4ESHA

The crystal structure of thymidylate kinase from pseudomonas aeruginosa pao1 in complex with deoxythymidine.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
211
structure length
207
Chain Sequence
NAMTGLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPSDEPMAADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPVEIGLARGRLDRFEQEDRRFFEAVRQTYLQRAAQAPERYQVLDAGLPLAEVQAGLDRLLPNLLERLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title The crystal structure of thymidylate kinase from Pseudomonas aeruginosa PAO1 in complex with deoxythymidine.
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 83
structure length 207
sequence length 211
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4eshA00
4PXAA 3ZDQA 3EPHA 2IUTA 2XSZD 2AKYA 1Z3IX 2NPIA 1CJTC 3FKSD 1R10A 2HF9A 2J3EA 3B6EA 4IDQA 1W36D 3B9PA 1KI7A 3PUVA 3TUJC 2I1QA 4AIIA 1E2HA 4I1VA 2X1VA 2D62A 1ZIPA 2AFIE 2C9CA 1KI6B 5FL7A 4NHOA 3KDSE 3MG9A 2I4IA 1JJ7A 1QHYA 5LPNA 3A4LA 2PT5A 3KKPA 5FR1A 3B60A 5GVRA 1B23P 3SFVA 1LVGA 3LLMA 3ZIAD 4TL9A 4TMXA 4C7OA 1WXQA 2WMNB 2ZRIA 4V0OA 3T1VA 4PAOA 1U94A 2HCBA 3OESA 2GETA 4G5SA 1I2DA 1KDTA 4PC7A 1IY2A 4KYIB 2NTYC 2A5JA 4Q1BA 2QAGC 4IVPA 3VU9A 3MCAA 3SC3A 3REGA 4RSGA 3KTAB 1QHXA 2ZU6A 4M0LA 4DKXA 2VP6A 2FSGA 2HCJB 3P32A 4Q03A 1NVUQ 2G0TA 3TRFA 2BKEA 5GJVC 1E99A 5HCNA 4TL8A 4JLKA 5C4GB 821PA 2IYYA 1NVVR 3QEJA 2FNAA 2FOLA 4IXMA 5DE3A 3SS8A 1NLFA 2G1KA 2PL3A 5BN3A 1C9KA 2FSIA 1JBKA 1KO1A 2BMEA 4IJMA 4GL2A 1V43A 1NVVQ 2IYTA 4PAMA 3JVUA 1Z0AA 3DMNA 3HDTA 5EJEA 4AY2A 4HLQB 2R6FA 3ICEA 4G5OA 3SHFA 1AS0A 1AGRA 6Q21A 1DAMA 4PTLA 3U7EB 2P65A 3EZ9A 2REOA 3R20A 2QG6A 1Q1EA 2IW3A 2ZU0C 3U6KA 4AK9A 2YWFA 2OXRA 1TNDA 4D81A 1UEJA 3LO5A 2QM7A 1KDPA 4DEXA 3SDZA 2IYSA 5CDFA 2ZXUA 1K6MA 2H92A 4Q4LA 4RJLA 4TZ0A 1Z5ZA 2A7QA 4US2R 1X8LA 2AR7A 3Q7PA 3GLFB 2BKUA 4AWXA 2WJJA 4DEYA 4KSCA 2ZI6A 2I3BA 2NPFA 3CH5A 5K8TA 3V9PA 4Q5IA 4BGDA 5D3MB 3CPEA 1KIMA 2QAGB 5FPTA 5EP2A 1CR4A 1E79D 2GZAA 4A92A 5EXXA 2IA5A 3OFND 4OQMA 4URVR 5EUQB 4EQ6B 1EWRA 1IN7A 1Q21A 4MRNA 4PQYA 4MGKR 3ZGXA 4ABYA 2DFLA 3LBIA 3EPKA 1ANKA 3CM0A 4JZKA 3LAWA 4JLJA 4ACBA 2G6BA 4DDUA 5AK0A 2DPXA 4AKIA 3U3JA 1JNYA 2VHTA 2QTVB 4JBXA 4B3FX 3U4QB 1OXTA 1AQUA 4RD2A 5ANRB 5FI0B 5JS7A 2C04A 4HLUA 2CLCX 1NLZA 4Q01A 4AURA 4ITRC 3KQUA 1KOFA 1F2UB 4L4UA 2BBWA 1J8MF 2CHGA 3UANA 2JCSA 4HDCA 1VTKA 3VR3A 3HYTA 4P4SB 3BAFA 4B48A 4LZZA 3KTAA 3FHOA 2IK8A 3TIFA 3NEJA 1CP2A 4BFXA 2UVQA 5BQ5A 3MJHA 2BBOA 4Q7MB 5J4YA 5TV2A 4L5BA 2GA8A 2XTMA 2XTZA 1U8AA 1D2MA 1ZD8A 4KFSA 3GJ6A 1G7TA 1I4LD 1MO3A 1L4YA 1WCV1 3VR5A 5KSYA 1DPFA 4KU4A 2J41A 1G5PA 621PA 3H86A 3GJ8A 4B2PA 2ZS7A 4DLVA 1CIPA 1CF4A 2WJIA 3LA6A 4JL6A 4IDPA 2KJQA 3WHKA 2QP4A 2QE7D 1MO6A 3FTQA 4TYQA 2PEYA 3PFIA 4PO9A 1VCOA 5JECA 1CR2A 2B7BA 3UATA 5G3ZA 3K0FB 5HCIA 3LV8A 2IWHA 1OFIA 1QHNA 2ZRGA 1AK2A 1XCMA 4YDSA 5KO2A 1G8GA 3RYTC 2AK3A 3GMTA 3QUSA 1L7VC 5IHPA 1SXJD 1H8HA 3EIEA 4PAQA 4BLTA 2GILA 5E7JA 5IK2A 4BFVA 3ETLA 3ZVRA 1Z0IA 4RD6A 3ZJYA 3TK1A 2J0QA 2IC5A 3GLFA 2CMKA 2XAUA 3VHXA 4DXAA 1TL7C 1AKEA 1EGAA 4BASA 4V0NA 2DCUA 4LV8B 3UG7A 2TMKA 3T06B 2R9VA 4DB2A 3Q5EA 5D3MA 5J4HA 1R2QA 3PVSA 3X1YA 2ODWA 4US1R 2HXYA 3Q8XB 4IFEA 4EQ6A 1GL9B 2ZJBA 4EIWA 1J7KA 4Q4AB 2RH5A 3H84A 5FTNA 2OAQ1 3MRSA 4GNKA 2GCPA 4XWKA 2C8VA 4U02A 5TVKA 1M7HA 4V0KA 4DLXA 3D8BA 3QEOA 4Q4JB 2H57A 1A2BA 3U4QA 4ASUD 2WOOA 4FD2A 2GAAA 2QP3A 2V6IA 5JEDA 2PCJA 1JXOA 1N2CE 1XMIA 3E5HA 4I1OA 1V5WA 4HUQB 4GZLA 1DBSA 4CGZA 1X8KA 4Z54A 3F5FA 1F2UA 4RCYA 1ZP6A 1GVNB 4R7ZA 3B1ZA 5KTYA 2IYZA 4O2LA 4RFVA 3PUZA 1VDZA 4P4SA 5AUPB 5L8VA 2JIZA 2NIPA 2WJGA 4GRAA 4IEEA 2CDNA 4W5JA 2D3WA 3WMFA 4NYMQ 1XXHE 2VEDA 3KXIA 4JT2A 5FBRB 4KFUA 1XX6A 1IN6A 2IXEA 1PV4A 3SBDA 4KITB 1U9IC 4EPRA 2BV3A 2ONJA 3UWOA 4B3BA 3A1TA 5CYPA 2OESA 3W6PA 4GT1A 4C0SA 2R6AA 2O8BA 1EFTA 1E2EA 2G1JA 2H8KA 1DE0A 2JAQA 3GJ4A 4LJ5A 1XFAA 5BXQC 1ONBA 1IONA 3U44A 2G0NA 2WM9B 1NMXA 1JR3E 1R0WA 1ZRHA 2QNRA 5H70A 4B34A 4DZZA 3ASZA 4KLNA 1KI2A 4TMWA 1N0WA 2ZETA 3EW9A 3AUYA 1UADA 4JLVA 1YZQA 1R8QA 3AF1A 4HAXA 3WMEA 3K0FA 2CK3A 1DAIA 3PUXA 1YU9A 4MYTA 3GEHA 5C1BA 1X86B 5H1YA 5HKKD 3K9GA 3FHTA 4EKDA 1N6KA 3SJCA 2ZUCA 5F9HA 2A5GA 5E7IA 3SOPA 1VYVA 4M1OA 3RNLA 4JIMA 2ZYUX 3WYFA 1BMFA 2IF2A 1LV7A 2VHJA 3DM9B 4GOJA 4H9GA 4PO1A 1XCGB 3ADCA 4DC9A 2JASA 1NN0A 3OAAD 1J70A 1GDDA 1WF3A 2VRWA 1W5SA 3QBVA 2VSFA 1CJMA 1K5DA 1H8EA 1KSGA 1CKEA 3E1SA 3ZZUA 2O8CB 5D3QA 3OHMA 1FTSA 2WJVA 3B78A 1GILA 1NRJB 3U7FB 2DWOA 2NO6A 1P2SA 2LWIA 2ZE5A 2RGNC 1NSFA 4XWOA 2DFTA 1YVDA 3IEVA 3CB4A 3AVOA 1A4RA 2QROA 4WZ6A 3RS4A 2KSQA 3AF3A 4ZCMA 1ZM2A 4HUQA 2JEOA 1NL3A 1HH4A 4OI4A 3ADDA 4Q02A 2RHMA 4FMCF 4G3XA 4XSHA 1S4QA 1UBCA 1TF2A 3ZVNA 2RB4A 3LQQA 1I4DD 1SVLA 1XTJA 2DWQA 2DYKA 2YOFA 4PHHA 5DSZA 4ZDIA 3GFOA 4HUTA 1RVDA 2ZR7A 1FFHA 1QG2A 1ZUNB 2XTNA 1LW7A 1IY0A 3CWQA 3QNUA 5JJIA 3QF4A 3P27A 1N0UA 1P73A 3OEED 4A2QA 4HAUA 4LBVA 4X8HA 3C8UA 5KNBA 1G41A 2B8TA 3HPQA 5DHFA 2FFQA 2CVHA 1Z6AA 1E0AA 3DKPA 1E1QA 2HLDA 1XRJA 1VYUA 4US0R 4B73A 1F6BA 3CONA 2ZR0A 3LDAA 1UKVY 1XD9A 3CH4B 3PUWA 4JVSB 4POAA 4ZKEA 2FEOA 