4ESHA

The crystal structure of thymidylate kinase from pseudomonas aeruginosa pao1 in complex with deoxythymidine.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
211
structure length
207
Chain Sequence
b'NAMTGLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPSDEPMAADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPVEIGLARGRLDRFEQEDRRFFEAVRQTYLQRAAQAPERYQVLDAGLPLAEVQAGLDRLLPNLLERLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title The crystal structure of thymidylate kinase from Pseudomonas aeruginosa PAO1 in complex with deoxythymidine.
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 83
structure length 207
sequence length 211
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4eshA00
4QGAA 2J3EA 4DDUA 5KSOA 4GOXA 1S9HA 2IYYA 5DI3B 5AUPB 4URZR 1DARA 1UF9A 2JLXA 4A0HA 5AJVB 2AK2A 3W5JA 2DCUA 4M1WA 2OBLA 1XZQA 4QXAA 5JZVA 3N5CA 1J2JA 3GFTA 4LHYA 1CIPA 4NPHA 1RIFA 3KL4A 2B21A 4QHTA 4TTQA 2OZEA 4Y0VA 2RAPA 2K5UA 4ZCLA 1OXUA 3RS2A 4LX0A 5A5GA 2JLQA 3I61A 4QFMA 2BEKA 2ZAMA 3I5XA 2OSBA 1NLYA 3SDZA 3KUCA 2KBEA 4CEIA 1CXZA 1A2KC 5B2ZA 4DLZA 5IF9A 1IJEA 3UKDA 3LY5A 5JEDA 3BFKA 4JSTA 1P4SA 2P5SA 1U0HC 4XWKA 3G82C 3QPVA 2ZRFA 4C9BA 1CR1A 3QI2A 2O8DB 2CL6X 1OPXA 2QQEA 4AY2A 4HB2A 2DFNA 3C5CA 4UQOA 3ZS9A 4ACAA 1OH5A 1PVOA 3AVPA 1T8UA 1QF9A 2OT3B 4HZUB 1XU4A 5M04A 3CX8A 3X2SA 1FNMA 2MMGA 4IFEA 2UVQA 2HCJB 3W6NA 2VRWA 5JCZA 1WMSA 2PEZA 2JIZD 2A5YB 4LOAA 1SXJE 2IXGA 1VCNA 2FGJA 2PCJA 2C95A 2Z0MA 4QHSA 5JWHA 2R62A 4V0ME 4AG5A 4BEBA 1XBTA 1IXZA 2YC4C 4ABYA 4AYXA 3PIRA 2OE2A 1VIAA 4DCUA 1II0A 1Z6TA 3QF7A 1E2IA 2X8AA 2YC2C 3ZDQA 2NIPA 4QKQA 5EP1A 4DIEA 5DGXA 4PQFA 3TKLA 2O8DA 2GRJA 2OBMA 4B43A 2B92A 3THWA 2PBRA 2KJQA 2GCNA 5FPKA 2Q3HA 4DT1B 1OXTA 1OH6A 2YHSA 1FUUA 4A2PA 3SHWA 2VSFA 1VCOA 4HZUA 4XD7D 4NYMR 5EQTA 3H86A 4F38A 4BE7B 3RRMA 4NYJQ 3CR7A 5JRZA 