3OA 4MIBA 2FJEB 2QX0A 1T9YA 1N5QA 1XR7A 2J8SA 1U25A 3IRXB 3FFIA 3M32B 3PYDA 5AXLA 2XY7A 4LF9J 1RWNB 4H4KA 1LWCA 3PVXA 1BGXT 2MQMA 1RHUB 2CNNB 3DGPB 4JI8F 2QYCA 5GAEU 3A8JA 1GAOA 1S9GA 5KFZA 3H2LA 1FX2A 2H1YA 2JLGA 1HWIA 3EE3A 4OZJA 4LF4J 1PYTA 1A6LA 3VAIA 5IT4A 3IFEA 3HVRA 4Q0BA 5L9NA 2KVQE 2OPPA 4DSJA 2E1AA 3NAIA 3NL0A 4EI2A 4DQQA 4S0MA 3LP0A 2O66A 5HO4A 1JLAB 3NCRA 1QAYA 3M6UA 3BQ0A 2PEBA 3AOCA 2A0FB 2VPWB 4FKXA 4ZPTR 3G6YA 4L3NA 4ED6A 1F5BA 4IG0A 3H25A 4DV5F 3V4IB 3IM9A 2P5VA 1OY8A 1RISA 2DXFA 2CQHA 2Z2MA 3LF0A 4PXBA 2K7JA 2RH3A 2Y0SD 5CHCB 4GVBA 4DPUA 1DJ0A 2LA6A 3L7PA 3UR0A 2KB2A 2ZOMA 3TUJC 1U48A 2MLYA 3EUNA 3FBFA 3WBZA 3LPYA 2F8MA 1BY9A 1H7WA 3I32A 1GXTA 3QPIA 3W2VB 3CCRS 1A0OB 1S1WA 3ZO7A 4DPWA 4F3QA 3OV7A 1X9MA 2I6WA 2GVZB 3ET6B 5E3QA 4KTQA 2NLWA 2E9ZA 3T5HA 3CJKB 3GR1A 3MCMA 1S79A 2C1EB 4QQBA 2EFNA 2E29A 4EYHB 4WZQA 4WU2A 2PN6A 2C2EA 2F40A 1PG5B 1U6ZA 3M8WA 3FDSA 2AW0A 2HQGA 1QAXA 3HSDA 3RJMB 1V9OA 3D6TB 2M4MA 2YNGB 3IAM9 4Z37A 1SXLA 4DU7A 1WC1A 3MM9B 4B02A 3KHRA 3NOCA 3IS9B 3O6QA 4RNFA 3EZ5A 2QFIA 3HO1A 1CLFA 4JUZA 1YWXA 2XMVA 1JLCA 2GW8A 2MZSA 4IKAA 2Z58B 4QWEA 3CC2S 1U45A 1YI2S 2YTCA 1U1QA 1AZSB 4HR2A 3SXLA 1SJ3P 4FF4A 4E2FB 1HYSB 3MM5B 5ETSA 4IOCQ 5HQLA 4LBPA 1NSPA 3MECB 3EPIA 4D3HA 3ICLA 4TYBA 2ZHAA 1VIXA 2WRMA 3IBCB 2OP5A 3MM8B 3MMJA 1VRTA 1Q82T 1IWAA 2IIHA 4M5DB 1PC4A 1CSJA 2ZJPQ 2P8IA 2LLZA 3Q89A 1KNZA 2QTWA 4DCJB 2J6TA 3EVOA 4NCAA 2PT0A 3HHLA 3LP2A 2HHQA 1GMWD 3UDCA 2D1CA 3TAQA 1L3VA 1PAEX 2JLFA 4I2PA 3UCUP 1Q5YA 4LSLB 3KK3B 2Y1JA 4JB8B 2YQ3A 4NI2B 2M8DB 1QD1A 1RB0A 3OXFA 3JYTA 4IG3B 1RAFB 2BJ7A 4OJGA 2HHWA 3GQCA 3V81B 2NXEA 1S1VA 1LW2A 1VJQA 2L08A 1FTRA 3OTCA 1U4BA 2DR9A 2XZDB 3IGNA 2FHKA 3CMAS 2OPPB 5LMNF 1HNZF 2MY7A 3VCDA 3RRHA 1SUQA 2GCFA 3MCOA 3TO8A 4DV4F 4X2BA 2BQRA 1Z2LA 2QFJA 4LF6F 4B9TA 3RBEA 2YPYA 3B6BA 1NK7A 4B3TF 4L6V3 3TYTA 2PD1A 4DPXA 1V3RA 1TK8A 1LFPA 4OZ1A 1S76D 1CULB 2FHJD 1SJRA 2BJDA 3U02A 4PEOA 3TVZA 4F4YA 3A8IA 3W8PA 2M70A 1CQNA 3MEEB 3MWBA 1R8HA 3VGTA 4DR6F 4J5OA 2GJFA 3M2RB 4NZ7A 4PXDA 1VK8A 4C3MA 2K06A 3OL6A 2W9AA 1X9SA 2V9WA 3ZTOA 2FIUA 4LRAA 2JWNA 4UT4A 1FKOB 2JSXA 3R7NB 4CIOA 1SL0A 2HHHF 5KFHA 5C42A 4DR5J 2C2RA 1JKHA 1UVKA 3LO3A 1TZ0A 3MF5A 4YDXA 5BJRA 3OLBA 1Q81T 2B3TB 3CC4S 2FVRA 1TL4A 3BDEA 1E6VB 4O44B 1NMEB 3HVWA 3R1HA 4IFYA 4I64A 4LJMA 4O3OA 2JEGA 2DY9A 4ED0A 3DRRB 4Y3CA 1X0PA 2VBYA 4HH1A 3UCGA 4CTAA 4PAAA 2C3YA 2U1AA 4AFFA 3R2DJ 2HVEA 5H9FJ 2DPJA 1XEZA 1O51A 4F02A 3M8YA 5MAOA 4DR1F 3MDFA 3Q0AA 2J6UA 3TA1A 2VFSA 3I5AA 2E66A 5IWAF 3GG1A 4LR8A 3PIOQ 3EYZA 1BUXA 1FNXH 3UN5A 2EK1A 2P9EA 3AJDA 3CIZA 5B0DA 4ED4A 2LYVA 1RACB 2R2SA 1M5KC 2J7UA 2ZBIA 1FESA 1W2BR 1D9AA 2MMYA 4CT9A 2I1RA 3FRZA 3NP5A 3LQVA 3OL7A 1VQ9S 1NCLA 1G2EA 1VC6A 2YQ1A 5DS7A 2WCXA 3OTOF 4DR2F 1PYOB 1HMVB 1SV5A 3FSXA 5IQ6A 4N56A 4GKKJ 4JI2J 4DPYA 1RT6A 2K8GA 3SFGA 1LW2B 3VALA 5SUHA 5DGAA 3HPOA 1D1UA 1PAUB 2HFVA 2RS2A 5EDWA 1KKHA 1U26A 1S72S 4ZVPB 2UXDJ 1NHVA 4CO3A 2KJVA 4PXEA 4YY3J 3LWMA 2RNEA 2VQFJ 3JYTB 2G9OA 5GADU 2CNOB 1TELA 2IYGA 4AL6A 5AXMA 5K14A 2QEXS 4TU9A 4CZCA 5T7LB 1RSCA 3MUMP 4JOUA 2BQ3A 1YBAA 1IBMJ 1NK6A 1MMLA 4LF4F 1RT4B 1G1XA 4NWBA 1LFWA 3N4WA 3OJUA 3MR6A 2OPQB 2PGCA 3PRVA 4TKTA 5E3PA 4DL0C 4Q45A 3UWTA 3AOBA 1FWKA 1XN9A 4PXCA 1FDAA 1MROA 1A7GE 1P6TA 3BKUA 3QAUA 4P9SA 4F50A 2J9EA 1UW4A 5KFEA 2BBEA 4JYAJ 2FJXA 1N33F 1TMMA 1YZ6A 4OYPA 4R0EA 5KG4A 3BM7A 4FKYA 1HNVB 2HPUA 4GMKA 4QCLA 1BQXA 1S4FA 3O44A 4RWXA 4OYOA 5ETVA 1UZDA 1RJJA 2JFDA 1RAHB 