4PHTA 4BUJA 3CX6A 2ORWA 1L2TA 1XZQA 2CLSA 2WJHA 5GJWC 1FOEB 2XB2A 2JLRA 4YONB 4YQFA 1G291 1I2MA 5FI1B 5GJBA 1AJEA 2O8FB 5FPKA 1GL6A 4BLOA 1Q44A 4H1UA 1TEVA 3RWMB 3SJAA 1Z08A 3NH6A 2GEVA 1E4VA 1DO0A 4IHQA 1OE0A 1G20E 4O3MA 4RY2A 1GG2A 5IF9A 3ZD6A 2NZJA 3M6AA 4JYBA 2VF7A 1CR0A 3UMSA 1LFDB 3JZAA 3SYLA 2IX3A 1SVMA 1LF0A 5CK5A 4PQFA 1EFUA 1KDRA 1HEIA 2ZRAA 5EP3A 2F9MA 1JB1A 3WYGA 4PR0A 3DL0A 1N0VC 5A0FA 5BN4A 2O8CA 3T35A 1X1RA 2CE2X 1Z2AA 3IIJA 5EXTA 2R8RA 5LD2C 2ZYWX 4CT5A 1Z29A 2FV8A 2PLRA 4QC2A 2P2LA 3HWSA 5FL7D 2W6JA 1SVIA 5TXGA 1RYFA 1U9IA 1TU4A 1DELA 2VIIA 1BS1A 3GCGA 2G83A 1CTQA 5TY0A 1Z83A 3GEEA 5DYGA 2WOJA 3T5GA 3HU1A 4QBHA 4A0FA 3R9WA 1HQYE 1RKBA 2WV9A 121PA 3KJHA 4PC6A 5FBVB 2BC9A 2XZLA 1NKSA 4B44A 2OBLA 2JDIA 5L3QA 4JJZA 4TLBA 2R6DA 4PQRA 4D6PA 2OT3B 3GJ5A 3OE7D 1SQ5A 4MYUA 1XU4A 1ZVQA 4EFNA 4YC7A 2IT1A 1G64A 2A9KA 4NCHA 1HTWA 1VG0B 4O2RA 2QP9X 2QL6A 1N6OA 2GKSA 2ZRDA 1AZTA 4URWR 3BWDD 4M53A 1N6HA 4OJKA 5J4KA 5FTLA 2QMEA 4F91B 5DI3B 2VH5R 3OIVA 4LC1A 2AX4A 4C4PA 4IXNA 1R5NA 2PMDA 4LC0A 4JSTA 3T15A 1MRNA 4CEJB 4B32A 2HT1A 3B2EA 1QBKC 4P32A 3QPWA 3VX3A 4B43A 1PVOA 1E9RA 2QPOA 4C0AC 5FTKA 1IN8A 3BIFA 3K70D 1N5KA 1IXRC 5AJVB 3U61B 4XH9B 4PC1A 3IEUA 4LJ7A 4EDHA 5LD2B 2E9SA 3NDBB 2NZ8A 2GDJA 3FMFA 1ZAKA 4FMCB 3B9QA 4Q1FA 5ELXA 3FMIA 3CW2A 2RGNA 2P0EA 4L9SA 2RGCA 3BFKA 3TSZA 5JMTA 1GZSA 2ZI9A 2ZRCA 3RAPR 3SHWA 5AJZA 5G41A 2V7QA 2QGNA 2WJYA 2VBCA 3GJXC 4LBYA 3DHWC 4HB2A 4UNQA 3WMGA 2OFOA 1UKEA 3CLVA 4I4LA 4YLGA 4B2IA 1OH7A 3EZFA 1YHNA 4B2LA 3GFTA 1E32A 1O87A 2F1RA 2JGNA 3L0SA 4IDNA 3B85A 5BYJA 1DG1G 1F2TA 5C2JB 1CXZA 1XXHA 2W2TA 1A7JA 1FQJA 1EFCA 3QKRB 2F3RA 4F4JA 1CBUA 3Q9LA 1XEWX 4P33A 1DEKA 1WBDA 1ESNA 1Z28A 1D5CA 1PUIA 4D0GA 2AHOA 1VG1A 1B0UA 1Z63A 4DWJA 4GSYA 1QHSA 4GMXA 2BM0A 3GPLA 2ZI5A 4FMBB 2ERYA 1G1MA 4S2EA 4XJXA 3U3KA 4M21A 1XMSA 5LDDC 2ZUBA 4EPVA 1F48A 2EFHB 2HJGA 4IOJA 3LD9A 3KQKA 4DJTA 2ZVPX 4FCWA 2O0KA 4NCJA 2OCAA 3RVBA 3P26A 1KNXA 2HJVA 3BE4A 4MYCA 1OYWA 4TQAA 5BYKA 4TMVA 1HA3A 1YKSA 3AP3A 3EC2A 5EE1A 1ZNZA 2MSDB 3B5JA 1M34E 3K1JA 3MUFA 2LKDA 3ICQB 1Q1QA 1Z0DA 2EYUA 2H16A 4LK2A 3GJ7A 1BYUA 3QG1A 2ORVA 4MRSA 4HATA 4KBGA 3D31A 2BMJA 1CR1A 4CZ2A 4D82A 5SZJA 5KDLA 5HPYB 2RMKA 1AA9A 2IXFA 4ZKDA 2AXPA 3W3ZB 4JVNA 4MKIA 4LHVA 2XITA 5HR5A 4UXHA 1GNRA 4LDJA 5J4VA 2GF9A 2IEZA 1DADA 4E03A 5A4JA 2ZAMA 4LGMA 4N0DA 1KJYA 5FPSA 4A9AA 2V3CC 2GHIA 1NVWQ 1GAJA 4B3CA 2P6RA 4JLOA 3G0HA 3E70C 4NCKA 2BBTA 3MJRA 4L9WA 4D0LB 2WWYA 1W49A 2NO9A 3FYHA 3K09A 3B1XA 2JLXA 1ZM9A 1OLOA 2UZIR 1X3SA 4MKGA 3ZH9B 5GADl 1P2VA 2OFXA 4X8LA 1KKLA 2CEAA 2VP4A 4BLSA 4CEHB 3TR5A 3CRRA 1H8HD 3BERA 1ZINA 3WYAA 2FSHA 3T1QA 1Q1ZA 5JI3E 5IK2D 1VIAA 3IIMA 4Q47A 2IYLD 3QG5A 4L15A 4TTRA 1NG9A 2UZ3A 3TSOA 3A4NA 5AUOB 4U5XA 3W8RA 4TWZA 5JCPA 2VSXA 1U99A 2W83A 5G3YA 1QHIA 3PIRA 3TVDA 3THYB 2XJ4A 3THWA 3EARA 3DO6A 4TT3A 1EESA 1RJ9B 1GP2A 3I61A 2IXGA 5J5CA 4Q66C 4TTPA 4DCTA 2AL7A 3MSXA 1EK0A 1BO6A 1E9SA 1XMVA 3IO5A 4HLDA 4JJKA 4QXAA 3THOA 4B76A 1Z8FA 1S8FA 2FSFA 3KKNA 1WQ1R 2R62A 3KUDA 2PT7A 2WIBA 3RS5A 1G21E 2QMOA 4KI0A 1UBGA 4V0LA 5DISB 2N42A 2XNDA 1QRAA 3QPUA 4A2PA 2ATVA 4L8GA 3L8ZA 4I1UA 2B92A 3EZ6A 4RFSA 5E7MA 3CX7A 2FMXA 4P4UA 2ZJZA 1ZC4A 5JFGA 2GJAA 1XTQA 3WBKA 3X1XA 4C0JA 2JIZD 4TYYA 1MV5A 3B7GA 4P31A 1NIJA 5SZHB 2WICA 2ZSAA 3BFXA 4Q4HB 2Q3FA 3VR6A 1PZNA 3UXMA 4C3ZA 1Y3AA 4DDTA 2XOKA 1ETUA 4F7WA 1U2RA 2IUUA 1SVSA 1RE0A 3BB3A 4TSFA 4LHXA 5FL3A 3X2SA 2QMUA 4LV6A 2VP0A 4DLWA 1OXSC 3T12A 4A0GA 1TF7A 1YZKA 1QF9A 4LJ6A 3AVVA 1KNQA 3CRVA 421PA 4EFMA 2P6NA 2Z4SA 5KPDA 1FP7A 4AKGA 4YMUA 3BB4A 4ZCIA 1RW4A 1W36C 3FFAA 2PZEA 4BWYA 4TL7A 3FPAA 3A1WA 1OXVA 1PLJA 5FPYA 4DVGA 3JZMA 1P9WA 2CK3D 2Q6TA 1M1YE 2GVDC 3TH5A 4NP6A 1GKIA 1W4RA 2VHUA 1XJ0A 4JLPA 3A36A 2GZHA 4GP7A 221PA 2EU8A 2REXB 1AIPA 2X77A 4A1FA 5JSZB 4AYWA 2ZR9A 4BFUA 1JPNA 2WAYA 1XB2A 1MKYA 2J1LA 2EQBA 2RAPA 4TTQA 4MYHA 4CIDA 1BMFD 3UMFA 3QXCA 2QT1A 2R44A 2J0SA 4ZI3A 1KO4A 5FOSA 5F98A 1E4YA 1DAKA 1KAGA 3U3MA 5KYKA 3THYA 4GDFA 2FFAA 3BB1A 2C9YA 3K9LA 1H8ED 1ZD1A 2CCJA 1KSJA 2D7DA 4EPTA 4MUBA 1AS2A 2GBLC 3LQRA 3RRMA 2QMHA 3TLXA 1VMAA 1S0UA 2KI5A 1TQ6A 3NKVA 3FMOB 4OI0A 1KI6A 1U90A 3AH8A 4M2LA 2QENA 3CRQA 1HE1C 3Q7QA 3C16C 3V4FA 1FUUA 4DRZA 4GBMA 1U0JA 3LBHA 3DM5A 1ZM3A 4B71A 1Z0JA 3EWSA 1T3HA 2BJWA 2X2EA 2ZAOA 5KHOC 4ARZB 1E0JA 2SHKA 2ZYTX 3WNDA 3NBYC 3AB3A 2ANBA 3W9YA 1HY3A 3R7WB 4CYMA 4C30A 1T8UA 4QKQA 3W6OA 2YJTD 1W44A 3QKUA 2UKDA 5JRJA 3AVYA 1W36B 2IS4A 3I92A 1Z6XA 4EJSC 4IOKA 1KMHB 5J4LA 4G01B 4KLZA 4WIAA 4QGFA 4Q4HA 3GEIA 1SXJE 3W34A 1G8HA 2F3TA 4EPXA 1R7RA 4QNRA 1E2KA 3IPXA 4ERNA 1SVWA 2NOAA 2VYFA 5GJCA 1OYYA 1W0KD 2YKGA 4A0RA 2RHDA 2HLDD 4PC3A 1HURA 3C15C 3B8HA 1IJEA 3I3SR 1IY1A 5JJLA 1GSIA 3EC1A 2OAP1 4KHZA 3WP0A 3DEFA 3AVQA 1N6PA 3N70A 4NDZA 4IDHA 3CUEF 3GJ0A 1OXUA 1Z0KA 3BOSA 3QPVA 1E2MA 2GRJA 1GRNA 1G4AE 1S96A 2Q9CA 4DIEA 3A1SA 4BFYA 4CVNA 3DKVA 1ZC3A 1LF5A 2AWOA 4BZPA 1DAEA 2VHCA 2W58A 4OHWA 4XD7A 4B6EA 4ZV4A 4F93B 2J7PA 3KZ1E 1W2GA 5G53C 2G88A 4CEIB 1OKKA 3F3YA 1DAGA 2IYQA 5JSZA 3W3AA 4JKIA 3N2IA 4PPQA 2ZRKA 3SQWA 3KX2A 3O8DA 3BH0A 