3KTAA 1IN5A 3B60A 3FMOB 2G77B 4C2UA 1FMJA 4KITB 2WVJA 4C0BA 2ZE5A 1R0WA 1DTSA 1VHLA 4PC3A 1G291 1NKSA 4PSKA 1KKMA 1KJWA 2ZI9A 2Z4SA 3CNNA 2ZR0A 2JDIA 1AK2A 1XWIA 3LQRA 2RGBA 3BB3A 2IXFA 1AN0A 1E4VA 3SN6A 4AC9A 2C96A 4DWJA 2AX4A 3QOFA 3CH4B 2GJ9A 1A2BA 3SI7A 3FHOA 3QEJA 3LV8A 4X8LA 3RRNA 3LWNA 4BUJA 3GEIA 1VECA 1MABB 2ZYVX 3VKWA 2WPDA 2P0EA 3PJRA 5JBQA 3B2EA 1KJZA 2N1BA 4OQNA 4DT1A 5JJLA 2H1LA 2QP3A 4JLAA 4PC2A 2XZOA 2YNMA 3H0KA 1AM4D 4AIIA 3WYFA 4B34A 1E2QA 2UZIR 4PC1A 4OQMA 1W0KD 3A37A 1SHZA 3VHLB 4B6FA 4AKHA 2B6HA 1H8ED 1FFHA 1Q3HA 3T15A 5B58C 2JLZA 3CF6R 4NH0A 3IQWA 2FEMA 2VP0A 3KKQA 5J4YA 3AVOA 3C8UA 2DWQA 2BHRA 5FUWA 3O8BA 5SZHB 3R9WA 1W4CA 1UDWA 4OI4A 4DB4A 4IRUB 2BC9A 4KXFB 2ZU0C 1YZUA 5HZHA 521PA 4QJ4A 1HUQA 1HTWA 3K09C 4RSGA 4B47A 3J81k 4TTRA 3WY9A 3QPUA 2QMOA 1MABA 1NN5A 2ZRPA 2BBTA 2PEYA 1PLLA 3VX3A 2J0QA 1JEDA 4I99A 4BFSA 4MUBA 4GZMA 2J59A 3RSLA 1Z06A 4OK6A 3PG5A 3B1WA 2I1QA 4RKEA 3BERA 3MUFA 2C99A 1R0ZA 4NU0A 4DCNA 4OHYA 2J7KA 4GZLA 1NP6A 2CVFA 4FMDB 1T3HA 1I4DD 1E2HA 2W83A 3PUZA 3AM1A 1Y3AA 2F3RA 2A9KA 3EC1A 1TTTA 4DLRA 2QM7A 2XJ9A 4CW7A 2WAYA 3AVXA 2RGEA 4MGKR 4QBIA 3QXHA 2ODWA 2ZJ8A 3LO5A 5G41A 1T5IA 1G3QA 3U7GA 4JKYA 2BJWA 2BCJQ 1QVRA 4JLJA 4PAQA 4QM6A 5KDLA 1Z6YA 3NHAA 3G5UA 2V6JA 2BIFA 3B1VA 2VHUA 3TK1A 1G17A 3DZ8A 3KJGA 2NPIA 3EW9A 5IRCD 1Q12A 5EP3A 1D5CA 1NI3A 1R6BX 1GL6A 2D4HA 1A4RA 4JYCA 4MUAA 2PH1A 3T1OA 2Z43A 1R8SA 3KJHA 1AS0A 1BYUA 1OXVA 3FWYA 4M1YA 5AK0A 4II7A 1KOFA 1TEXA 4UNQA 4D80A 3CR8A 4C0HA 3T1TA 5BYKA 3R9XA 1LS6A 2EVWX 3A1SA 4BASA 2AR7A 4B33A 4A1FA 5BXQC 2HXYA 3NBFA 4D0NA 4FIDA 4HLDA 1S96A 4LZZA 4DSUA 4B75A 1W1WA 3SU8A 3RWOA 3VU9A 2IA5A 1Z63A 4YDHB 1E9DA 2EU8A 2IW3A 1M7GA 5KPJA 1UJ2A 4FWTA 1PUIA 1OB2A 4Q19A 4M22A 3GFOA 4DCVA 1U9IA 1G3UA 3GJ4A 1KNXA 2J0UB 3QKSB 1XTQA 2GVDC 3OIYA 2ZS8A 4PO1A 3WNDA 1N0UA 1L4YA 2GXUA 1Z0AA 2NOAA 