3NG8A 1VLOA 3W7BA 2P2CB 3N6MA 4JI7F 3GSIA 3H5UA 1L3TA 3T6BA 1U1NA 1CEZA 1Q16B 2HMIB 1BMQB 2QL7B 1F3VA 2AT1B 1U1OA 3OR1A 2HWIA 4DV3F 4P2FA 5A0YA 5C5JA 1WSRA 5IV4A 1U47A 4U6PA 2XMAA 1O6XA 2W01A 3I4PA 2MQQA 3J81U 4U7UD 2X1FA 3NCPA 1NU4A 3TJ8A 1P8GA 3UDLA 3ZFVA 3T1HJ 2EVZA 4JI3F 3ET6A 4A8OA 4EK2A 4KH1B 4DX5A 3QATA 4CWBA 5EUHA 4EUVA 1CBKA 4RR5A 3CCJS 2R8JA 4JI0J 1CVJA 1TL3A 3SCJE 3R7BB 4U7CA 4ELTA 2K3KA 1N0UA 1R7IA 4DDFA 5CYJA 2XNRA 1RYSA 1NO8A 1JKHB 1O8BA 3W9IA 4I7FA 4NYZA 2OFHX 4OJHA 3WIVA 2AJ1A 3MD3A 3OSPA 1TKXB 2RMLA 3POTB 4ENOA 2D69A 2CQCA 1D09B 3G82A 4Y2MA 2YNIB 4QU7A 4ZVUB 4G65A 2ZKTA 4DV7F 1X4HA 4CO2A 2VOPA 3H0PA 4UOCA 5L38A 3BF4A 3C19A 2BKNA 3CPWR 2BRKA 2MYFA 2FC8A 5HP1A 2R7VA 1UEKA 3KK2B 2UVRA 1N6QB 3MGJA 5CXTA 2LCWA 5BR8J 1C1BB 2UUCF 1GFWB 4FXWA 4U96A 3NS5A 3TR5A 4HKQA 1B0VA 2ZZTA 3R2CJ 1SPBP 1RGVA 2FQQB 1IKVB 1U1PA 2FHMA 3S1TA 4RUHA 2ZNYA 1L3KA 2YKNA 2BDPA 1YJNS 5CD4A 1WKJA 1KQKA 1FEEA 1TP7A 3I9ZA 3IG1B 4NA2A 4C8NA 2VPYB 1KHWA 1ZBTA 4OHYA 2W1BA 3A3OB 5ETMA 4Q2LA 5DO2A 2AGOA 3GJQB 4EEYA 4WF9Q 4WZMA 5KG0A 1XIQA 2AIRB 1WI6A 1OPZA 2XSFA 4LSLA 3KK3A 2AJ0A 1MG7A 1XR5A 1LWEA 1WG5A 3U27A 1CJVB 1I1GA 4DR1J 4LF1A 4N5SA 4DL2A 4DQSA 2AJ4A 1TL3B 4GRSA 2R7RA 4LUBA 4DSFA 4K8RA 3MR5A 3B4MA 3NWRA 2QGFB 3G6XA 4M5DA 1DLOA 4PQAA 3OVBA 1KFDA 4WK3A 3L7OA 4IH5A 1N36J 2BVZA 2CPJA 3GFHA 4LFAJ 2PA3A 3C6TA 3K5LA 1EIYB 2DNMA 2V8HA 1N56A 3GTYX 4ICLA 1SI9A 1UMJA 3G6VA 3RAQA 4WK1A 2DNPA 4FBTA 1KQSR 5E3CA 2XMWA 1S1XB 2QLBB 2VG6B 3OSNA 4ED1A 3KDNA 1DQ8A 3MMAA 4JI6F 1HWUA 3W9HA 4F7VA 2MHNA 2VU5A 5EX3A 2Z2ZA 3MAHA 2BQUA 1ZH5A 5LOQA 3TI0A 4OI4A 2DBBA 1XMBA 3MCSA 3C14A 1RLDA 2OEJA 5KG1A 2VQEF 3RRGA 2KT3A 4R25A 5IOLA 1KVJA 1YDLA 1PJ6A 1S6PB 3PDNA 4IQMA 4HH0A 1WKLA 4LF2A 5HROB 4W90B 5EX0A 1I3OB 4M94A 2Y3YA 5LT5A 2AQ4A 1M0SA 1XTZA 1PCAA 3ITHB 3MMCB 4EO6A 1QVFR 2CNLB 2LQ5A 4JYAF 1IXKA 3RAXA 1HMVA 1SV5B 4OX9F 2P9GA 3GPAA 1R0BG 4DUZJ 2OTLS 2DH8A 4X4RA 2FHOB 1WJ9A 2I9SA 3SMZA 2H48B 3AFGA 2R2RA 1S1TA 4FYVB 1JJ4A 2W4PA 1EAYC 1ZM4A 2DNLA 2GQQA 2RRNA 2YKOA 3DFEA 3PACA 1O0PA 4TNOA 5E2QA 3RYLA 1X4CA 3A13A 3UN3A 5HAOA 4QZVB 1RT7B 1VYAA 1YSJA 3AHPA 4CLTA 2XGQA 1TKZA 1HI0P 1W26A 2MHEA 4CLLA 3OFFA 4MIAA 4ZJOA 1Q7YT 2B56A 2VPXB 3K89A 4DSKA 3LP0B 3T9NA 4DCPB 1Z4UA 4DJBA 3J81j 1URNA 1QSSA 2EBGA 4ZJQA 2HLTA 3NS7B 3Q2SC 5HVGA 4KC5A 1SBRA 2XTJP 1PIEA 3HVTB 1S9EB 1SC3B 2XY6A 2CG8A 2WONA 3PFEA 4PYAA 2E7VA 3HK2A 4C98A 4P7VA 2HKEA 2RDIA 3JTNA 2VFUA 3PTWA 4L75A 3GWCA 5HMYA 2V4QA 3SZ2A 1LWFA 2F65A 3DHXA 5LMUJ 1OY9A 3SDEB 4J7CA 3AXKA 3I55S 4UZBA 3DYAA 2FTRA 4USHA 8ATCB 1NK4A 2R7SA 4DHVA 2P9CA 1RAEB 4JV0A 5FLXY 3ENWA 3BGOP 3QZ7A 3GIJA 3R5JB 5DQGA 1VQMS 1S77D 1Y5IB 1HBMA 1MU2B 3CIMA 3DM2B 4CLFA 2X7IA 4AD6A 2VFRA 4WYWA 3X3UA 1MMNA 1D9FA 2CKWA 3MFHA 2QC3A 5LSRA 2XO6A 4PWDA 1HKAA 4ECVA 2ERRA 3QWUA 2KVIA 3CJSA 3J7A1 4O44A 1JIHA 1U0HA 3O8WA 3TX8A 5DM7Q 1FD2A 1SC6A 1GQEA 2KI2A 2VJUA 2FVQA 4F0KA 3OQ2A 5H9EJ 2ZH4A 1RWXB 2BM1A 5JUMA 4YB7A 4QPXA 2CA9A 3FBEA 2ZWOA 1IR0A 5KT7A 1RZMA 4DV6F 1NPRA 4RPFA 5DZ6A 2CPFA 2ZH1A 4FF1A 1RT7A 3H42A 1T9UA 4FBUA 3DI6B 4DL3A 2QO3A 3SIPB 4ILLA 4C7QA 2RKIA 3DMJB 5A2QY 2HVIA 2PDAA 3HHLB 2MJNA 2UP1A 5HBMA 4DV2J 3VAHA 1TTHB 1RWMB 1ZM2A 2O5DA 2EFOA 2QMUB 3N5FA 2CJXB 4HHJA 4OI2A 4USJC 2NXUA 1XK8A 1IKYA 4OJ1A 4ZP8A 2XYHB 4K50A 2WZ1A 3UFCX 4CYUA 2V2VA 2HAFA 2HRUA 2AX1A 2CRLA 2HQDA 3CJ4A 5HK4A 2VJVA 3HJVA 4DSIA 1XWLA 4CLWA 1FJGF 4NI2A 3KLGA 3QSIA 4IO1A 4LREA 4DFJA 1R8CA 2QMXA 3FZBA 2DNQA 1N5YB 3MTKA 2QZ8A 