1XNJA 1T3LA 4HB3A 3F8TA 1W4CA 2IUSA 4Z51A 5BW8A 4IKEA 3DVLA 2YVUA 2EW1A 3GQBA 4JMPA 4KXFB 1G5RA 2GXUA 2WIAA 4F4IA 1S9HA 4KV9A 1X6VA 1J90A 1JQLB 4ON9A 4F92B 4RD0A 5DH9A 3TBKA 3VNUA 3L0PA 2GJSA 2BM1A 3MLEA 1GRRA 1NNEA 2QAGA 2X19A 4OKSA 4EJSB 3H1TA 1JEEA 2A30A 5CJPA 3QSYA 2GJ8A 2YOHA 3NXSA 2CHVA 1Q57A 1YZLA 3GLGE 2C78A 3WRXC 4C2UA 2IS1A 3W5JA 1OH5A 3R7WA 4MKFA 1E1RA 2KE5A 5UKDA 5B64A 4R2IA 5F9FA 2JDID 3CNLA 3OEHA 5FOUA 1M6NA 3A37A 3SYKA 4UQOA 4LHWA 2WTUA 2VA8A 2WKPA 3IHWA 1D2EA 1A5TA 1KMHA 1NBME 3HR8A 4RZUA 2WPDA 2IS6A 4QJ5A 2CNWA 2IYVA 2WWIA 4BLRA 2QQEA 1VHLA 4A4DA 1KGDA 1D9ZA 1SXJC 2QBYB 3M0EA 4O25A 4OK3A 4LY6A 4DLUA 1VYTA 4CDGA 1ZM7A 3KL4A 1DTSA 3PEYA 1W7AA 2OE2A 3HP1A 3ZIAA 2ODNA 2PBRA 1ZW6A 2V1UA 2O8DB 1E2IA 4GMDA 1S3GA 3NIBA 4M9XA 1G3IA 4UNNA 1WBBA 1Z0FA 1E96A 2ZJ5A 3ASYA 4XVQA 2JLVA 3QVUA 3EAQA 2Q9BA 4QBIA 1UAAA 1QHHB 5FBWB 3CPHA 2ZJYA 4W7SA 1OIWA 1N25A 4LYJA 2R6CA 1TPZA 3LW7A 2F9LA 2LCFA 3DMDA 2BCJQ 1U0LA 4IW3B 5FUWA 3KKMA 5HZKA 1T5LA 1W0JA 3C5HA 5EE5B 3PXGA 2GBLA 2V8OA 4M1MA 4YMSA 4BFZA 3KUCA 5JI2E 3FB4A 2G9NA 1GNQA 2ZRPA 4WXPA 5P21A 2ZS9A 1OH8A 3RANA 3K53A 3SFZA 3HU3A 1VPLA 2D2FA 2XXAB 5CITA 4GP6A 4IEIA 2IS2A 2ZRHA 4DBLC 3ZS9A 1U0HC 3QKSB 4PZYA 3OIYA 2WWWA 2V7QD 3K0AB 4DUGA 5TMPA 1KYIA 4M1WA 1TF5A 1DAHA 4M1YA 2L0XA 5FUYA 1HYQA 2CJWB 1Z6YA 3CPJB 4DDVA 2IEYA 2FZ4A 2YWGA 1G3QA 2XNSA 4EAQA 5G40A 1DAFA 2P67A 4OHYA 1W4AA 4Q7LA 3KQLA 4D26A 2HDNB 3SJZA 1Q12A 1ZJ6A 2WSSA 4Q4AA 5AJXA 2XZPA 3U3RA 2OO7A 1SXJB 1BH2A 3CX8A 1KO8A 2HF8A 5F2EA 4UXJA 3KQNA 2ZVQX 3LLUA 5CLQA 4Q4JA 2IYWA 3HR7A 4Q21A 3TQCA 5M04A 3LVRE 4K8OA 1LTQA 2A5YB 4TMKA 3A58B 1JQJC 3KB2A 5SZKB 4D25A 1T4GA 3CNOA 4JKYA 1DO2A 1KSFX 1NJGA 4GPTA 4JYCA 4R2HA 3C41J 4Q9HA 5JCZA 5KSOA 1F5NA 5FBQB 1NN3A 4NZYA 4XVRA 5FFMA 2VO1A 2BMFA 2ZYVX 3KKQA 4PPGA 3OIWA 1TQDA 1NI3A 3U5ZB 4WA7A 2FGKA 3DPUA 3N2EA 4LBWA 1TQ2A 2ZRBA 3A4MA 3BFVA 2H17A 3RABA 3MWYW 3CO5A 4OK6A 3FFBA 1SVOA 4Q48A 2NMVA 1T6NA 1XWIA 4YMWA 4HEJA 1R6BX 3PCRB 4QM6A 4QHSA 5DGXA 1GKYA 1CULC 5KSPA 2JJ1D 5DIFA 4M9ZA 2JLYA 2YYZA 2A2ZA 4QRHA 4URUR 2C03A 5KNDA 3EZ2A 3PR1A 3G82C 2ZRNA 2C77A 4AKHA 1L8QA 4Q9JA 3T5DA 4QGAA 1RRFA 4G1UC 1P3JA 2YOGA 4Q9KA 3P20A 3KFVA 2RGEA 1KI3A 3AGQA 4OQFA 3U3OA 2HEIA 4JBWA 1JR6A 4Z1MA 3SR0A 2QRZA 2WSMA 3LXXA 4ZIRB 1KDOA 1OHHA 1E2GA 2KWIA 2XXAA 4ESVA 3EA0A 2C95A 4MGYR 4Y0AA 3WP1B 3RS3A 3QKSA 1T5IA 2OBMA 1AKYA 1AGPA 3D6TB 4WBSA 2GESA 3K0AA 4A8JC 4LPSA 3GLGB 3M1IA 5AUQA 2OM2A 4C0BA 3AM1A 1UM8A 1FZQA 2BVNA 4HYYA 4DSNA 2VF8A 2QE7A 1XTRA 3BXZA 3TUZC 1KY3A 4Q9IA 1P9NA 4QG7A 4TT3D 1WMSA 4LHYA 4UJ3A 5FTMA 4DLYA 2V9PA 5JJKA 3K9HA 4CT4B 1NP6A 1E2LA 5CLLA 1XTIA 2AD1A 3FGNA 2NG1A 4ZO4A 4R9UC 4DDWA 4Q9LA 4P4TA 1M2OB 2ZM5A 3VTKA 1EX7A 4NCIA 4HZUB 4C0HA 1SVKA 2GJKA 1P9RA 3D3QA 4HDOB 2D06A 4TYNA 3I5YA 2XNDD 4LSGA 4FIDA 4Q1DA 5HE8A 5A5GA 3SN6A 2QY9A 3CRMA 4MRRA 2OFWA 2VP5A 3IBYA 3LY5A 4Q1CA 5KUTA 2F7SA 4TQUS 2NO7A 2HYDA 4HB0A 2KBFA 1WDTA 2H18A 3O8RA 1KO7A 1NKTA 1OFTA 4V02A 4B75A 1W2HA 4BRWA 1XEXB 2WMOB 3C14C 3V00A 1A2KC 3WRYC 3PUYA 1SKYE 3ZVLA 3C5CA 4XOIA 1FUKA 2OSBA 3ZZ0A 3OIUA 5EXPA 2CVFA 2QSYA 3FMPB 4TSFD 1T91A 3N5CA 4AG6A 3RC8A 2OG2A 3VR1A 4NPHA 2JJ2A 3IUYA 1RRCA 4AG5A 2DWPA 4IVQA 4A8JB 1E9EA 2BEKA 2C96A 2OCPA 3U6BA 2BDTA 4HI0E 4IDOA 4NCNA 2RCNA 3FHCB 5FBLB 1YZUA 2GEDA 2O8FA 1F60A 2OV2A 3Q5DA 1KSHA 2QEQA 3KXKA 3FVQA 1JEDA 2P6UA 2AN9A 2GCNA 3L82B 1NY6A 4YXWA 4D2IA 4ZIRA 1N3BA 4URYR 3E2IA 2IWRA 5E4FA 4HDQB 2ZTSA 1YE8A 1U98A 1GNPA 3KKOA 4M4SA 2JLZA 4E5UA 1G7SA 2W0MA 3AQ4A 2OXCA 3AKEA 4B74A 2V6JA 4FW9A 2PEZA 4J0QA 3MWLA 5FUVA 1TUIA 4DCSA 5AJYA 3H2YA 4HB4A 4FINA 1R4AA 1JAHA 3CF6R 2PJRA 4MDFA 1S1MA 4H1VA 1KMQA 1RIFA 1W1WA 1KK3A 5FOWA 1NBMA 2XEXA 3AF4A 4QGHA 1D8TA 3UPUA 4A82A 1KI9A 1QG4A 2GVZC 1ESMA 1UKZA 2FU5C 2Z4RA 4OK5A 4AD8A 5CIWA 2YINC 3FWYA 1UF9A 1TMKA 1VCNA 2V1XA 4HZUA 8OHMA 3W8NA 3ONWA 4KFTA 2PJZA 2FE4A 3NBZC 3QXJA 4RD4A 721PA 5GVSA 4NE2A 2J5XA 2D4HA 1EG7A 2ZIAA 2FEMA 1W5TA 2CL0X 1OSNA 2DY1A 3O47A 4HAVA 1Q20A 2YNMA 1NF3A 4Q1EA 3VKWA 3RSOA 3IKJA 3G5UA 3UIEA 1U8ZA 3QE0A 4MGZR 5L3RA 1Q1BA 1TUEA 2QORA 1TADA 1YRAA 3OAAA 4URZR 2EYQA 5CYOA 1KKMA 3P1JA 4Z8YA 5B58C 4QM7A 2WWXA 5B2ZA 3TQFA 4DCNA 3IGFA 4OJQA 3QENA 5JWRA 1XEXA 4GFDA 1JR3A 3OF5A 3QKTA 4P0TA 3W6NA 2IF0A 2QPAA 1ZD9A 2PZGA 4PPNA 1TU3A 3P4YA 5JHHB 2H1LA 1PUJA 1WB9A 3TVTA 3AF0A 1JXMA 4LYAA 1MT0A 3EPJA 1M7BA 2ZJ8A 1KJZA 3SU8A 5JWOA 1G6OA 2LKCA 2FFHA 2J7KA 1NLYA 1XD2B 3CRW1 1P2TA 4E09A 1GIAA 4BZQA 4MGIR 3X1WA 4C7OB 3UWKA 4N1AA 3IO3A 4FWIB 4C9BA 3I62A 1CJKC 5DI3A 4A8JA 2ZRFA 3AKDA 2VL7A 4CEJA 2F1JA 5AWFC 4URXR 3PEUA 2Z43A 4V0ME 5TARA 2ZQ5A 4RVCA 4GOXA 4XD7D 3VR4A 3VHLB 4FXPA 4E07A 2ZJ2A 2WVJA 1G8YA 1LB1B 1QVAA 4A15A 2J7PD 4OQNA 3L8YA 2BMDA 4PHGA 3AVTA 1KK0A 1CEEA 3CR7A 3AVWA 1G9XA 2FGJA 4W5WA 1OKKD 4KJZA 5K8LA 1KO5A 4D80A 4UKDA 3PITA 2GJ9A 3BC1A 2PLFA 1GTVA 1GRQA 3RS0A 4DCUA 1XPUA 4G5QA 2ZE7A 1RZ3A 1Z47A 2QTFA 3BJIC 1VG8A 4HLUC 3QXHA 1XP8A 4NONA 1NVXQ 2MMCA 3QXSA 2QGZA 4R71A 5JZVA 3EA5A 4M1SA 4ZI2A 3NHBA 5CK4A 2FPMA 2QU8A 5CJ2A 4ZCLA 3TUIC 3ADKA 1ZUIA 2FA9A 2C98A 3ND8A 1NY5A 2E1RA 3U7HB 3LX8A 