1N6LA 4V0NA 1WDTA 2F3TA 2AWNA 2RGXA 5JECA 2C78A 4EFNA 5J4VA 1KI9A 5FL7D 2G83A 4A0RA 3QIAA 2WOJA 4Q9JA 2JJ2A 4PHFA 3QVVA 5DSZA 2HT1A 4GSYA 2DFTA 1XMIA 1IHUA 1US8A 3AGPA 3MJHA 2YYZA 3FKQA 1E1QA 3WNCA 5F98A 2WSSD 1BH2A 3D6TB 2QGZA 5JS8A 2B7CA 2JLYA 1H8HD 4TMZA 2ZVQX 1G7CA 1CRPA 3D7MA 1HT2E 4Q4HB 1WBDA 4ON9A 1D2NA 1X3SA 1Z0IA 2GETA 3OE7D 5EJEA 3KXKA 2J5XA 2OESA 2J0UA 3QKSA 4GP6A 3NVAA 4TYQA 2GBLC 4CZ2A 2XB2A 4A4DA 4GL2A 4JL5A 4DLTA 4QGHA 1YKSA 2D2EA 2A78A 1COWD 2CDNA 2FFAA 2A5FA 3B8HA 1FX0A 2AN9A 2QM8A 1NMXA 4YXWD 2ERXA 4PO9A 3CRW1 1E2DA 2YVUA 2PMDA 4NP6A 1RW4A 4TL6A 3RABA 3A58B 3WNBA 3NC1C 3C15C 1ETUA 1W4BA 4C0JA 1K6MA 1FTNA 1LY1A 4NHOA 3K70D 1GG2A 3HR8A 3QE0A 1LNZA 3GJ5A 3QSYA 1RRGA 2Q9AA 3AF3A 1Z2CA 1P2UA 4DRZA 4XIGS 2O0HA 2O5VA 1ZAKA 1M2OB 2ZETA 1NLZA 2ZJ5A 3GLGB 3U7FB 4XVRA 5DE3A 4CEHB 1CR0A 1M7HA 1KHTA 1JQLB 2IYZA 4A8JA 4B35A 5FI1B 5FBRB 1KK1A 2W6JD 3W34A 3QENA 1KAGA 3C16C 4UNRA 4E07A 2QA5A 1MOZA 2FDCA 1P62B 2WOOA 3K0AB 4NCKA 1JR6A 1KI8A 2ASEA 1KAOA 1M8PA 3T35A 2ZSDA 1JBKA 3FKSA 1JB1A 3BFVA 3GJ0A 3OEHD 2H16A 2OXCA 1S3SA 4AYWA 1SXJD 2FZLA 2LCFA 3CBQA 4KJZA 1F3OA 1NVUQ 4WZAE 1E0AA 2XNDD 3X1DA 1E9SA 2OAP1 1W2GA 2CVHA 5F9FA 5JHGB 1XTRA 2J46A 2HV8A 4X8OA 1JR3A 4MKGA 3ADCA 1OFIA 3CWZA 2LWIA 2WWXA 4PR0A 4DSNA 3HYTA 4O25A 5E3HA 4MKHA 2HYDA 5L3QA 1R7RA 2ZI7A 2B8TA 1UKYA 3S1AB 1JPJA 3AGQA 4L16A 3PQCA 2BBWA 4Z51A 4OQFA 3GLGA 2V7QD 3OEED 1W36C 4RCZA 2CXXA 2SHKA 2ZRDA 3B5JA 1W49A 4PSAA 2ZVPX 3FVQA 3I62A 4L8GA 4FCTA 4QOSA 2AK3A 5TV2A 3VNVA 4JIMA 2BMEA 1I2DA 4JVLA 4JL6A 1N3BA 2ATXA 3PFIA 2CK3A 2JLUA 3U44A 3GCGA 2IWRA 3MWYW 1KDOA 2QPAA 5EP4A 1ZNXA 5J47A 4LYHA 4MRVA 2QY9A 3A8TA 1N6OA 5CLLA 3BXZA 1B23P 4PC7A 1CJKC 3CRMA 1QG2A 3Q85A 2P6NA 3U6KA 1FP6A 3OF5A 4ZDIA 3QF4B 1F2UB 3JVVA 2ZRHA 4V0LA 1KGDA 5AR1A 4QJ5A 2IK8A 1G18A 3K0EA 3IEVA 1G8FA 1KDRA 1SVOA 3U7HB 1R5OA 2QP4A 1Z6GA 2QE7A 