2HBRB 4R0JA 3FCWA 3LP2B 3IS9A 5KFOA 4DSEA 1P1TA 1RHRB 4Y2AA 3RB4A 4F4KA 1FRIA 4AUKA 5J2MA 3OUYA 7FD1A 4CCHA 1AW0A 4UUWA 3LWLA 2GQCA 3BBBA 5J2PB 3EPGA 1R6VA 4XDDA 2V50A 4ID8A 1F3FA 2LXIA 2XMKA 4L74A 3C6TB 3AOAA 1Y4ZB 3WZ0A 2EEYA 3HD1A 4DF8A 2E5LF 3PW0A 4I1TA 1VI7A 4OYBA 4AL7A 5B08A 3TEHB 1JLGB 1LK7A 1LWXA 3RG6A 2W24A 1N34J 3K57A 3SSQA 1UPPA 3BB5A 3TA2A 4G3IA 4OIXA 1HQ2A 4PG8A 2J0QD 4RW7A 2WW4A 2OJ3A 4NRTA 4Q44A 3QIDA 3KOAA 1TL1B 5HQMA 4KT0C 3D1QA 3T9ZA 4M5KA 4GKJJ 3ETOA 2D3OR 5J2NA 4W92B 3LGHA 2Y8YA 5AE1A 4HVZA 1NXIA 3HVAA 3HHLC 3JQJA 1KVKA 4FVMA 3W62A 1JLAA 4GC7A 2DR5A 3CJKA 3QRRA 4ES2A 2YNHA 3FC9A 3NGSA 3KUHA 3ZZ0A 4ZLJA 4RBTA 2YNFA 2W4CA 2R2TA 1YBTA 4L3KA 4OYIA 5KFKA 2NYHA 3OVAA 3PX4A 1L3SA 2MKSA 4RNHA 3UD5A 2DH9A 2DITA 2ASDA 4TXSA 3JSYA 3R5AA 4A8KA 4WWSA 2VV5A 5IT9U 2V2KA 3R7SB 9ATCB 4N8OA 1JJCB 1T03A 4X4QA 2YX7A 2XCAA 1JLQB 3ZNJ1 2WSCC 1I51B 5HP1B 3LAMA 3VAKA 3CT9A 4HI2A 1BLUA 2DPIA 4LFBJ 1WC5A 3KLHB 2DVIA 4B9NA 1R0AA 3MMBA 4QIGA 3ZZYA 1E6YB 1NSKL 4I2QA 5K8NA 4YQWA 1VQPS 1TR0A 4IRDA 3NOGA 4DR7J 1IBCB 1U2FA 4ZVFA 5C7PA 2LEBA 4B3MJ 5EN1A 2ZKUA 2ZD1A 1C1CB 4X62F 3PX6A 5L1KA 4C8MA 3C3LA 1TUVA 2D74B 2GHVC 3D3BJ 2DGTA 2BUNA 4X64F 1RTHB 2V8PA 3GZ7A 2HW3A 1CC7A 1HBUB 3EJMA 1HHSA 2AZ1A 3CJ0A 3C6UB 3D0HE 3ILJA 3N0VA 1CJUA 4Q43A 2UXCF 5ETRA 3RW6A 1B7FA 1F9EB 1TVRB 2VHGA 1TAQA 2IA0A 3CVKA 3TQ1A 3B82A 2DRBA 3CCUS 3IN5A 1FVSA 4C0HA 5DLGA 3QIPB 3M8QB 4WIQA 1ZAXA 1YIJS 2B9XA 1UFKA 3FJ2A 3HX9A 1UFWA 4UTGA 4ZKAA 4X66F 2EFGA 4Q5VA 3ZZOA 2HVDA 2N7CA 1QTMA 1VIOA 3OTDA 2HK2A 3MEGA 4OI1A 3MPDA 3JSRA 3NEKA 3OTEA 3VR1A 4IH7A 4IH6A 4FYWB 3SV4A 4A47A 2V94A 5U47A 3EX7B 1RU2A 4FNHA 3ELHA 4QYZK 4AT1B 2KZZA 5D15A 3H4DA 4B3OA 4DS5A 1EETA 1CJTB 2HHUA 1NJIT 1YK9A 2MLZA 3HHEA 3DRXA 1HR0J 4NXNF 4DL6A 3DKDA 1XNQF 2ZDOA 1RT5B 3DDIA 1WTFA 3GU0A 3ISND 2N7YA 1LW0B 1IKWB 1RK8A 4G1IA 4M5NA 4OZ5A 4Z7YA 4CO1A 1R31A 2H3EB 3TP2A 5E41A 4YP3A 2DNZA 5HATA 2CJYB 4MKVA 3OW2R 1YJVA 1FRMA 3DOLA 3R9LA 5HL7Q 4CO4A 5DQIA 2XLJA 3GIKA 1YRXA 3IMQJ 1K47A 3QGHA 3L7UA 1N33J 4C8ZA 5AXKA 2ASLA 4DZDA 1S59A 4KPCA 4LFCJ 3WC0A 1VQ5S 3ITHA 1NLKL 3H4BA 1ZM3A 2D3O1 1VOMA 2LQ9A 3OXGA 4UF4A 5D0HA 3MR2A 2LECA 1U1MA 2HS4A 4MH8A 3FMBA 4Q2MA 2YX1A 4RWWA 4DLGA 2FLLA 3RBXA 3D6HB 3IWLA 2YWHA 3LP1B 3WQPA 1I5OB 2FY8A 4ZVSB 4HHHA 4WIIA 3SCKE 1VQ4S 1AFIA 1RBAA 2QL5B 1YTYA 3VGVA 3M8RA 4USMA 1H74A 2DHHA 4LRDA 3KMQA 4R5PA 1WD6A 1ZOTA 3G8QA 1REVA 3KLIB 3M8PA 2W2QP 3SSRA 5KFJA 1R43A 2VD3A 1ZZFA 5A8RA 2MGZB 1SJ4P 2F4VF 3AQPA 2FLPA 1OIAA 4LIWA 2OHDA 4F4WA 3Q22A 3JB9k 3HKZD 2B4UA 2Q66A 1FXLA 1N48A 3VQTA 3EZOA 4JI3J 3MOZA 5CYQB 1M90T 3UI3A 2EPIA 5JJBA 4M5HA 2Y1RI 5KT4A 2IM2A 1HQEA 2OELA 4X4PA 4DR6J 1V5VA 2CZVC 4UY85 3AT1B 4Y6IA 2GQ2A 4BC7A 4ZN3A 1RT2A 1RAIB 2GC8A 1N88A 4H54A 5B0BA 2L9NA 2QV6A 4HEA9 1KSPA 2HHHJ 1NK8A 4ZCIA 3US5A 3WIUA 3IA0A 4RO0A 4CLPA 2V34A 4RW8B 1YJ9S 2ZH5A 4N7TA 4O3SA 3GIIA 1K0VA 2IDLA 1FRXA 5C24B 1EB0A 3MMBB 2MZTA 2EKNA 4OI0A 4G6VB 5I42A 2IJFA 1CJUB 2CJQA 5DG7A 2E5LJ 4IDKB 4P73A 1HBUA 1DAXA 1DBDA 3GCWP 3R6GB 2MKKA 2OPRA 4RW4B 2H54B 2OI2A 1AB8A 1UWBA 3W66A 1FRJA 4LFBF 3M7VA 1M1HA 4MIWA 1WEYA 4AE5A 5F9NA 1QDUB 3U1MA 5C2GA 2DHSA 5KG2A 4ZLLA 3G8TA 4LSZB 1M1GA 2CPEA 3Q8VA 1JMTA 1U09A 5HANA 3SSSA 5IZHA 1OWXA 1KP6A 1YG0A 4H4MB 1BD6A 4LVNP 3T5LA 4NL5A 2YKPA 4RL1A 3G8SA 4IR1A 4J9NA 5THWA 1N32J 3FUYA 1EQMA 2FJDB 2FLOA 1Q53A 3J81Y 1MLAA 2QSWA 2V4JB 4OV1A 4TQRA 3MM6A 3PW5A 2RD5C 2AYGA 2V67A 2YKAA 3I6PA 3MPUB 5CQGA 2C3MA 4XIUA 4P71A 5J2NB 