2N46A 1R8SA 4L16A 4XWAA 1KZGB 1AN0A 1E2FA 1N6RA 3F0TA 3QKRA 4UXIA 3RSLA 3TNFA 4LOAA 1SKYB 4B47A 1TEXA 4Q19A 2ZI4A 4RD3A 1Y63A 3GLIE 5DYIA 2DB3A 4YMVA 1IAQA 1X8JA 4O0MA 1KHTA 2IHBA 5CIQA 4A0HA 3AVXA 1GWNA 4CEIA 4OQLA 1E1RD 1O3YA 4D4MA 1HE8B 2BIFA 2R6GA 3NH9A 1OPXA 3OEHD 3FDIA 4NH0A 2JATA 1EFRA 4TL6A 1Q22A 2WWGA 3HJNA 5KOYA 1DVRA 1N6IA 4CW7A 2WZQA 5FTJA 1W46A 1TAGA 2WPDD 4QGGA 3W5IA 2ZSEA 2CNWD 3Q3JB 4BE7B 1COWA 1DG3A 2GAOA 3ZVMA 4LHZA 5DN6A 5EP4A 1VKJA 5J40A 3PEVA 5TDHA 4LCBA 4XVUA 3K9NA 3VFDA 1U8YA 1MO5A 3LWNA 3ADBA 5JS8A 4BPBA 1GL7A 2MMGA 1XTKA 1UKYA 4PSVA 1XD2A 3MAAC 1G19A 2YZ2A 1IXSB 2PCLA 3DOEA 3VQTA 1E0KA 5EE3A 3R8CA 3VAAA 1R0XA 2Q3HA 3DZ8A 1IOZA 4MRPA 4LJAA 2F43B 5HTKA 3LNCA 3B13B 1CU1A 5CM9C 1ZUHA 4QJ3A 1KI8A 2FPLA 1S9DA 3DZDA 4RD1A 2ZJOA 3OE7A 3EZ7A 1FQKA 2QPTA 2RKOA 4TZ6A 1RYHA 3LRPA 1W0JD 4Q7JB 3GP8A 3EPLA 1IQPA 3VKGA 5EXSA 2EFEB 4NL4H 1CJUC 3TKLA 5KDDA 2ZRLA 5FOVA 1QDEA 1FPMA 1E2QA 1AQYA 4CEHA 3V4RA 3A6PC 2O8EB 1MR3F 2R2AA 2VHQA 3CKLA 1MABB 3LXRA 4KO8A 4NYIR 4WVFA 2B21A 3X1DA 2G3YA 4F4CA 3VKHA 4GOKA 1YR7A 5KSZA 1S3SA 4Q00A 4OI2A 4I1SA 2E87A 3AF2A 2FH5B 3D7MA 4DUGD 5DLQC 1VIYA 4NYIQ 1Z6GA 4NBSA 1G16A 1G7CA 4G5GA 4KAXA 2ZREA 1JAIA 4RZ2A 5SZIA 4LJ9A 1Z22A 1RRGA 5CM8B 3AP1A 3THWB 1IXZA 1P72A 1G3MA 1RJ9A 4TLCA 1K8RA 4QBFA 1IBRA 2B8WA 1NMYA 2CBZA 1JALA 3K0CC 5IDVA 1IJFA 4WOPA 4TYPA 4TN1A 2WSSD 5DO9A 1QZXA 4MA4A 2OZEA 3C4JA 2WKQA 3B82A 2ASEA 4BFTA 1XEFA 4LYFA 3KFXA 3RS7A 1II8B 2PX3A 4FMDF 2FFBA 2B6HA 1M74A 1GFIA 2ERXA 1KZ7B 1G18A 1US8B 5FOTA 2QRNA 4OYHA 3ZYCA 2X8AA 2GZDA 3NTUA 1G7RA 1N5LA 3JVVA 2A3RA 1W48A 1LS1A 2GXAA 1P6XA 3TE6A 2ORIA 2JLSA 2GXSA 4BEBA 2JJ8A 4LJYA 3QXXA 4DIDA 1NSTA 4DLTA 1R5BA 3AP2A 4W5HA 5J47A 1BOFA 3TSWA 1OJLA 3SYNA 2IBMA 4P3YA 1M7GA 4TMTA 4MITA 3B1VA 2QSZA 1U81A 2C9OA 2ZITA 2QZ4A 1E2PA 5EUMA 3H4MA 2PH1A 4JVLA 4LI0A 2BBSA 4GZMA 1OV4A 2W6IA 1E1QD 1MOZA 1ZU5A 2F43A 2YHSA 4XTCS 4LPKA 3NC0C 4BEJA 2J45A 1RPZA 4BFSA 1GKUB 2OLJA 1EXMA 4G0NA 2NO1A 3IQXA 3R9IA 4ZDKA 1KJWA 2QQ0A 5K8UA 3I32A 3ZQJA 4IOLA 2GK6A 4NU0A 1Q0UA 1SZPA 4DLSA 3HPRA 1HUQA 3QY0A 1YQTA 2A5FA 4ILEA 5LBIA 3RRNA 1SHZA 1WA5A 1UPTA 2HYIC 2C2HA 2ZSDA 4EUNA 2FDCA 3T61A 4Z1MD 1E2NA 4DT1B 4R98A 2IHYA 2O8EA 1OHHD 1MABA 4M1TA 2J87A 4TLEA 1UEIA 2QI9C 2BEJA 3QOFA 1E9BA 2BJVA 3MGCA 5JLJA 2O8BB 2WHXA 3BD9A 3NC1C 2J0UB 5HE9A 2XZOA 2OCBA 2VP9A 3GLIB 2XGJA 4OL0A 1PLLA 2MSEB 3PV0A 4I99A 3FKQA 4OHZA 4RZ3A 3U44B 3TAUA 1G8FA 1T3SA 4RZXA 2JLUA 3SJBA 1OIXA 3L0OA 3B1YA 1ZU4A 3CNNA 2CCGA 4X8MA 5E95A 521PA 2YV5A 1R0ZA 4DLZA 4V03A 3KJIA 4FWTA 3I4LA 1VCIA 3Q72A 4U00A 2ZPTX 4UNRA 4JL5A 1WP9A 2O52A 4DCVA 4XSGA 4RKFA 1IN4A 3TR0A 3IQWA 2R65A 1MO4A 1OFHA 1UDWA 1E69A 2F1HA 3QI2A 1HT1E 2W6JD 1ZNWA 4IFBA 1II8A 1LY1A 1XD8A 1NN1A 1T9HA 1VHTA 2AXNA 2DR3A 4B33A 1US8A 2EFDB 1NN5A 3LW8A 1H65A 4JSYA 3U7GA 4HAZA 5JWHA 3M4YA 4ARZA 2P5TB 3CR8A 1C1YA 3QIAA 1G3UA 1E2JA 1T8TA 1ZCAA 1SGWA 4KVAA 3RRZA 2XJ9A 2EVWX 2XSZA 2ZRJA 2ZE6A 3KJEA 3RC3A 3FKSA 1X1SA 1UJ2A 1Z06A 3AVPA 2W2VA 1P5ZB 4LJ4A 4V0MA 4F38A 1AS3A 4DHEA 3AGPA 1YR9A 2NQ2C 5C4MA 4A6XA 4HSEA 4DSUA 5EE9A 4LJ8A 2WBLC 3WNCA 4QNMA 1YZTA 2D2EA 1UBFA 3UKDA 4ESHA 2HUPA 1XPOA 1S2MA 2CL7X 2YWEA 2NGRA 2HV8A 4PZLA 4W9MC 3PJRA 4HZIA 2FWRA 3H0KA 2JJ2D 3AVUA 3U60B 1IHUA 2CL6X 1E9CA 2GK7A 2H7VA 3AV0B 1TX4B 4NYMR 1E2DA 3P4XA 2FF7A 3IBGA 2C5LA 3UG6A 2P5SA 1KK2A 3T1TA 1OIVA 2FZLA 2JLQA 3Q85A 4BFWA 1FW6A 4OQXA 4N0EA 2Z6VA 1NG1A 4PSKA 4BRUA 5L3SB 3SBEA 5FH9A 4FMDB 4CF7A 1Q3TA 3RLFA 1Z07A 1J99A 3NBFA 5H8WA 1CS4C 1YZNA 2Q0HA 2OEPA 2ZRMA 3QF4B 4DT1A 3K0CA 4YXWD 4DB4A 2EFCB 2REBA 3EWAA 2AK2A 4YMTA 1FNNA 4MRVA 5JEEA 1W47A 5EZ6B 5FUXA 4PO8A 2J0UA 2FJUA 4B3DA 4QFMA 4TYWA 1P62B 3I8SA 4K81B 4FI3C 3GLIA 1KI1A 1JECA 5AJWA 4M9QA 1AZSC 1XJQA 3UMRA 4BECA 4WZAE 3IIKA 2H5EA 3SZRA 1EX6A 3L0IB 3WNBA 3J81k 3ZQ6A 3GLHE 2PMKA 1NBMD 3K0EA 3LX5A 1CLUA 1UDXA 3L43A 1E9DA 4IOMA 4EJSA 1OXXK 2I1VB 4EPYA 2CXXA 2BWJA 4YDHB 1BYIA 5BWMA 2XX3A 2WAXA 2O0JA 5FOXA 1FP6A 2ZI3A 2JA1A 2Q21A 4OHXA 4KODA 2ATXA 3T34A 2IYUA 4LUCA 4ACAA 4M1KA 1G8PA 1QHGA 2FN4A 3IHLA 1P75A 3HYRA 1YR6A 2EWWA 4LV5B 4NTZA 3RRYA 4BLPA 1JPJA 5AR1A 4DLRA 2IYRA 2OCYC 3AUXA 2GXQA 4MUAA 4C0LA 1XTSA 1JR3D 2OBNA 5DI9A 2WWHA 2Z83A 3MWJA 1VECA 4M9SA 1E3MA 2VPPA 4LBZA 1E79A 3A8TA 4AYXA 3CZPA 2EWVA 2ODBA 3OFNA 4DSTA 1T0JB 3GD7A 2QBYA 1L4UA 2VTKA 4JLAA 2HXSA 4JVMA 5EP1A 1GM5A 1LS6A 3CZQA 3RDPA 3QJYA 1G6HA 1VCMA 1BIFA 5KPJA 2HT6A 3K8YA 4WAUA 1XCPA 2QN6A 3VR2A 4A36A 3MWKA 3NDPA 3EG5A 2IYXA 1KAOA 4U7DA 2PX0A 4Q18A 5BN5A 2O8DA 2GNOA 4KCGA 1YJ5A 1RC8A 3S1AB 1UFQA 3CBQA 2X2FA 1CRQA 5EQTA 5L3QB 1G3RA 1QHHA 5L3SA 1OB2A 4X8OA 1OH6A 5EE0A 1HT2E 1KTVA 1OFUX 4LYHA 3TMKA 2FG5A 2QAJA 1ZM4A 3C7KA 4D0NA 3IPYA 4ZDWA 1ZNYA 2Z0MA 1Z6TA 1WRBA 4G5RA 4ZPXA 1SULA 4UNSA 1W0KA 2YC2C 4QJ4A 4WZBE 2QM8A 2V55B 1FTNA 3B1WA 2RGAA 2J46A 1T0HB 1EWQA 1E6CA 4E22A 4QHYA 4XIGS 4Y0VA 4QBGB 2ZJAA 1TTTA 4UJ5A 2W0SA 2JLWA 2ZROA 5LB4A 1OB5A 2RGDA 2D7CA 3IDQA 4GI7A 2BHRA 4CRWB 3MFYA 3VNVA 3OZXA 2AWNA 2KBEA 3KQHA 1MH1A 2CCKA 2RGBA 1SHKA 1N6NA 1ODFA 2DFNA 1WE2A 2QT0A 1XBTA 2CJWA 3I5XA 1ZMXA 1BKDR 2GEUA 