4RZ2A 2G3YA 1QHIA 4TSFA 3VR4A 2JJ1A 3T06B 1UAAA 4A36A 2BMJA 2ZM5A 1OF1A 3KX2A 4Q4AA 4DCTA 3TLXA 1UADA 3MMPA 3DOFA 4Q21A 1J90A 1NIJA 2ZYUX 3W90A 4F4JA 1G64A 1DG1G 1Q1BA 1X1SA 5EXSA 4CIDA 3LBIA 3T1QA 4IVQA 3TW8B 4US1R 1N6IA 5KOYA 4LJ9A 2QNRA 3CO5A 4UNNA 2WJHA 5TDHA 2QBYA 2VHTA 4B3BA 1TF5A 3SYKA 1W5SA 4TT3D 3MAAC 1E2LA 3CRQA 4BLOA 5JSZB 3O8DA 3DM9B 3WYGA 3TGPA 4AI6A 4JYBA 4QHYA 1SKYB 3AKDA 3QF4A 1F2UA 3CLVA 4A2QA 4HEJA 2IYWA 2NO0A 2V1XA 4EPWA 1XD8A 5L3SA 4RZUA 2F1HA 2JLWA 4PPQA 2IF2A 1T3SA 2EFCB 3KQHA 4YMVA 2P3SA 2GHIA 2O8EA 1GL9B 3GEEA 3RAPR 5ANRB 1ZC3A 4OBEA 5LD2C 2O52A 1EESA 1K5DA 5G53C 1II9A 1W0JD 1ZINA 1KSGA 5KTYA 3SNHA 3DKPA 3ZVLA 4B3GA 1GSIA 3IQXA 1XCGB 3OAAA 4TLAA 4MYTA 1XEFA 1VG0B 1F48A 1H65A 1VYTA 4JLNA 4E5UA 1G7TA 2XNSA 3CB4A 2V3CC 3GLHE 5B57C 2GWHA 1W2HA 1KZ7B 3AF1A 3BC1A 5EE0A 1OIXA 4N3NA 2IYVA 4LBVA 3TJZA 2QAGA 4LV6A 3LVRE 5FUYA 1M74A 2OUKA 4TQUS 5JJKA 4A0GA 2PL3A 5C18A 2IS6A 4KI0A 3QG5A 1G3IA 5HCIA 5FOWA 4JLMA 4EFMA 4XSHA 5EZ5A 3SC3A 2EW1A 3GQBA 5CK4A 4RD4A 4MYCA 3GLGE 1HV8A 4Q18A 4O2LA 4URYR 2XGJA 2W2XA 3RYTC 3ZVRA 4Y0AA 4FW9A 3SJZA 4BGDA 2E87A 2CLSA 5TB5A 1TAGA 4QC2A 4KFRA 4LC1A 2XEXA 5E7JA 2XSZA 3I1FA 3FMIA 1F6BA 2CBZA 4P4TA 4KFUA 3THXA 4TLBA 5JLJA 4LBZA 1TF7A 3CONA 4B2PA 1XPRA 3LX5A 2W6IA 1EWQA 3T5DA 2FV8A 2GXQA 2R6CA 3K1JA 1RRFA 3LXRA 3NEJA 3EA0A 5BYJA 4ESVA 1EXMA 3D8BA 3KQUA 3AKYA 5KSYA 4KO8A 1BMFA 1A7JA 1G4UR 1QG4A 1XXHA 4PHGA 4BLQA 5KSZA 1HQYE 1CF4A 1NVXQ 2J41A 3VTKA 4YMUA 2GTPA 1FZQA 3QY0A 3KQKA 1WA5A 4GRAA 3CNLA 4RY2A 2RKOA 4AK9A 3AF2A 3NBZC 3TIFA 1O3YA 2QQ0A 5FTKA 2WIAA 3AQ4A 4I81A 5A0FA 5GJVC 4EKDA 3VKGA 1KSHA 3RRZA 1YZTA 4CDGA 1P61B 2MMCA 5AJYA 4XH9B 1LVGA 4BLSA 3CRRA 4C7OA 1N5IA 4A6PA 3L0OA 1QRAA 2OLJA 3BRWD 1U9IC 2V8OA 2WMOB 2F1JA 4PQYA 5FTMA 2O8CA 4D4LA 4O0MA 4HYYA 3HR7A 3UMRA 5JI2E 4LHVA 5DNYB 4R7ZA 1J8MF 3EPKA 3B9QA 3Q8XB 4ASUD 