4DOZA 3HCXA 3CE8A 4RW8A 5IXUA 4YOEA 2CQ2A 3OFGA 4ECXA 1MMDA 2JZ5A 4FZVA 4OX7A 3CCZA 2ZC3A 4QU6A 1MNEA 1UA0A 2XCPA 1FDDA 3FEZA 3T19A 2VONA 1RT2B 1X4AA 5GMEA 2F7VA 4BBYA 5KT2A 2CXEA 3H40A 2PMWA 3CUNA 3BS9A 1IBKJ 4F3OA 3CCMS 1HIYA 1VQKS 4F2RA 4IR9A 2O67A 2ZOGA 4FNIA 1QE1A 3F0NA 2W9CB 2DB1A 5D8HB 1RQ0A 2I5JB 3E01B 4DL4A 2BKOA 1UEUA 1H73A 3WC2A 4RW6A 1RA7A 4RKUC 5D4LA 2QA4S 2MZRA 1JNRB 3P8BB 1MWZA 4U8YA 1NJWA 4ILMA 1HR0F 4B3MF 2GMLA 2GAGC 1N6QA 2RRAA 2O3DA 3RBZA 4PG4A 4TLRA 1ZM9A 2CPHA 2OD4A 4NCBA 2CJ9A 3TARA 2YNGA 1IKXB 3EMTA 1WEXA 1HW9A 2KN4A 4X64J 3BN4A 1Y3JA 2L48A 1HNVA 1WC0A 2JC1A 5F8LA 3CCES 4RW6B 4J91A 2BE9B 4LVOP 1G3OA 2NREA 1OO0B 1PJ5A 3I87A 4PWWA 3DU5A 4DV3J 4OYWA 4HYKA 1S1UB 4DS4A 1UW9A 1R0CB 4RU2A 1NZ8A 2LEAA 4QOTA 2RDDA 3IBWA 4WFZA 3GFYA 5J2MB 4ZPBA 1AA1B 4ZVTB 2HQ3A 4UOGA 1G4CA 1RAGB 1RT4A 4DWIA 2F8EX 2CPIA 1XJWB 2DGWA 4R8UB 3GIMA 1FERA 2GFFA 4NCGA 1DFDA 5RUBA 2OSQA 4K5SA 4H4OB 2XYPB 1PBUA 4Y65A 3L3CA 1RT5A 3I82A 1N52B 2O1PA 5GAGU 2D3UA 4CLUA 4QWCA 4NMXA 2N4CA 3EXCX 1SC4B 1RTIB 1FCAA 4Y0FA 1HA1A 2E1MC 2FHJA 3QLHB 1JJHA 2OTJS 2KJWA 3T5JA 4ZVEA 2DXDA 2VICA 4QWDA 4QR0A 3K5MA 2B8PA 2YWFA 4DMZA 3QJJA 2Q1LA 4NXMJ 1U1LA 2R7WA 1RXOB 1QTNB 2AKWB 2DGOA 2R8IA 3ETMA 3HHNB 4HDHA 2ZBRA 3CWJA 5FDLA 3QIPA 2JC0A 4J9SA 1RLCL 4EU0A 5HJYA 3F41A 3DI6A 5D0EA 2R8HA 1YBUA 2OEMA 5D77A 1XNRJ 1TKTB 4ANCA 1M5PC 4NLDA 1BE4A 1LWCB 2C2ZB 4O3PA 4PWDB 2IPOB 3EGWB 4G1PA 2XSJB 4K0KF 1T05B 4U7UK 4M5LA 4ED5A 3D68A 5KFRA 4C0OC 3C6UA 2XSJA 3VVUA 2FB0A 3RB6A 5JMNA 2MZJA 1GTHA 2PE8A 3EICA 3QFHA 5M2PA 2LKZA 1VBXA 1LWFB 2NUUG 4KBIA 3AXMA 3UDEA 3M9OB 2ZD1B 5FDLB 4B17A 2WONB 3BDPA 1MWYA 1V3SA 5B0GA 3CD6S 1KLMB 3JQMA 4C8OA 5C25B 2KL8A 2XBPA 3BN7A 4RZRA 4DV6J 2HSEB 2NZCA 1S5ZA 4ZLNA 4PG6A 5HMXA 4ZVOB 4X4TA 1GMVA 3GG0A 3J80Y 2CDRB 3EGVA 1KEKA 1HNIB 1RTZA 2HG4A 4TY8B 3ZZUA 1SKRA 1HBNA 4IUFA 1T02A 2ZJQQ 2ASJA 4OV6A 2QE5A 8AT1B 3JAMU 1CULA 4RNNA 1ZTTA 5EWEA 4DV4J 3B54A 2I8EA 5KG6A 3GONA 2DNOA 3TVKA 1NDCA 4KGZB 1J27A 5GMDA 3D6FB 4QIEA 2V0NA 4OHVA 4RX6A 4QR1A 2H5EA 5BYRA 3H5YA 3DLGA 1SUQB 2IJRA 4A8XA 2RU9A 3OR2A 2WVFA 2YNFB 3ISZA 5MLCV 7FDRA 4YR3A 1N4LA 3PZPA 3PX0A 4ECTA 4ZA1A 1JX4A 3GFXA 1RUSA 1UAWA 3KJVB 5GADI 2X3DA 3KFWX 4K5RA 5F3TA 3PJ9A 1N5TA 4F4ZA 4ILRA 2YWWA 1Y0HA 3ADAC 2ATCB 5B7WA 2PFDA 3L95X 4OZ3A 2ZE2B 3T1HF 2AYEA 1Q5VA 4KPYA 1IKXA 2V8DA 2WAQD 3CCTA 4TLQA 5F8MA 3G2XA 3GR0A 2Z56B 3GYGA 4O3NA 3DOLB 3LGMA 4OX9J 2HVZA 3M9MB 3I0SA 5G4DA 2HYIB 1RHMB 4FPRA 5KFLA 3DLJA 3AD8C 4U9RA 4Y34A 3D7SB 3KNGA 3MM8A 4BCAA 3I56S 3UW1A 4FS1A 2UVUA 2VG5B 2MEWA 3V6KA 4FN5A 4A8QA 2MJUA 3IWXA 3KK1A 5BYQA 2W9CA 3E51A 3MM5A 2I2YA 1RHKB 1DLOB 5CABA 4O23A 5DDQC 1JWWA 3MEKA 3VGUA 2MKJA 2RILA 4OLPA 5LL6d 4YHHJ 1IVZA 5EGYA 1WHWA 2I38A 3HHKA 3M1VB 5DG8A 4P2SA 2ACMA 2GIFA 2G0JA 1MW7A 2GX8A 2XY5A 2RIJA 2NR0A 4ERDA 3ISNC 3DLHA 3Q24A 1DQ9A 1QUVA 2A3JA 3F56A 3OXLA 5CH7B 2J5AA 2KZMA 1FJCA 3BGLA 1TL5A 4DF4A 2V4RA 1Q86T 5C2CA 4HTJA 4LF7F 4V19X 1YJTA 2HWHA 3UDVA 5KG5A 2G1HA 3NY0A 5L9XA 1Y00A 2LFVA 2GA7A 5CCLA 1EX8A 1RTHA 2CQPA 2BMBA 2YX4A 4H4MA 3TZZA 2V5HG 3K59A 2RHQB 3BO2A 1SIZA 1OSCA 1RWWB 4DUYJ 4ID5A 4IRCA 3SCIE 1RKJA 2YWGA 1JLFB 2ABYA 4NLSA 3NNHA 1W25A 1VBKA 1OPIA 2VBZA 3IXQA 3P4UB 1RBLA 2HFUA 4URQU 5IV3A 5LJ5Y 1QSLA 1C1BA 3BR9A 3RW7A 3DLEA 1DURA 1CC8A 2KYZA 4NZ0A 2XI2A 4OHWA 4C3KA 1VFJA 2ZUAA 1NAQA 4IDKA 2FZCB 2HAIA 4DLEA 3SV3A 5D0RA 4Q7AA 2D7SA 3J7YU 2YNIA 2V8VA 4K0KJ 2RAQA 1TKXA 3POTA 1HWJA 2CPDA 4LR9A 5HI7A 1FA0A 1VS3A 3GJTB 