3PG5A 1TQ4A 4JS0A 5C18A 1ELOA 2GWHA 3QQ5A 1E0SA 3BBPA 1S1CA 1P7CA 2ZEJA 4OBEA 4MDEA 3SE0A 3NEYA 4PX9A 3WXMA 4PFSA 4PANA 4M8NE 2B7CA 3I72A 4HAWA 4KSBA 3KXLA 1SXJA 4QOSA 5H68A 5B30A 3QVVA 3W90A 3SQXA 1XF9A 2YC4C 1FX0B 3AKCA 2O0HA 2DHRA 2V4ZA 3BGWA 2ZUDA 2G77B 1XEWY 2A5DA 4IRUB 3R9XA 1CJVC 4D4JA 2Q3MA 4NMMA 1EFRD 4ZDJA 4AYTA 1M8PA 1FMLA 1RRPA 3O8BA 4C0QC 3K09C 2XB4A 1COWD 1HV8A 2RGXA 4LRWA 2BOVA 4LX0A 5DN6D 1P60A 4JLDA 1YRBA 1F2TB 2V54A 3A1UA 3EXAA 1XXHB 4K46A 3TAHA 3VX4A 4N3NA 2J59A 3MMPA 4EPWA 5CDFE 3ZD7A 2Q9AA 4NYJR 3SNHA 3WBJA 1FL9A 4KYUA 2D74A 4S35A 2XOKD 4MQBA 1AM4D 2CE7A 4UNPA 3AEZA 1G5TA 2VQSA 1QVRA 5DHAA 5E3HA 1NIPA 1ZNXA 1NMZA 4ASUA 5B57C 3EX7C 4NYJQ 2Y8EA 1I4TD 4MH0R 3S1AA 3ND9A 1R5OA 4II7A 1GOTA 1JI0A 3BH7A 3BS4A 5AUNB 5F3WB 5IRCD 2AKAB 3KJGA 3RHFA 1OF1A 2FPKA 1G17A 3EIHA 1G4UR 1XJCA 1YR8A 1K5GA 1N5IA 4DSOA 3THXB 3QBTA 2Z5FA 2F1IA 2OLKA 3BH6A 5KDOA 5KU1A 1LNZA 5CB8A 2KB0A 3GLHB 4RCZA 1DARA 2GCOB 1P4SA 2F55A 4FN5A 1XDBA 3DOFA 1II9A 2J9RA 4WW0A 3WY9A 3VMFA 2ZS8A 4JLNA 1E94E 3TJZA 4TLDA 3CWZA 4BQSA 3PEWA 2VSOA 4Q1AA 3WHLA 4C0KA 3CF0A 4KVGA 3RWOA 1E9FA 3GLGA 2DBYA 3PQCA 5KNCA 1KI4A 3UK6A 1JJVA 1FNMA 1D6JA 3QF7A 2AD5A 3GFPA 4OI1A 4AI6A 4PSAA 4I81A 1N6LA 1OT3A 4HLCA 3ZS8A 4D4KA 2C99A 1OW3B 1ZBDA 5JRZA 1ZCBA 3IILA 2W00A 3U2QA 1KK1A 3BK7A 5HKKA 1PJRA 2ZE8A 4A6PA 1VG9B 4B3XA 2ZSFA 1F3OA 3DDCA 4JLMA 1FX0A 3NHAA 4JT4A 4OHVA 3RS2A 4Q7KA 4AC9A 4JLBA 3R8FA 2ZANA 1A82A 3T1OA 2ANCA 2P3SA 3O8CA 3I1FA 3SI7A 5L3VA 4TLAA 2F6RA 3SEAA 1SKQA 2OHFA 4KFRA 2CHQA 2W2XA 5HZHA 4B3GA 3PENA 4FCVA 1R0YA 4RKEA 1E9AA 3K70C 1FMJA 3NVAA 3LBNA 1NJFA 3EASA 1XMJA 4PC2A 3FOZA 3ZZTA 2J0VA 4EFLA 1IM2A 1Q3HA 4KBFA 1P2UA 4XTRA 1GUAA 4PPFA 5TB5A 5K8IA 2ONKA 3A1VA 2AFHE 4TQ9A 3FE2A 3MD0A 3L2OB 5LB2A 4QHTA 2OUKA 4BLQA 3EIQA 2W6ID 2ECKA 2YWHA 3GLFE 5JBQA 1W4BA 3TW8B 1GITA 4PZZA 3TGPA 4RFSB 3I8XA 1P61B 2VP2A 3KB1A 2ODEA 4JBYA 3THXA 2NO0A 5EZ5A 3X1ZA 1ZYUA 3LFUA 4C2TA 3LH5A 3VU9B 2ZI7A 3BRWD 3GLHA 2N1BA 5FR2A 4BZXA 3NG1A 1C4OA 2WWFA 3TW4A 5IT5A 5CB6A 2GCOA 1PLKA 1IN5A 1A1VA 4D4LA 1DS6A 2GF0A 2MSCB 2CLDX 2OILA 3OEEA 3LVQE 4PHFA 2QA5A 1RFLA 4QL3A 1KY2A 3I73A 3GJ3A 4FCTA 2DFKB 1MRSA 3HU2A 2K5UA 2WKRA 2BCGY 2JJ1A 1J8YF 4JL8A 4HAYA 1ZIOA 4MKHA 5FPHA 1E98A 4IVRA 3REFA 2A78A 1EFHA 4WXRA 1Z2CA 1UBEA 4A2WA 1D9XA 2VLIA 4M22A 3BORA 4NKRA 2IL1A 4AKEA 1N5JA 2FX3A 5JHGB 3K70B 3AKYA 4Z8XA 1J2JA 1YZGA 3CF2A 2RGGA 3ZLJA 2GTPA 2EFGA 1DOAA 3NWJA 2QUZA 4LWZA 3NBXX 1CRPA 2PZFA 3CIOA 2QTHA 1D2NA 2O5VA 3K0SA 1II0A 3ECCA 5C46F 5DNYB 1XPRA 1XZPA 4B35A 4TMZA 4B6FA 2ZSBA 1HQCA
chains in the Genus database with same CATH superfamily
1TCUA 3KB6A 4WK0B 5CTAA 5JSFA 2CYCA 1KTIA 3QFTA 3N75A 2XSZD 2GZSA 4EA7A 1Z3IX 1HZJA 1H2WA 2IGBA 4QU5A 4YRRA 5BNZA 5BYBA 2FPWA 1EVKA 5AM0A 1Z13A 3RIHA 1WXHA 3SQNA 1MZVA 3RVQA 3HJFA 1C4XA 3PR3A 3N2LA 2I1QA 4UBIA 5M2QA 2BFAA 3NV7A 3ZY3A 1E2HA 2ECQA 1E1DA 1N92A 5D2CA 4AZWA 1JV2B 4E13A 2PYDA 3QOYA 1ZIPA 5ABPA 3LIPA 2C9CA 4KXNA 2V7EA 1PWYE 1R0KA 2A9OA 3KDSE 3OEWA 4LIPD 4UU8A 2CXTA 2J31A 4OH1A 3ECSA 3TL2A 5L7WA 3UTCA 1M5UA 4W1QA 2I54A 4WZBA 2PT5A 5FR1A 3SF8B 5LPNA 3VYWA 4H7KA 1SUSA 1YXMA 3DE2X 3E7XA 3LLMA 4WA8A 1P29A 3ELYA 2CXRA 3HBAA 3V4LA 1GAQA 4P80A 1TB4A 4V0OA 4J2TA 4PAOA 1YOVB 3OG9A 1U94A 4EZIA 2WIGA 4G5SA 1KDTA 3VJKA 2JFXA 4PC7A 1GCUA 1Z4MA 2F90A 3VU9A 3RS8A 4U63A 3V34A 2IE8A 3L5KA 1JRLA 2UYCA 2O14A 4KDFA 4ZALA 1XQXA 2EW8A 2F4NA 3KTAB 1OLSA 4V0RA 4WUTA 3TF5A 4P93A 1NVBA 4XFDA 5BSRA 2VP6A 2JAWA 3P32A 1EUZA 4EENA 1XYVA 2WF7A 4ZT6A 5AKLA 3TRFA 2RSLA 5DULA 3T7IA 3K6KA 3MS2A 1E99A 3DOUA 4TL8A 4Q05A 3QEJA 4DM7A 5CD1A 1NLFA 3I1IA 2PL3A 4ZQCB 5F7ZA 1JMKC 1EXDA 2FSIA 2D0DA 1GZVA 4R31A 3LGXA 2JAOA 4KDEA 2L18A 3FJ1A 1W2WB 5FUQA 1T2AA 1M8JA 1G2QA 2IYTA 2RCYA 4PAMA 4E0BA 3KVNA 1H0SA 3DMNA 3HDTA 4G5HA 4PYIA 5EJEA 1BGWA 1P1IA 2JZNA 1YBFA 4X6XA 3O4FA 4D8UA 5EJ6A 4R4JA 2WFMA 2P8JA 4KO3S 4PZDA 3TFWA 4IJUA 4QUEA 3S2FA 1AGRA 1BGXT 3O92A 1AGYA 1DAMA 1VSVA 1MVOA 3II6X 3WZLA 1M6VB 4Q24A 4POAA 5AW2A 3R20A 4Q37A 4PYOA 1Q1EA 3U62A 4D5GA 4P2BA 4GR4A 1A9QA 4AK9A 3U6KA 1UEJA 1X1CA 3JYLA 4RXTA 3K72B 2EZUA 4QYSA 2ORYA 2J4FA 2A0YA 2O6LA 3GBSA 4HS9A 5P8WA 3WWZA 2AFHB 1K6MA 3R3YA 5DNUA 2Z5VA 4E70A 4RJLA 1Z5ZA 3A3OA 3HFGA 5C8XA 2E5WA 2XE8A 5JAMA 1LD3A 3DHYA 3H8VA 2C54A 2ISCA 3TR6A 3NGXA 3ZZ1A 5JALA 1X8LA 1FC0A 3Q7PA 1DPGA 1NAIA 2WAOA 1UZNA 2A4KA 3HUUA 2O3TA 4KSYA 3R7DA 1MC1A 2WJJA 3DDOA 2NPFA 2I3BA 1YNSA 2CMHA 3LUDA 4ZN6A 2NP6A 4NMLA 2ATCA 4NV3A 4I1RA 2QAGB 2YCBA 1C4KA 3DAOA 3WWOA 1E79D 2CLOB 2J9GA 3DE4X 3G2QA 2PH5A 4IJKA 5B3JA 5HFJA 1EWRA 1IN7A 4MRNA 1AZLA 3FCEA 2IIVA 3LBIA 4ZCQA 5L4SA 5BRNA 3HRHA 3PU6A 4EEKA 1Y48E 5C5DA 3CEPB 3I6QA 3IL2A 3AR5A 1TC2A 3G7NA 3LAWA 4JLJA 5HZMA 3EVGA 2XUZA 4AKIA 3T3PB 3LQFA 4ZO9A 2BGTA 3BGIA 5DYYA 5KVVA 4B3FX 2YFYA 3KLMX 4ARSA 4FFNA 4G9BA 4YNBA 3T7DA 3C6QA 5FI0B 3Q1KA 4QRDA 3RHZA 2HWYA 3GLRA 2CLCX 1NLZA 4HLUA 4ZV7A 5LWQA 2MR6A 3BXPA 3A05A 1QB7A 1VHWA 3L7JA 3IKVA 5JVDF 1X0VA 4DCPA 3LCUA 4IXTA 1W73A 3CH7A 3D7LA 5HKLA 4TS3A 3TFOA 3H04A 1EK5A 2EG5A 3VR3A 2IFTA 3BAFA 2H1VA 1FU4A 3A3PA 5FHQA 4A2CA 1SU6A 4TZKA 2H0RA 4F11A 2IKQA 2IK8A 1JVNA 1EI9A 3TNDA 4BFXA 2BR5A 3I6IA 4WJKB 2C5FA 3L49A 3R5KA 3T9EA 1FLVA 5J4YA 4L5BA 1K7CA 2XTMA 3SR3A 1DHRA 4R0NA 1PQPA 2F48A 1QMPA 3KELA 3T7RA 1ZD8A 3EZNA 5AICA 1NJ6A 1G7TA 1I4LD 5U4QA 5CH3A 2J3KA 3MGKA 3ZWQA 5K45A 1FPQA 1OAOC 1Z18A 4JOCA 1M0SA 3PYXA 3IT1A 4A3SA 1AHPA 1BH6A 1KAEA 3HFSA 1DPFA 5FP0A 3OJFA 3HA3A 5KYUA 3IESA 2R00A 4ZYLA 3H86A 3LUHA 4B2PA 3UMJA 2ZS7A 3EBPA 5TVGA 1CF4A 3EUWA 5K0EA 2YY6A 4EO4A 2BFDB 3CYFA 3ZWKA 1Q16A 5E6UB 5K8VA 3WHKA 1MO6A 3KUKA 2CXNA 4B7CA 5E38A 5JECA 1CR2A 4YVFA 5ALLA 3IHKA 1P39A 5G3ZA 1D07A 2IX9A 3K0FB 4BFCA 2IWHA 3LL4A 3LOPA 3JU3A 4YDSA 1ZH8A 3NTQA 1G8GA 4XI9A 3GMTA 2WW8A 1L7VC 3PRYA 5I3CA 5ALMA 4U2KA 1MX5A 2HHCA 5I7EA 4PAQA 2F3SA 1JQDA 4WCFB 5HJ5A 1CP3A 1HSZA 3QTLA 4G0QA 4BFVA 5K2MA 3ZVRA 4MHOA 2GPYA 1F6DA 1QPBA 2H63A 3MOSA 2Q0QA 4FGJA 4ZWNA 1ZD4A 2IC5A 1WB4A 2QTCA 1H3FA 3VDMA 5C5EA 5HVNA 2PU5A 2VYNA 3ND7A 2WTNA 1EGAA 4V0NA 3D4BA 4B4OA 4KR3A 4LV8B 1ID1A 3GZJA 3T06B 2I9PA 1K63A 3Q5EA 3W0LB 4PF1A 2ZIUB 3ZJ5A 4HVCA 4YJ2A 1TMOA 5IVHA 2F1KA 3GZNB 3QE4A 3I64A 3Q8XB 5I4CA 1PG2A 1OILA 4Z0HO 5EY5B 5LOVB 4EIWA 1OMOA 4HVLA 2ZXEA 1OYOA 5K0LA 2OAQ1 4GPIB 2QX7A 5BSVA 3UJPA 3E27A 1TUBA 3TPZA 5TVKA 4MS1B 1R4MB 3D7KA 4H1TA 3D8BA 4HNGA 3I30X 2AF3C 5AMXA 3HXOA 5A5EA 1RWWA 2N47A 1KYXA 2WOOA 3PDUA 2GAAA 2QP3A 4FD2A 2V6IA 4LOIA 3AK4A 4OH7A 4N6OA 1XMIA 2PKRA 4RULA 3HFRA 4HUQB 5IAJA 4OXQA 3D8HA 4GZLA 2UUBB 4M46A 2VTBA 2IDKA 4EB0A 2GBPA 3NANA 1F2UA 3CVVA 1ZP6A 2ZFUA 1AV7A 2CYAA 4M0KA 2VZLA 3LCCA 4BNGA 5CDUA 5TQ0A 4O2LA 4P4SA 2HJHA 2ILVA 5ITSA 2GDZA 2NIPA 3ZDFA 4ZTUB 2YHIB 4HMOA 4FFPA 4QQKA 3KU1A 2HK6A 4Y2SA 1IZ7A 2ZJ3A 5IT4A 3KOYA 4YLYA 3OJEA 4JWKA 3FPBA 1T4BA 4KFUA 4QYWA 3HP4A 1T2CA 2WF5A 1PV4A 3H9CA 4KUEA 2MYNA 2VSYA 3CX4A 1J23A 1D0VA 4EPRA 5F23A 4JEUA 4RY0A 1ZRSA 1UFVA 5FF9A 5KWSA 1H4SA 1NQTA 3ILVA 2RARA 3IIEA 4W82A 4C0SA 4W9NA 3MYRA 1SY7A 2VNIA 1EFTA 3I04A 1P0QA 4CTMA 2O8BA 1DKLA 1M6YA 2PU7A 2WFAA 3O26A 2A92A 2H8KA 1DE0A 2JAQA 3NTOA 4P0TA 1XFAA 5FBZA 1EUDB 2OOKA 2H2HA 2P6PA 2XB6A 2Y77A 1W5FA 3LWZA 4L22A 4YRKA 4UDNA 3GJTA 3DO8A 2WM9B 1ZRHA 3IVGA 4OATA 5EWLA 4B34A 2HBQA 4TQGA 4MO9A 1JDVA 4OHPA 4TMWA 1TK9A 2GSWA 3AF1A 1Y8QB 3CUSA 4AMYA 2HQOA 4YCJA 4MYTA 5ICMA 1JEAA 1DBPA 1SVNA 2I29A 3H2ZA 1PX2A 9LDBA 5JYDA 1X86B 3ED1A 4ZVUA 5H1YA 5TQ2B 2NADA 4B84A 3P0JA 1NA5A 3T9BA 4WFIA 3Q3CA 5FORA 1BQ3A 1TLLA 3SJCA 3SZUA 5KI6A 3P5BA 5JVDB 2A5GA 2J3MA 4V1CB 2Z6UA 1GEEA 1VYVA 5I4IA 3NNNA 3PF8A 2J4CA 4M1OA 1KP2A 3TNYA 4NCBA 1J09A 1HWYA 2ZYUX 4ZJUA 4JP2A 3OE1A 3DM9B 4GOJA 4H9GA 4RA9B 4UDXX 2O1WA 5D87A 4DC9A 2X40A 1D4ZA 4PFJA 1N77A 1BSVA 1LRKA 5CG2A 1J20A 2QB5A 1SUDA 1MFZA 3ESZA 1W5SA 2WSBA 3HMQA 4INPA 3QBVA 4UEOA 4BN5A 1CJMA 2YXEA 1H8EA 1KSGA 1CKEA 3E1SA 3A6HA 3E7DA 3FJOA 3TRDA 3D6MA 4JQOA 2QD1A 1GG8A 5L6MB 1OXKB 4HQNA 1U2GC 3R77A 1NU6A 4XASA 3MJEA 5FOTA 1NSFA 3HUEA 5I8PA 2Z98A 4IO1A 5JROA 2DFTA 3AY7A 3TLJA 1RMYA 1JPUA 4TUYA 4WZ6A 3PJFA 4BMPB 3AF3A 2AOVA 1U28A 5KC9A 2H1SA 1UFRA 3R7SA 4FBMA 1R6AA 1NTOA 1O58A 2W70A 4KMSA 2AJCA 2XNHA 5MN4A 2V3WA 3D3JA 1JH8A 4OLJA 5CA1A 4FMCF 4G3XA 3LQ2A 4A6DA 1S4QA 4NWIA 2QUJA 1TJYA 1I14A 4Z3OA 2QRKA 2NXCA 2X9QA 2QHXA 2RB4A 4UM9B 1GT6A 3ZVNA 3EB9A 1P80A 4KXLA 4YRTA 1Y5NA 4KK3A 5CDGA 4D9NA 1SVLA 2DWQA 4NABA 3OMWA 4PHHA 4HUTA 4JR2A 2JAXA 3H11B 1EJ2A 1QG2A 1SHTX 1FP4A 3R5JA 2HA2A 4IL5A 5COBA 4BATA 3L6UA 1HZZC 3CWQA 1EHCA 3ESDA 3T7KA 3ZLUA 4YV1A 5BVGB 4DJ5X 1PNQA 3OEED 1QVWA 1L4GA 2VUTA 1S5PA 4LBVA 4BP8A 1G41A 3AERA 3HPQA 1GRVA 3MWGA 4O3FA 3C8DA 3Q9NA 3Q9SA 5F2OA 5JPCA 4RF4A 1AV6A 2CVHA 4MI3A 1DU4A 3DKPA 2AQHA 3LZDA 3U3DA 4DJAA 4ZYTA 1XRJA 3GEGA 2VATA 1WQ3A 2EZTA 2XAAA 3OKPA 3W6UA 1FJGB 3IR5A 2O1SA 4H60A 5DX1A 3LDAA 1ISMA 4M99A 5KYXA 1PT5A 2BFFB 5F4ZA 1NATA 2VVTA 2UVPB 5BNFA 2ORWA 4MB0A 2IV7A 2XB2A 2I8CA 1U63A 1GQRA 4K1LA 1SXHA 2VDJA 2X0IA 5AKYA 1KYVA 2FX2A 2MINA 3SBXA 4KDCA 2IU0A 3UOAB 3VYSB 4BU0A 1WHSA 1Z08A 2BGJA 2IXBA 2GEVA 2Y67A 3L4BC 4P82A 5LP6A 5ARDA 1OE0A 1G20E 1MUUA 1Y82A 4O3MA 3IMGA 3R0VA 4CM4B 4KMRA 1V35A 3DWIA 3EEBA 5IF9A 2B8NA 2NZJA 4EG1A 4PLPA 1I6LA 1JSCA 3VZDA 4JYBA 3OOHA 2IIBA 2QPLA 4A27A 1FF9A 3UMSA 1L5FA 1OZ0A 4GM4A 2Q4OA 1FFSA 1BD4A 1LF0A 5CK5A 4PQFA 4BX0A 1BFUA 1EFUA 1KDRA 1XZBA 3FR8A 3PUHA 5EP3A 5JZBA 1CLEA 3FUVA 4WY5A 1AUQA 5FUBA 1KJ8A 2IYNA 3DFZA 3ZEIA 3BZUA 3G0DA 1TC1A 5HCUA 2GPTA 2O2EA 2HRRA 4MYSA 4Y3UA 1N0VC 5A0FA 2O8CA 1WZIA 3I9NA 3NC4A 2CE2X 3OQVA 3IIJA 5EXTA 3DVQX 4Y6GB 3KU4A 4BVHA 2ATEA 5C8VA 2ZYWX 4FFSA 2IP1A 4ENRA 4CT5A 5DHTA 1Z29A 4N7BA 5FL7D 1RBMA 2HK9A 2PBLA 2W6JA 1SVIA 3JVIA 3OLXA 4RSHA 4YJHB 1IU9A 4ZRMA 5EGSA 4DR7B 1CVLA 1PDVA 2OO5A 3CH6A 3H9UA 4PG4A 4G5YA 1T2UA 4XIFA 1N4AA 3ZNNA 1X1QA 2IGTA 4B6PA 4C6RA 1KH3A 2ZIWB 4RMHA 3PLRA 3STWA 3GEEA 1YQQA 1SB9A 3I9OA 3LY9A 3LC0A 2DRIA 4XWWA 5DHPA 5EKTA 1HQYE 1GAWA 4EFDA 1M2EA 3EF1A 1XDWA 2DPGA 4XXHA 3KJHA 1NF9A 2YYAA 3FVTA 3QVOA 4BYGA 1YRWA 2C1XA 2JFZA 3G02A 3SVTA 4PCLA 5KVQA 4B3TB 1H2YA 2FP3A 2VFAA 5H59A 5IX8A 5L3QA 2PGDA 1W85A 2Z58A 3G23A 4HBGA 5DLDA 3ZNQA 1ZUNA 4QLAA 3TLKA 4B6JA 1YA6A 4XJTA 2C4UA 2REQA 1J9EA 1CUUA 2J3JA 4G81A 