3NXZA 4FYXB 1Q1KA 5D4PA 1IKVA 1H2TZ 1URRA 2E7WA 1KOHA 3DLEB 4B3SJ 3Q8SB 2ILZA 4JI7J 1SJQA 1FFSB 1I94F 2WVEA 2XO7A 1XERA 3SBMA 2JX2A 3CB4A 3M30B 3G71S 4DFKA 4JI1F 2NUHA 4XAKA 1B4SA 3G6ES 2IM3A 5LMNJ 1T0TV 2L3MA 1UEVA 2OPRB 3DU6A 2HQIA 4E0DA 2R7TA 3KUEA 5I4MA 1JJ2R 4NLUA 4CO0A 2W9BB 3KHHA 5ETPA 2CNKB 3HLUA 4ELVA 4K4VA 1IBMF 3DRSA 4CLZA 5L39A 2FGCA 3HP6A 1HNWJ 3PO4A 3I5BA 1WI8A 5A0YB 3SDEA 1T9TA 4YEAA 3SCLE 3VF0B 5GAHU 4I7FB 1XMOF 4ECWA 1FJGJ 1EKRA 4CLYA 4C8YA 3PKYA 1VGYA 3UCZP 3R5BA 3KLIA 1RWVB 1WOPA 4WFNQ 2AJQA 4P7TA 3QMQA 3FKBA 3VWSA 1H6KX 2LXFA 3CD7A 3ZTSA 1R8AA 4L72B 5HN0A 3BQ2A 2M3DA 4PYDA 2YKMA 1CJKA 3PXGa 2E1CA 1T3OA 3IR7B 4ED7A 1BQNB 3B8HA 2LU2A 1N8RT 2YXLA 1K9MT 4Y28C 2B9YA 1TL7A 1IBLJ 1RE1B 2QMWA 1OYEA 3QNWB 3KK1B 3OLAA 2VASA 4OFZA 1ZZNA 2VG5A 2X3GA 3LAKA 2NXCA 3OFHA 3TRGA 2JRSA 2OLWA 2IAJA 2ZJRQ 2PO4A 2VG7A 1SH2A 3QZ8A 2CZ9A 2R9LA 2W2NP 2XZTB 2DXEA 3K2YA 3Q86A 4KAIA 1REVB 3Q8RB 3E8OA 3RB3A 2E5JA 1WF0A 2BW2A 2CQIA 2KHCA 2DNGA 3PRBA 1N5VA 3S01A 3K5NA 2BXJA 2B8QA 4FXVA 5J2QA 1IKWA 1D8ZA 3M4XA 4MK9A 4WP8A 4A8FA 1SH0A 3PRDA 4WP3A 4JI0F 2ZZNA 4XDCA 1Q95G 1RKIA 1VQ7S 2HBQB 2D3ZA 1C4AA 1SVDA 2EI5A 2KRBA 2KG0A 3U1NA 1IQTA 4DSLA 1V6HA 5AE3A 2WB4A 3HZEA 3OR2B 2HIQA 3CXCR 3T6JA 3IWNC 4DV7J 2DH7A 3QQCD 4TQSA 1AFJA 2E1PA 2IYIA 5KT5A 1S97A 2PI5A 1S1XA 1QAJA 3GV7B 2UZAA 1ZPVA 3GB0A 1LW0A 2AU0A 3H5XA 1X5SA 4EBEA 2W25A 4I6AA 1CPZA 5B0CA 3MAAB 2W7AA 4UUXA 1NKEA 1NDKA 2YH1A 1KN6A 2DEJA 4G1QB 3CMES 4NLQA 2DGSA 4TY8A 4USKA 5KFPA 2F9DA 2GHPA 2G2YA 1KQFB 4I68A 5KFSA 1HQUA 2IC3A 3C8YA 2LDYA 3N6NA 2PSZA 1TMJA 1VHFA 2YKMB 3KG4A 3CGIA 1TV6A 2NS1B 1FE0A 1KWMA 4HLBA 2VBWA 4ZVQB 4EWTA 3RZAA 3P96A 1ZTWA 2QLXA 4LRBA 3QGPA 4JI8J 2IFXA 5K5MA 1DQAA 1F60B 4KHRA 4PCQA 2QLFB 3SQGA 5JXSA 5F8IA 1FI4A 1C0UB 1ZA1B 2EG1A 2FPHX 4DG1A 1NHKL 3ENQA 5J1PA 1FKOA 2GMHA 2MQPA 2BOPA 3HKWA 2FVSA 2PI4A 2Y8WA 1KFSA 4K4SA 1FKPA 2ZOFA 4ETXA 2B5JA 2M8HA 3IG1A 5FLXU 2B43A 4J9VA 4OYAA 4CH0S 4FXDA 5DM6Q 1C0TB 2A6MA 3BV8A 5KFAA 2EKYA 1UJ6A 5A8WA 2M7SA 2Y1LB 3TZYA 4ITSA 4ZPWR 3Q8PB 2UVVA 2DRAA 2R42A 4HHUA 4K2XA 3BSAA 2BR0A 4KV8B 3C2PA 4PKDB 3PKMA 1QUPA 5J1NA 2PMZD 4MJKA 3FBCA 1F0XA 2E5GA 1U7LA 1T9XA 3IGVA 1VBYA 3NRBA 5FD1A 2BANB 2CADA 2VDIA 3PEHA 3TX0A 4NPOA 4C2MA 4NLOA 1HBOB 1S4EA 4J9RA 3BKFA 3LOUA 5IM0B 1UVJA 1Q8KA 3WX8A 3J7ZT 4JI1J 3D1HA 5CYMA 4C3LA 4QWAA 2KXNB 3M6VA 3AD7C 1RAOA 1H7XA 1IJFB 3MEDB 5BYSA 4C4WA 3GYXB 1F5AA 4YR0A 4GKKF 1B0PA 1UA1A 1HI8A 4N76A 4KKOA 2COLA 1U2RA 2V2QA 3QJPA 4DZ6A 4ZHRB 3BO3A 5BR8F 2JNJA 2W2MP 2EWHA 2RB7A 4F2SA 2GAHC 2KXFA 3GSDA 3MR3A 3U7JA 1S0VA 2EC0A 1UP1A 1ZAVA 3KXDA 4PWUA 1SQEA 2J0XA 5DRKA 2J9DE 3W9JA 2AGPA 1RHQB 3TW0A 3OJSA 3B4DA 1FWLA 3RUBL 5KFXA 4ER8A 3NGUA 4Z2XA 4J9KA 4PQUB 1X0FA 4P72A 3VZHA 1NK9A 2DCLA 4QYZJ 2DNHA 3MPWA 3D67A 3WHIA 2BKPA 4ZITA 2EK6A 4AXIA 4EMDA 1NSQA 1C2PA 2AYMA 3QYYA 2JVOA 3UD3P 2VG6A 2A1BA 4KRWA 4WFBQ 5F8NA 4FDFA 3PW4A 3FRYA 1KS2A 2C2MB 2NPFA 1X31C 1H2UX 2CQBA 2RF2B 1XMQJ 1RT1B 1BQMA 3D5MA 2K7KA 1YLXA 3KYLA 2Q6BA 1EARA 5HQ8A 5L46A 3V6JA 1AZSA 3IR6B 2AF6A 2OPQA 2QSFA 4UZCA 3DRYA 1RTJB 4LF8F 5LSOA 4PG7A 2J6SA 2HHSA 3AA9A 4J9LA 2XULA 2K3IA 2ZM6F 2OFGX 2VF3A 4EBCA 4BWJA 2KYXA 3PHTA 2CPYA 2GS8A 1UVMA 1LWEB 4O4RA 2KT5A 2LQ8A 3EXYA 4GC6A 4OYXA 4BDPA 4CH1A 1OYDA 2B4OA 2DO0A 4CO5A 3GCXP 4J9MA 1P9YA 3DRPB 5ETTA 3QO9A 7AT1B 1SKWA 2HZAA 1TU0B 1YQHA 2HRTA 2RUGA 5AJ3F 3T41A 1QSYA 4PUOA 1TAUA 5D78A 1HBOA 1FF2A 2RU3A 5IC6B 4DR5F 5D0GA 1SCJB 3ZTQA 2XGPA 2VQEJ 3V6DA 1LV5A 2EBEA 