4MCHA 2ACEA 1MB4A 1XHEA 5ADVA 3DQQA 1KJ9A 1L5KA 5B7PA 1FS6A 1JWBB 5EEHA 3BKXA 2D0PB 4O2RA 4JU8A 3IXQA 4L9RA 5EOVA 1XZIA 3GG9A 1I30A 4IDAA 3ZV6A 2AG1A 1RC0A 2Q2WA 3THSA 4EGAA 3DUFA 5BP7A 2OGWA 3E8SA 4OJKA 2QMEA 4XWGA 3CZMA 4C4PA 5JW6A 1QZTA 4CDRA 2HV9A 2Q5JA 3HZHA 4LC0A 4YGYA 3T15A 1MRNA 4N18A 1SBNE 1GTRA 3FIJA 3B2EA 3WK5A 4P32A 1CFZA 4B43A 5ESXA 4K05A 3KT3A 4FD3A 2AEMA 3WGKA 4X3CA 1IXRC 4EO7A 4CDNA 1P91A 2Q1WA 3AG6A 4XH9B 3N8IA 3H2JA 5E8RA 4PC1A 2HGSA 2J6BA 5TGZA 5MFZA 2X0JA 2V6GA 1RI2A 3HSYA 1LK0A 1QVZA 3FLBA 4EDHA 2J67A 1RYMA 2GDJA 1B43A 3K4PA 1U8EA 1ZAKA 4FMCB 4NS4A 4DA9A 3B9QA 4Q1FA 2VRCA 3O4HA 4MQ6A 1NVMB 2JFBA 2LIPA 2WJZB 4NESA 4L9SA 2X13A 1L5GB 3FOWA 1ZGJA 1BZYA 3HEMA 2XLCA 4Z7NB 3RAPR 4YCCA 4WDQA 3SHWA 4HXGA 3VPSA 1PJ8A 4YROA 3E1KA 3V1YA 3FNGA 1DBRA 3DOOA 3EGIA 2X6RA 3KOMA 4KQGA 1RU3A 3AIKA 5JC1A 2ZR8A 1J39A 1NFFA 1U7WA 5ALYA 4K6GA 2LDXA 1A8HA 1TRHA 3E9ZA 1TXGA 3GRCA 4J3FA 4EB6B 1FE8A 3F73A 4RZUA 3EZFA 2NQTA 2ET6A 3EVCA 4LRQA 3WZMA 3KE9A 4ALNA 1E32A 1ZN7A 2VF5X 2WSYB 4ER6A 2JFNA 3F1KA 3NV9A 1IRXA 3RU7A 1F2TA 2HMAA 3B1KA 4GPBA 1CXZA 5JAQA 4FFOA 1A7JA 1FQJA 5JNUA 2F3RA 3VYUB 2QD3A 3F2VA 4QUBA 4Y2VA 5ALQA 1RHQA 1B41A 1Z4NA 4GIBA 4R1LA 3JQAD 4XYGA 3UUWA 1R0BA 3NHZA 4D0GA 3UHJA 3QV1A 4U2FA 1BKSB 4ZGWA 4FONA 4P3OA 1PQWA 1Z63A 3EVZA 3G2HA 3KFLA 1KDYA 3V7FA 1CHNA 4BCDA 4YPVA 4GMXA 3QIVA 3CISA 5F2NA 3EK2A 3R24A 1ZLXA 1F7VA 2ZI5A 5M34A 4O8ZA 2VJPA 2GM4A 2C00A 4LQLA 4LYGA 1EBUA 3SWWA 2ZUBA 4KO4S 1WPXA 3KQKA 3DZJA 3HLTA 1XYGA 3AV3A 2G72A 4DJTA 2ZVPX 2I91A 3ZD8A 2X0FA 1BXKA 3P26A 1C9JA 1M1UA 1OYWA 3BE4A 5ENVA 1GNLA 4RPIA 1FTWA 5HF5A 5IN5A 3KNZA 3AP3A 4WZAA 2HJRA 3LC1O 5EE1A 3RTGA 3TTSA 5IANA 1ULHA 3B5JA 4Q3EA 1UZAA 1M34E 2HX1A 1MU0A 3NBMA 2LKDA 1PZGA 1Q1QA 1Z0DA 4W63A 3RK4A 4DA4A 3ICQB 1A9SA 2IPMA 3UV7A 4LK2A 3GJ7A 2CLIB 1FP2A 4IFIA 3D2LA 3OZRA 4HATA 3CLSD 4W8GA 4KIUA 1BWQA 1FRFS 3T7CA 4CZ2A 2HNBA 3KC2A 5E9QA 2J5BA 5KDLA 3VYRB 2RMKA 1AA9A 2WWVD 1EE1A 3TDMA 4JVNA 4TWBA 1RHJA 3VR5D 2B5WA 2I65A 1X7WA 4UXHA 2C5HA 5JMPA 2VI5A 5J4VA 3TTXA 3GLIB 1N33B 2GF9A 2FQYA 1DADA 3FAKA 3WK9A 4E03A 5AYVA 3T0IA 3ONDA 1E61A 3FYUA 2AC4A 3OFKA 3WX0A 7ABPA 1GPAA 3ZY5A 4G37A 1XKXA 3B3FA 3CLHA 4JEMA 4DFDA 1VMDA 4QOHA 2P6RA 2YJ3A 4J7XA 3R7NA 2PQMA 3F6CA 4I0WB 4JKOA 2IOHA 3IP5A 4M8IA 1Y6JA 4KQHA 4MUHA 4NCKA 3DL2A 4P4GA 5B5SA 2A9JA 3PXXA 3GL9A 4L9WA 4R51A 5FYQA 3ROQA 4D0LB 1W49A 3FYHA 2FLVA 4C2BA 2JLXA 1OLOA 4JODA 4HWTA 1XJWA 3ZH9B 3PC4A 3A6EA 1QGYA 2OFXA 4QNNA 2FPGB 4EP1A 1I1HA 1KKLA 2QSUA 3BIWA 4JP3A 3W5SA 3CRRA 1H8HD 2JFUA 1ZINA 4PTYA 4CT0A 3DLAA 4EUSA 4GUAA 1Q1ZA 1K1EA 3FYCA 4KQJA 5DMXA 3IIMA 5JI3E 3FMGA 3Q98A 4K87A 3QG5A 2NXNA 4IQ0A 4LYYA 5HEKA 2DG2A 5AUOB 2LP4Y 1G6KA 3W5DA 2W2PA 3W8RA 3WSTA 2R6R1 1Q6YA 1PWHA 2FN7A 4UE6A 5SY6A 3V8QA 4CKBA 2GD2A 4YRBA 1U99A 3I58A 3CVYA 4U0JA 4UHEA 3EJ6A 1KKUA 3AF6A 2X9NA 3DO6A 1WXFA 3ISTA 4PG6A 4TT3A 4CMKA 5JASA 3OI7A 5J5CA 1U2DA 2C5GA 1FQWA 3B48A 4TTPA 1XI2A 2IOFA 3TZHA 4U7FA 1BO6A 3MT0A 3FTNA 4MXDA 1Z8FA 3LUBA 4QJIA 4YUVA 1A9TA 3KKNA 5IBRA 3E1GA 3DKRA 2R62A 3MJVA 1NDUA 3REQB 3ZCSA 2PT7A 3HFJA 1UM9B 2WIBA 2X8BA 3OQIB 4KVFA 5IBCA 1UK7A 2RAFA 4WN9B 5IZCA 4QODA 2QMOA 1Z8DA 3RS5A 1X7XA 4YRNA 1ISGA 1H0RA 3W3AH 2ZIZA 2L19A 1GCOA 1WKBA 1BHSA 1HLDA 4XB1A 4H4DA 4IIXA 1SUFA 3L8ZA 1PVVA 2VPYA 2B92A 2PX6A 4L8GA 4RPJA 1ZKDA 4Q0MA 3LU1A 4P4UA 1ZC4A 1SUWA 3LUPA 3D6JA 1XALA 4RELA 3TSAA 3WKAA 3I5MA 1APBA 4F3RA 1USUA 1MV5A 4YGXB 1M0WA 4Z0TA 1U6IA 1MG0A 4P31A 1H5NA 1WUYA 5IJXA 2WICA 3Q7IA 2CFTA 4DV7B 2W37A 1T6BY 3OPVA 4ENUA 4JXJA 1MJGA 1PGPA 1WHTB 1UAGA 4G85A 1E3IA 2C4NA 2IEDA 4HDNA 1G20A 1QCCA 1GLNA 4FKMA 4QXQA 3SS7X 1R12A 3UXMA 1U2RA 5ISMA 2IUUA 2DPMA 1SUCA 2OZVA 2QTBA 4MW7A 2X9LA 4LHXA 4EBBA 4GSLA 4LV6A 4M1ZA 5YASA 4A0GA 1ENYA 3N9IA 4LJ6A 4F21A 1KNQA 5TGTA 421PA 3CURA 4Y1RB 2P6NA 3KSAC 4MEBA 4YMUA 1XDSA 2ZKIA 3BB4A 4NC9A 5B36A 3VJLA 1ZL2A 4RVUA 2EXXA 1KYZA 4PR3A 5CH8A 4DLNA 1I3OA 3V6LA 4N12A 4JI3B 1PLJA 1VSTA 3QTBA 3QPAA 2WU3A 5IFKA 4DMKA 2Q6TA 3IBTA 1E3QA 1Z8HA 3JYNA 4LE2A 4U2GA 3TH5A 2JHPA 2V03A 4NP6A 3WKCA 5CFLA 5IKMA 1DZ3A 5LZ5A 3A1CA 1TVMA 1GKIA 1QOZA 1JKJA 5TNXA 3WYEA 3DNFA 5FNVA 4ZI7A 1RD4A 1XJ0A 4BE9A 4QLBA 3AEQA 2WSLA 4XCQA 1X70A 1P77A 1UPBA 2Q45A 3B9RA 4UBNA 5CNIA 2RHRA 4AP6A 1TPYA 4B3JA 5IU6A 2C2OA 3VDRA 5DM70 4A1FA 1THGA 2ZR9A 3PIIA 4MJ7A 2AFVA 1N5RA 3JQRA 3EUFA 3UMFA 3TI7A 3EXFA 2QT1A 3HKCB 3QXCA 4EZBA 3W5BA 3LHFA 1B6GA 1SCBA 4B5KA 2J0SA 1FXWA 3QUBA 1KQOA 4K3UA 3ICVA 3C7TA 4GDFA 3LCVB 4ZCPA 3RUPA 2QKYA 1JJAA 1XCLA 3P97A 3BB1A 3OCJA 1JSZA 2X4DA 3K9LA 4EB8A 4HX9A 4HPJB 1ZQ9A 5A1JA 1MQAA 1GDHA 1V0JA 2NT3A 3L18A 4X9XA 3LQRA 4UQLA 2ZUWA 1PL7A 1GV1A 1S0UA 1GPMA 2DQSA 2NXWA 1X7ZB 3EUEA 3NRBA 3NKVA 3U3ZA 5DP1A 1GZ4A 1R6TA 3K1AA 2FZGA 2F3QA 2QUBA 3F67A 3KQVA 1U90A 2HSEA 4IGKA 4M2LA 4QYTA 4I6GA 5F77A 1KMCA 2EBWA 2OXFA 1HE1C 2ZIFA 3Q7QA 4I3HA 5AIBA 2AIRA 1ABBA 2CMGA 4PSDA 1GLVA 5DM0A 2IJGX 5F21A 4BJHB 1JYEA 2FPUA 1Z0JA 1T3HA 5AM1A 1ZGHA 5REQA 1HMYA 1Z2DA 2X2EA 3JS5A 5CPBA 3UCFA 5KHOC 4JU9A 3R3XA 1OX4B 2COEA 3AB8A 1E60A 4RANA 5KJEA 3WNDA 1K7XB 2ANBA 2X1HA 1CB0A 1AK1A 2VDQB 5FXMA 4DVJA 1TYCA 3WRVA 4CYMA 5AHKA 4C30A 4WN3A 3W6OA 1WNFA 3L05A 3WYCA 5IAEA 5GMOA 5BXYA 3ZDCA 3RTCA 2E82A 1Z6XA 4XDHA 1JU9A 3G8BA 3HG7A 4G01B 4KLZA 4WIAA 1WU7A 2VYVD 1Z34A 3E53A 5DM1A 3EDYA 2B4RO 3COPA 1VKNA 4U8GA 3ZHBA 3LCRA 5TPWB 1WX1A 1X77A 2F3TA 4BVBA 1STOA 4M0PA 4TWIA 4EPXA 4QNRA 1VI2A 4BQRA 1FXSA 2Y4OA 4G0MA 5GJCA 1OYYA 1ZGZA 2OUIA 1NJ1A 1R1DA 2YKGA 3AEKA 2HEGA 3G9TA 3C39A 2OCGA 2RHDA 2WFLA 4JA0A 5HILA 3EC7A 4AZ0A 5TJ9A 1RZRA 1GSIA 1Z6PA 3EC1A 3NAQA 1S3FA 1E1MA 3E22B 1F0NA 4NDZA 2IKSA 2VN8A 1YL5A 3EAFA 4IDHA 5DOVA 4BKQA 3R3SA 2VHVA 2OXIA 3BOSA 1SCJA 4FC7A 3U7QA 1EAMA 4UARA 2OCDA 3G79A 1S96A 1N9ZA 2UUOA 3DEZA 3QUTA 1YK0A 2MT9A 3GVIA 5FA5A 2Z2XA 2HADA 3ZXIA 3PXDA 4ER0A 3WLLA 1DAEA 4GMHA 3Q41A 1K2VN 4WSOA 3STVA 3N3BC 2JGLA 1YHZA 2Q1XA 1EFAA 4B6EA 4ZV4A 1QZZA 4F93B 1NQOA 2ZRQA 5ICGA 1XN4A 5T8KC 4EX6A 2IODA 2B94A 4LTNA 3QUQA 4ZT2A 5KINB 3GUYA 4ZMBA 2G5TA 2BGKA 2H5JA 3NHLA 3W3AA 4JKIA 4MA5A 4EHNA 5IJ0A 4X84A 4DABA 3KX2A 3ZHUA 2BFPA 5F51A 4DBLE 4BBAA 4TGLA 1ZD3A 4O2BA 4Q6WA 5AW9A 4IKEA 4LN1A 1ZK1A 2YVUA 4MA0A 1MLDA 4MB6A 2AJTA 5BW6B 4A1OA 2EW1A 3GQBA 4DREA 3EN0A 4YT8A 1K92A 2WIAA 2YZMA 1YBHA 2GEKA 1PR5A 1DC4A 1Q7RA 1J90A 1JQLB 1X6VA 1Y5RA 2BPOA 5KYGA 4RD0A 4OP3A 2FHSA 3T4UA 3L0PA 4MUKA 2FEPA 1WW8A 3P96A 1QLHA 2R85A 4FI3F 4ZT5A 1U3CA 3T5BA 3DZGA 2IPXA 4BNVA 4OKSA 1KA9H 1M34A 2HMUA 2RKBA 4UREA 3IUEA 3OZWA 4WCVA 5DP2A 2RHJA 2ZDQA 5JJBA 4OX9B 4KNYA 4CMHA 2GJ8A 3VI3B 2CHVA 2XQVA 1POXA 2HMYB 3K9WA 3CZ4A 4FNOA 1Q57A 1YZLA 1SD5A 2I2CA 3PQ5A 3VPXA 4JUBA 3UO8B 4BEVA 3SVZA 3VAZA 4JENA 3E2PA 5IFLA 1NXWA 3H3JA 1OH5A 1IHPA 2WJPA 3L6RA 4D9KA 5D5QA 1KC3A 4A5OA 5F9FA 1ZHOA 4R2IA 1WAMA 3VVLA 1A9XA 2JDID 1WXDA 4IWYA 2I5PO 4CMCA 1PGQA 1A5TA 1KMHA 1R9GA 1VRWA 2D2VA 4C1BA 2IYVA 4CTKA 4BLRA 2QQEA 3D1JA 5EESA 4A4DA 3WMRA 1YB4A 4GKVA 1C2YA 4C01A 2VAMA 3TOVA 4W1SA 1U3DA 2OBYA 3FNIA 9LDTA 3M0EA 4O25A 4OK3A 4K0KB 5DLYA 2HJSA 4WMLA 3ITDA 2R7KA 4DLUA 4LY6A 4D7AA 2CLKB 3MVEA 1VYTA 1E1KA 4GAEA 1ZM7A 4LGYA 3ZQJA 4CDGA 1DIGA 2BKVA 3OZIA 1J0DA 3KL4A 1DTSA 3G3EA 4KJXA 1R74A 2OE2A 3HP1A 4X71A 3ZGYA 4F8EA 4GQIA 3LKBA 4PNEA 3PSHA 1U5BA 2FUG1 4UNNA 1WBBA 4AUMA 4J16C 1UZUA 2X2PA 4NBKA 3RYHA 3WLKX 4R0MA 1ABEA 3EAQA 3D1LA 2Q9BA 5C1DA 1QHHB 5FBWB 4RK7A 3RSQA 1C3XA 4GS5A 1OIWA 1N25A 2RKWA 3IQDB 1ZXXA 1N5OX 2EGUA 4DRXA 1TJ3A 2R68A 4C3UA 3ZBTA 5HZKA 4C5AA 1T5LA 4DR1B 3T5PA 3EDRA 5IAGA 3D3KA 1D1PA 4INJA 4YMSA 5JI2E 2Z9BA 4C05A 3D0RA 1CEYA 2ZS9A 1OH8A 1P1KA 1FW8A 3K53A 2OZKA 3HU3A 2AFIA 1VPLA 2B7LA 5AH0A 2Y1WA 5CITA 4GP6A 5DHRA 3AHIA 2LVBA 3ED5A 4LTDA 4UZEA 5DNWA 5BV8A 3HJTA 2W2KB 2CVOA 2IXTA 3OIYA 2WWWA 5F1PA 3MAGA 4F3KA 4DUGA 5IMBA 2VT3A 2IZOA 5JZSA 4HWKA 2PT9A 3TZLA 1U7OA 1RM4A 4IZOA 4OD0A 2HY7A 4E51A 1PZEA 3RIEA 3HBFA 2Z56A 2VPWA 2CJWB 1WPQA 3L0BA 1Z6YA 2DEUA 1JI3A 4RS4A 4CE6A 2IEYA 2D7JA 3DS8A 4E94A 4FYHA 4GOLD 4OHYA 3GNSA 4Q7LA 3TEMA 1U2SA 2HDNB 1XDZA 4YRFA 2WSSA 3SJZA 1ZWKA 2HSWA 5AJXA 5JAPA 5IHXA 1SXJB 1X7YA 1BH2A 2BR4A 4GC5A 4GSKA 3CRNA 3JWGA 4B46A 4OLFA 2IYWA 2XHEA 3WLHA 5FEUA 5FQNA 4K8OA 2IQ5A 1VHQA 4R2LA 1JQJC 2YHAA 5SZKB 3NIDB 4YMLA 3IAS1 3R9XB 3CNOA 2O7SA 3BTOA 2IPLA 3DNMA 3PNBA 2FPIA 3PX3A 1KSFX 2ATIA 1NJGA 4R2HA 1XSEA 2WLTA 5TMEA 5KOHA 3ESQA 1N2SA 4FVTA 4NZYA 4X44A 3IXMA 1T3TA 3MXTA 4XX1A 5K0CA 5T6MA 3NONA 2IZ7A 3COWA 1QRRA 3ZUGA 2DBRA 4P58A 2VO1A 1OX6A 1YJAA 4XQ9A 3AETB 2Q50A 1KQFA 4OOFA 2Y2VA 3TX6A 3HDVA 3CKMA 2FGKA 3C24A 3DPUA 1SVUA 5FD8A 1UC5B 2O3SA 4PGFA 1TQ2A 1LXCA 3DT9A 4QRIA 1ZZEA 1ZISA 1YSCA 3MWYW 4CF5A 3OIFA 3CO5A 5A3SA 4D41A 1WW3A 3AUSA 1JLKA 3KUUA 4Q48A 4K9LA 1LW6E 1T6NA 1XWIA 3DMPA 4R8SA 2JH9A 4LMBA 4XR4A 3KJNA 4YMWA 1R6BX 2UVDA 4J3JA 5DGXA 1GKYA 4GX0A 5DX0A 2JJ1D 1U7HA 3G2PA 3KJFA 4KP7A 1UODA 1V8FA 4DW8A 4URUR 4BKUA 4TWAA 2C77A 1E7WA 3AM4A 3Q3GE 3RGGA 1L8QA 2J48A 3L1KA 4CM9A 3OQMA 1WZEA 3WFIA 4UCQA 4UFOA 1SRQA 3G17A 1DEXA 1H22A 1N5DA 4GI5A 4KQFA 2I7DA 2XMRA 4BZZA 4C4RA 4NATA 1KI3A 5BUQA 4MGHA 4YJFB 4JBWA 3TWOA 2E37A 1XP5A 3SR0A 4C07A 1EUYA 3LXXA 4D3XA 4DDMA 3WL7A 2BF7A 4KPUA 3HVHA 4C0WA 3TRJA 4UTPA 4ESVA 1V39A 4X92A 2GLUA 2BM8A 4Y0AA 3EODA 2M6KA 4CXMA 3RSSA 5LYJA 4BO4A 4WBSA 5E6SA 1AGXA 4MIEA 4QPJC 2VH1A 4ND1A 4A8JC 4IKPA 4EKEA 5I45A 1PHPA 2CFOA 3GLGB 5HOQA 1PGOA 1V9LA 1IIBA 5DTIA 1QG6A 3HKBA 1UAYA 1Z4LA 1UM8A 2AZDA 4R6XA 1HTBA 3DFMA 3LDFA 1K4KA 2BVNA 2G4CA 3D4IA 4JUDX 4HYYA 4YP9A 1YQUA 4FMPA 2X0RA 4KUGA 4LVNA 4IJ5A 3DBLB 5B58T 3TUZC 1A8PA 3IBFA 1KY3A 3L1UA 4X3OA 3H17A 4UJ3A 4HDRB 3UHPA 1M0EA 1BS9A 4NQZA 5DCUA 1YS6A 2XF8A 5C5IA 2IZ1A 2GGSA 5DBFA 4CMEA 4CT4B 3QBJA 1NP6A 4YJGA 3UW1A 3DBHB 4M0FA 3ITNA 3T6KA 4UATA 2X7HA 3MGAA 4KGVA 4DDWA 4P35A 1DC3A 1BW9A 3IPRA 5F3RA 2H2WA 3FUXA 2PX8A 1GSOA 2EBFX 3A06A 3GR6A 2Y66A 4YRQA 2ZM5A 1IMJA 1FIUA 1YBMA 1TMGE 1Z38A 3ENNA 4HZUB 3UOWA 1ENZA 3GRYA 5JCXA 1QGOA 3UJ9A 3V4ZA 1DQNA 2XNDD 1GDTA 2IHKA 4IIGA 4Q1DA 4BTEA 3BMOB 1I33A 4RK5A 4BWFB 2NNWB 3KTDA 3EFEA 2QY9A 2JBHA 4XLLA 1GXSB 4NEQA 2VP5A 4HWSA 2AZTA 1WZCA 4K9MA 4MPTA 4AJJA 2NTVA 3ZY6A 3IYLW 4UFNA 3HO1A 1CY4A 3ANMA 2JBAA 4WY8A 4RK0A 4XA8A 2JI6A 2FJ0A 3JVEA 4V02A 4B75A 1W2HA <