4M5IA 2DNRA 3TUPA 5DETA 1ZAWA 3W3SA 2HK3A 1WNEA 3KHLA 3W2VA 3D54A 1WTBA 2F4FA 2LQBA 1AROP 3V5RA 4KJIA 5DDOC 3IP0A 3VGSA 1U0HB 3RBDA 3HSGA 4BLGA 3DGPA 3GIRA 2R2UA 2OD6A 3KG0A 3LGNA 4KQZA 3QJLA 3D9BA 2VFTA 4ED8A 1GH8A 2A2DA 2VUGA 4NLPA 1GX6A 1U24A 2BX6A 4PZVA 2CDQA 5F8GA 4X84A 2JDJA 2XLIA 4FF2A 4E98A 2H5IB 3UPFA 1ELOA 3N9UC 2MQ8A 2HFZA 1Q8IA 1X4EA 3SQGB 1NB7A 4OZNA 4O0IA 2XS5A 3QRQA 1VLYA 3QAEA 4KV8A 4QIWD 3TUIC 2RE1A 3O5TB 3PIPQ 1UETA 2D9PA 1FK9B 1WHXA 4USUA 4UQGA 1C0TA 1WHVA 2CQ3A 3HZGA 2VZ9A 5KTQA 4HT7A 1CS4A 3MM7B 3OTOJ 2ZH2A 4DR2J 3PG9A 1B0TA 2P6TA 3M2RA 3KLEA 2OH2A 2E9RX 2RSQA 1V5IB 3FGVA 3OTBA 1TKZB 3DYAB 3H8YA 2HNZA 3MD1A 3MAAA 4MT1A 3AY0A 3H59A 2MKIA 9RUBA 4YS2A 2XHWA 4MMOA 4CI0B 2I0XA 1VQLS 4HACB 1DTTA 1UKUA 2FDNA 2E5HA 2KHDA 4KE5A 4DU8A 4K4WA 4ATNA 1ITPA 2G1DA 2ROGA 4TN2A 4LF5J 3GP9A 4I56A 3H20A 1FEHA 1MWQA 2LP4A 4DQRA 3HI9A 1RWPB 1K1SA 1NB2A 1FWPA 4CNYA 2V2ZA 2L41A 1QM9A 1GTEA 3HSJA 3DLBA 5FJ4A 3KNAA 2HNDB 2MTLA 1LNQA 4W4MA 1NPPA 4WCEQ 2XM3A 4LR7A 2DGVA 4PUOB 3X1LB 3CW2C 5D3GA 3PYFA 1HHTP 3PCOB 4DQIA 2ZBQA 4OLOA 4DV1J 4KR0B 1YGYA 2LQJA 5I3UA 4I2PB 1NJYA 4ECQA 3MHYA 5EWGA 4K4XA 2OAUA 2D9OA 2UV8G 4ZS6A 2VIHA 4RW9A 1DHMA 1T11A 3DOKB 2KH9A 4J9QA 1QVGR 2X51A 1S6OA 5HSPA 2XS7A 4ZDNA 1CG2A 4RJVA 4RW9B 3K5PA 4WXWA 4DN0A 3GILA 1FT8A 2M52A 2VB6A 3I5CA 4QIFA 2XG8A 1UFLA 2M2BA 2OMOA 3GLJA 2KM8B 4C8LA 2EG2A 3H7HB 2DEIA 2VQFF 4O3RA 3HF5A 3PHEA 4JV1A 3BKTA 4NYPA 4OHXA 5D3GB 2MQLA 2LEPA 3CDBA 5KFGA 3D0GE 3BR8A 1HYSA 4AQYJ 2Z57B 6FDRA 4M8LA 1RT6B 1ZA2B 2XYGB 3BO4A 2WVDA 2NPIA 3QRPA 2K2PA 2N82B 2V63A 2JOQA 4DPOA 4OYMA 5A8KB 5A2QU 5KOXA 3M8ZA 2QRRA 1NDPA 1CJVA 2LVWA 3D0IE 3M2VB 3M8QA 1M5VC 1RABB 5K8PA 2N4DA 2QL9B 3RTVA 4RBUA 2CPZA 3AJ2A 5H9FK 3HFZB 5KT6A 1NH8A 3UVJB 3CJRA 4LSNA 1NKBA 1X9WA 1FFGB 4CDIA 4DV0J 3CC7S 1CS4B 3MM7A 3VV2B 5B0EA 3IR5B 3R8YA 4ED3A 3DNCA 3THVA 1T03B 2VA2A 3M6WA 3C66A 4A8YA 4A8SA 3EGZA 1S99A 2DCUB 4Y2IA 2CUYA 4AXJA 5KOWA 3UN2A 1C1CA 2HGNA 3GJRB 3VAFA 3CDWA 1F2HA 2HZVA 4IQXA 2UXBF 5E7OB 2ZVSA 4X4SA 4IYQA 4NLYA 4GVBB 4DEZA 1K1QA 5J1EA 5GMKa 4O4GB 5KFNA 2MQNA 2ZHBA 3KK2A
chains in the Genus database with same CATH topology
4I2QB 3OHAA 1E6YA 2XEXA 2KT2A 1IJEB 1VJWA 2HFNA 3V4MA 4B08A 3MEEA 4WE1B 4IFVA 1Q7LB 2MDAA 2CQ4A 2DHAA 2CG4A 1ROFA 4Q0BB 4X4NA 1GX5A 4MYUA 3I96A 2AYBA 5F8JA 1M1KT 1QY7A 2OPSB 1VMBA 2A2CA 2J9CA 3FFIB 1S1VB 4ZP9A 4NX9A 1WG1A 2BZ2A 2ROPA 4ES3A 2M5YA 4UW2A 2AP6A 1Y3KA 4IG3A 4BS2A 2J0WA 2PC6A 2RQ4A 4LT6A 3I0RA 4ZP6A 3CD0A 3MI7X 2FD2A 2UUTA 4RW7B 4OX8A 2HHVA 1UVIA 3FEYB 3NNAA 3N79A 4MKAA 5L8RC 2FY1A 1RTJA 1IM4A 2VBXA 4KGKA 2KM8C 3CDUA 5AE2A 1RT3B 1XC9A 3M8SA 1KTQA 2MSTA 3PV8A 2BE2B 4G1QA 3SYZA 1RT1A 1LOUA 3BEGB 1RTDA 3BGFA 2DGUA 3OR1B 1HPZB 4I6YA 4WFAQ 1AUDA 2M9KA 4DN9A 2UUWA 2C28A 1FDNA 3HHDA 1IUJA 3M8PB 1S9FA 3FQLA 4ZOSA 1UVLA 4DUZF 5IQQA 2DD8S 4A48A 1FRLA 3OFEA 5FIIA 4K4ZA 5K14B 3QWPA 3ZZPA 3KLGB 4EZ6A 1SIWB 3IC1A 1VQ6S 2B0GA 2W8KA 2ZH3A 3P3DA 4WTYA 4TU7A 2WTFA 3TAPA 2IA6A 1FNOA 3AJ1A 2BRLA 4ZMMA 5LXYA 2R7UA 3LH2S 4WFYA 4AYBD 5KFMA 2GMJA 4EYIB 2YVSA 3I0SB 4XPCA 2ZZMA 1JK9B 3GV8B 1ZYQA 1KC8T 2IJNA 4AL5A 2GGPA 1RYRA 5K8OA 1WELA 2HWTA 2LU1A 3OL9A 3TUZC 3R1LA 3JAMY 2PEHA 1NHUA 3MEDA 4DL5A 2FJWA 3RR7A 1EP4A 1DARA 4KO0B 4RUAA 4IG0B 3V4IA 2XMTA 3G4SS 2IRYA 2WOMA 2AX0A 2WSFC 2ZC4A 3E3XA 1JXEA 3K7RA 4PG5A 5DGBA 1D8YA 4B3OB 2LA4A 4DV1F 1D9DA 4IOBA 2JH3A 4GO5X 2M88A 2BANA 3DC2A 1HD1A 3MEGB 1AXQA 4IFYB 4DV0F 1YRUA 1YVFA 4YB5A 4RU9A 3CDEA 2FJBB 3MUTP 1N32F 2J9DA 1GXUA 1S9GB 4B3SF 1CQMA 3V2UC 4OZLA 1X4BA 5C42B 1N0VC 1KQGB 3K8WA 1NKCA 4UQTA 2ATLA 2IVYA 4Y2KA 2MZQA 4YFUA 4B9VA 2Z2LA 3KLEB 2B5JB 2BACA 5KT3A 3I4HX 3E2EA 3DRRA 4CTAB 4YDDB 1NK5A 3PO5A 1C0UA 1D3WA 3BGUA 1FE4A 3Q23A 5KFFA 2DTJA 3R27A 1HWKA 1JLEA 3HVTA 4OHZA 3CD5A 4YUDA 3MURP 3V6DB 5EHHA 1U1RA 1HQUB 2IC3B 2B9WA 2CZ4A 1BC6A 2XNQA 2ZH9A 1VQOS 2NQPA 1PILA 3O1LA 4YB1P 3BGRA 1PC5A 3TVYA 2AV5A 2WOMB 4ZP7A 5KAKA 2XWXA 3Q8QB 3EZUA 4WYLA 3J7Z5 4ZVGA 2UU9F 4JBCA 4K59A 3N5BA 5CA5A 3OL8A 3VQSA 4IO9Q 4HT5A 2KU7A 3FEXB 4MYTA 5E33A 1R89A 3GFZA 1XBWA 4R8UA 4F67A 3K58A 2E9TA 2DNNA 2GNKA 4A4JA 1JXLA 2CQGA 4X4VA 4NMLA 2QIFA 4WFXA 2DNYA 5A6WA 1VRTB 2MKHA 3K5OA 5SZTA 3HJFA 2GO9A 2QLWA 3KHGA 2GJIA 1S1UA 3QO9B 3BQ1A 2IMWP 1RTIA 2NYIA 2RF2A 4ETZA 3UR3C 3MUVP 1KVIA 3G96A 5HLFB 2R7OA 1APSA 2HGLA 1WEZA 4DL7A 1H38A 4ZPDA 1UJ5A 2KRRA 2DO4A 3D1OA 3L09A 4X65F 1ZETA 1JLCB 4DV2F 2K1RA 4M63A 2C42A 1X5PA 4JI4F 5LXRA 4Q8FA 1TFYA 3OPKA 1Z1ZA 3UNGC 1UVNA 2AWZA 1KTVA 1IQZA 1XMQF 2JEIA 4WKRA 2DGQA 2IAJB 3R5DA 4EBDA 1S0NA 5GAHI 3RR8A 2GHWA 2XMUA 3VTIA 2Q79A 1QE1B 2J7KA 3G86A 2F1FA 2WK4A 1NH7A 1JNZB 2JL9A 2OMLA 4I4BA 4JI2F 4ZHRA 4FP9A 2FGOA 4MKYA 1FD8A 3MM9A 3NAHA 1VQ8S 2AJFE 2KG1A 3PR4A 3T5KA 1NEEA 4ZLPA 2MY8A 2W8LA 5M2UA 4PQUA 4C0BA 4O3QA 5KFYA 2Z4PA 4J9OA 4ECYA 3SFUA 5KG7A 1G7CB 5DQHA 2J7WA 3DN9A 3IO1A 3SEOA 1FJ7A 1YJUA 1TK0A 4P6QA 2R4FA 2ZUGA 2ZHOA 5GAGI 3VAGA 5M2RA 4X4UA 3DLGB 3M30A 4PR6A 4KKOB 5HMZA 4GKJF 2JJ4D 1HNXF 2KXHA 2WBMA 2KFNA 4I6WA 3H98A 1KONA 3M6XA 4PPZA 5JVGQ 1J5OA 3T1YF 3RAMA 2MKCA 5F8HA 3FQKA 4MK8A 3M05A 3S6EA 4RW4A 2GIRA 4OQJA 3PR5B 5CYMB 2EFPA 2W4DA 4RUCA 5I3PA 3DXBA 2KKHA 1NZAA 1ULRA 4NLXA 3L3CA 3QGIA 4K4YA 3TNVA 4YY3F 1S48A 3LUYA 2YKQA 2IRUA 2U2FA 1R3NA 4ES1A 5CZXA 2Q43A 3FSYA 4ZPVR 4DG1B 3OVSA 2QA4G 3SI8A 3HHLD 5J1EB 1P1LA 1QAIA 4N41A 4QYZJ 3U1LA 5DJBA 2PMHA 2UVWA 2FJAB 4N47A 1DTQB 3RB0A 4ZVHA 1LXJA 1WHYA 1HFEL 1T95A 4C11B 1M5SA 5A8WB 1HWLA 2C2DA 1YJWS 4NXMF 3NWGA 1PGZA 2RS8A 4ZCKA 4DR4F 1A9NB 3IRXA 3KLFA 2GJ2A 1T05A 5G0RA 5CYQA 5E3AA 3CDAA 3CCQS 2AGQA 5IT0A 1KHVA 4F4XA 5IT9Y 1VK3A 5H1SV 4OX6A 1S9EA 5F0WA 3M1VA 4R5PB 4LQ9A 2CVEA 1TV6B 1HARA 4Y2CA 4URGA 2RJZA 3G9CA 1NJZA 5K8MA 3P5TL 1OQ6A 1VQYA 4YHHF 4LFCF 2C22A 1Q78A 2HZCA 1H3DA 4KGMA 3NMRA 2ZITA 1MROB 2UUAF 3NS6A 3BREA 5IS2A 3PFOA 1FXDA 3NGKA 3NMAA 2MGZA 2JFKA 4MK7A 2F8HA 3JSBA 2IMOA 3KMSA 1O5JA 1X4FA 3THTA 3NBPA 2WBRA 3BSNA 1X5TA 1Q79A 2UUBF 4B3RF 1NK0A 4FVCA 2NSCA 3K8VA 3MPVA 5I3UB 4OZ0A 4AQYF 3NLCA 3LP1A 5KFQA 4YR2A 5E3RA 3QGGA 2CQ0A 2HRYA 1VRUB 1HNWF 5L1JA 2RDJA 3HFKA 3O3LA 1FXRA 2CVIA 3R5CA 1U6BA 3CJ3A 4NLWA 3HMJG 2Z0GA 2DJWA 4H4KC 6FD1A 2G4BA 5DDRC 3ONQA 3TA0A 2HHTA 2OO4A 2Y1IA 3FZ2A 3A8EA 2X1GA 1T94A 2DIVA 5B09A 1VBZA 4NLVA 2VG7B 4ZPAA 4NA3A 1S6UA 2J76E 4B9LA 4PPDA 1IBLF 1HD0A 3AB4B 2FUG9 2XWYA 4ICLB 3LANA 1TVRA 3JSMA 4ED2A 1BWEA 1HBNB 2BE2A 1EETB 2PIIA 2ZBCA 4B9SA 1F5CA 5KFVA 2P6SA 1R8BA 4ZCLA 2W9BA 4WJBA 1S6QA 2E44A 4A8MP 1WACA 5KFIA 4JV2A 2QA1A 2DIUA 5KG3A 1H0HB 5KFTA 2MB0B 4K4UA 3W2WA 2FLNA 1JLBB 4EFAC 4EGLA 4GO7X 1KD1T 2B7BB 1RDRA 3K0JA 1J2VA 3MM6B 5F9LA 3DRSB 2VA3A 5L1IA 4MFBA 3PW2A 4LFAF 3N6LA 2JVRA 4MAKA 2ZNZA 2YWEA 2OKQA 1U6FA 1JLQA 3M9NB 1R6YA 2N3LA 5LJ3Y 2B7CB 3OBIA 5D4OA 3PY8A 4YB6A 5CCMA 4LF9F 3AAWB 3O2IA 3M2UA 1FJEB 5F0UA 3MTJA 1R8PA 4NA1A 1SL1A 1G6BA 1WWHA 4C9DA 3MXHP 5DLFA 2HLUA 3P49B 4C8KA 4IRKA 3V81A 5I42B 4X4OA 3TAMA 2QA2A 3GV5B 4KIAA 3DHWC 2HNYB 1UJ4A 5K9FA 3ENVA 4O4GA 3OHBA 5LMUF 1DZ5A 3W2WB 4NOHA 3UD4P 4Q8EA 2XS2A 4NCGB 2CIMA 1JLFA 3CJ2A 4DX8H 2WW8A 4ID5B 4F26A 2ALZA 3C46A 4A46A 5A6PA 1JLGA 3DLKA 2BV3A 2HGMA 3CCWA 4ECUA 1C4CA 1BQMB 2B6AA 3KG1A 4J37A 4ZCMA 2PFFB 4NYOA 4ZK7M 2VC1A 4WU3A 2CJBA 1VC0A 2EFVA 1K0TA 2HMIA 3OUYB 3AB2B 3ZZRA 5A8RB 4F3MA 1RAJA 5T14A 3MZIA 1T3NA 1KRPA 2KO1A 4N8NA 2MSSA 2MPUA 3JTOA 1N5YA 2POKA 2OIHA 5D6GA 3TOQA 3HXMA 3FVYA 2DHXA 2FVCA 5CZVA 1FKAF 3MOJB 4BC9A 1KOOA 4ALZA 2AD9A 1V3ZA 4BWMA 4HL9A 2B51A 1X7VA 2HS3A 3KKFA 5J2PA 3HM9A 3IRWP 2J0SD 3DDNA 1X5OA 2F3JA 1GT8A 1X8DA 2DNKA 2XB2D 4E8UA 3PJXA 4M1KA 1OS5A 5F3ZA 4NZ6A 2W7OA 4HTIA 3T3FA 1JB0C 2K1RB 1PSDA 2LMIA 2RKIB 3DMJA 3D28A 1UL3A 3MFIA 1Q8LA 1Q4RA 2ILYA 3I31A 2E5IA 2ZE2A 5KFBA 1FRHA 2R7QA 2IM0A 2XMJA 3VZIA 3MAQA 5HLFA 1T7PA 2HNYA 3F73A 2VKRA 1KLNA 2V9KA 1QJHA 1U8SA 4CQ1A 3MPYA 3KWMA 5KFDA 2IRXA 3KJVA 1HNIA 4ECSA 2ADBA 1L5UA 2PA8D 2DISA 1KR4A 2HNDA 2BYCA 3FMWA 1IN0A 4DBQA 5I3QA 4TU8A 2Q6CA 3CEDA 2F9JA 1YITS 3KTQA 4RNOA 1TQLA 3BSCA 5C25A 1SJFA 2DR7A 5CD4H 1FO1A 1KLMA 2XI3A 3PNIA 5JVHQ 1JLEB 4RNMA 2BM0A 1L3UA 2YH0A 3THPA 3DXSX 3EGNA 2XZWA 5E5NA 5GAEI 2VODA 1X4DA 3CCVS 3ZZZA 1N34F 2WSEC 3CSKA 1DRZA 4J9PA 3KLFB 3A1YG 3BZQA 1M5OC 1FKPB 2JLEA 3B78A 3F44A 3UE2A 1S49A 3NKYA 1JLBA 3GYNA 4RBVA 2BJEA 1X4GA 4LMZA 4KFBA 2G13A 4KSEB 4QPTA 1XNRF 4LIRA 3LALA 2IBOA 1NNDA 1YHQS 4DFPA 4HDGA 2XMMA 3J7YI 4CT8A 1HBMB 1MU2A 1Y7PA 3DM2A 5F41A 2VC0A 3KLHA 2VPZB 4C97A 2R8KA 4NRUA 3RRKA 3JSMB 2GO8A 2FVPA 4KHPF 1W2IA 2NZ4A 2YY3A 1TKTA 1J5OB 3S7RA 3T1AA 1D0EA 2XC9A 4EZ9A 2MQOA 2G0CA 1S1TB 5T41A 4DR3F 2GGPB 2JHEA 2KDOA 2ROEA 4V19J 2ACYA 5ADZA 2X1BA 2VKZG 4QBUA 4LF5F 4KHMA 4QIVA 3MMCA 1LQ9A 4M95A 4U67Q 3BJYA 3QLHA 1FTCA 5ITHA 1OQ3A 3IAS9 3DRPA 5HROA 3D2WA 1EP4B 1P9QC 4H4OA 3AQOA 4BHQA 3N28A 2MXYA 2UXDF 2HHPA 4K4TA 2VOOA 2GV1A 2ASYA 4CNZA 4OI3A 4NLTA 3Q2TC 2DT9A 3H5SA 5B0AA 2XLKA 1LK5A 5KFCA 1LXNA 1MSWD 5DDPC 2VFVA 1Y9OA 5HMWA 4OL8A 2ZH6A 4N77A 2BABA 3MECA 2LDIA 1RTDB 2YWKA 2I5JA 2RT3A 3HDSA 2VL1A 3ZC4A 4B9MA 2B6AB 1VQSA 3PJWA 5KFWA 2FJVA 4ELUA 2LXUA 3FSIA 4MKBA 3CO9A 3DLKB 1S10A 2KFZA 2BA9A 2JEJA 5AXNA 1H2VZ 4DR7F 2M0GB 3S8SA 2QT7A 5L1LA 4DUYF 1HL6A 3MMAB 5EWFA 1Q8BA 1SB6A 1ZPWX 3I0RB 2CQDA 4OJ3A 2FC9A 1FHTA 4TY9A 1N54B 3KLVA 1K8AT 3NGDA 2UV8A 3HT3A 3E01A 4B9UA 1YJRA 3TAMB 1IKYB 4JI5F 2B4PA 1RT3A 1TFWA 3AH6A 5B0FA 2C3PA 4C11A 5HBMB 1S1WB 1Y5LB 3WX4A 5E0OA 3CCLS 3BSOA 4ECRA 1K73T 1WG4A 1SL2A 3CTRA 5IFMA 3WDOA 2HHXA 1UWBB 1FNMA 4OI6A 2D41A 4NLRA 3GMGA 3RU0A 2OSRA 4D3GA 4WE1A 1R0AB 1OSDA 1SJ1A 3BGRB 2V4JA 5IM0A 4MFBB 2A18A 1RA6A 3H2UB 2KFYA 5C24A 3CCSS 1U49A 2YKNB 1VQNS 4QW9A 2IM1A 3ULHA 2N3OA 1RI7A 2OPSA 4QYRA 3M2UB 4A8WA 2E1RA 1RP5A 1HI1A 1J5EF 3DDKA 2APOA 1FDBA 2IVFB 1LKZA 1R27B 1WF1A 2Z8QA 4IFVB 4WKYA 1S6QB 4FS2A 2YNHB 4I69A 4Y00A 2RQKA 3M32A 1NJXA 2IHR1 2WHOA 2ZH8A 4MTPA 3NCQA 3DCAA 3DOMA 2CJKA 4OMFG 2J8AA 1SH3A 2CYYA 2L9DA 4RLEA 4QWBA 2GIQA 3M2VA 1TL1A 3NNCA 2IVMA 2EW9A 4WXOA 1I6JA 3LW5C 3PEJA 1T8EA 2HS0A 1H98A 5GVQA 4LQ3A 5D4NA 2NSBA 3DLLQ 4F8RA 1HQEB 4I0WA 4DFMA 3N01A 2RVJA 1F2GA 2HFOA 2C3UA 2KTQA 4LSNB 2CJAA 4F25A 1VRUA 4KO0A 4QR2A 2E7XA 2DHGA 1N36F 1XR6A 1NRKA 1S7HA 4KB7A 2MZ1A 3H2VE 1WF2A 2CFXA 3I9V9 4QW8A 1QLNA 2W7PA 1P27B 3P6YC 2RQMA 5A8KA 1GNKA 2DGXA 4URSA 4XO0A 1F9FA 5T7LA 1Z2ZA 3CF5Q 2V8GA 4QJVA 2RRBA 5DG9A 1Y5NB 1S6PA 3PM9A 5KFUA 2DR8A 2H9ZA 2ADCA 5J2QB 2X1AA 2ZFHA 1S0OA 1IBKF 3TANA 1B64A 4JV5F 2Q3PA 3NBPB 4XPEA 2ZDPA 1SKSA 3DOKA 2DK2A 2VH7A 1GXLA 1N5SA 1YRTA 1VC5A 2RQCA 4I67A 2HVHA