2XXAA 3PEYA 4TYWA 1KSFX 2EWVA 5IDVA 1NIPA 1XMJA 3RS0A 2R6FA 3LFUA 2OCAA 3KKMA 2VF8A 4PTLA 1BO6A 4YMWA 3UPUA 5FOSA 3KKNA 1NG9A 6Q21A 5EE5B 1OKKD 1XMSA 4OQLA 3PUVA 1T0HB 1YQTA 1E94E 3CRVA 1DELA 1G4AE 1O87A 1YVDA 2CL0X 2YINC 4JVMA 5DHAA 1VIYA 2DB3A 3B78A 1OFHA 5HZKA 4C2TA 1ZM7A 2BKUA 3FGNA 3NDPA 5SZJA 1LFDB 3SOPA 4LBWA 2DFKB 2P5TB 4WXRA 3U61B 1XTKA 4NMMA 1P2SA 1HE8B 1U0JA 1OFUX 1LTQA 4KLZA 2AHOA 4K46A 2IX3A 5DH9A 1IN6A 1OYWA 1UM8A 1VYUA 1OLOA 3KFVA 2BDTA 1AA9A 4MRRA 4BLPA 3KKPA 5DN6D 2C98A 2XTNA 3P4XA 2FSIA 5L3VA 1KO1A 1J70A 2EYUA 4KVAA 2YOGA 3U3RA 1YZLA 1W36B 1QZXA 3H1TA 5J4KA 2IL1A 5CYPA 3K0FA 1GFIA 1EFRD 4NYIQ 5TMPA 3GP8A 2PMKA 1KI1A 1P75A 4LJYA 1XEXA 4M9QA 3TR0A 3VR5A 2ORIA 4A8JC 1NJFA 2C9CA 1VG1A 1U98A 1G6HA 4R2HA 5SZIA 2GCOB 1Z0KA 4L9SA 3TUIC 4BFVA 4C0KA 1XJCA 4P32A 4ZKDA 1E2FA 4A15A 5GVSA 4BFWA 4JT4A 2WWIA 3ZZUA 3EXAA 2VHQA 2VP5A 4WBSA 4XWOA 2X2FA 1E9CA 1MH1A 3DMNA 3THWB 1G5TA 3AUYA 1S2MA 5F2EA 2ZJBA 3L0SA 3MWKA 4KU4A 3X1XA 1G7SA 1GKIA 2J7PA 1KI6B 5FUXA 4M1MA 4D81A 1TX4B 2QG6A 4JLDA 4TL8A 3KTAB 4LYFA 1LV7A 1NLFA 1RZ3A 1AGPA 1D9XA 2OCPA 2XITA 4TQ9A 1A1VA 2OAQ1 3LW8A 2ZRCA 3RS3A 4EDHA 1ZUHA 3T34A 1RVDA 4WVFA 2EWWA 3AF4A 4WZ6A 1ZU5A 4GMDA 2CJWB 4F7WA 2GESA 3GMTA 4M4SA 3WMGA 2ORWA 721PA 2CCKA 3VKHA 1NSTA 1GRRA 3FMFA 2HF8A 3LBHA 4EQ6B 2HLDD 3LXXA 2GCOA 4WOPA 2R6DA 4AKEA 2NO7A 3PENA 4TYNA 1IQPA 1C4OA 2ZEJA 3OFND 5KNBA 4RVCA 1YZNA 2P2LA 3DOEA 4PHHA 1T0JB 2G0NA 2ZRLA 2O8FB 1SVLA 1II8A 2R9VA 3IPYA 4Q9IA 4DUGA 1RRCA 4LI0A 4LPSA 1OH8A 3FPAA 5JWRA 1BOFA 5BN5A 1E0KA 3ZVNA 2Q9BA 1ZMXA 4XVQA 3VR2A 1KI6A 3ASYA 2GF9A 4BLTA 5D3MA 4EPRA 3RS4A 4B76A 1E2PA 3I8XA 3M4YA 3BIFA 3Q72A 2FSFA 3IILA 3I5YA 2E9SA 2CNWD 1U99A 5F9HA 5LD2B 3WHLA 2RGNA 3BGWA 4EIWA 2QROA 2NO9A 3CZQA 1N5LA 1D6JA 2CJWA 3AVVA 4WAUA 1J7KA 1W44A 3QBTA 2FH5B 4YDSA 1RJ9B 3KZ1E 3PEWA 1Q1QA 2ATVA 3L0PA 3KB2A 1NMYA 4XTCS 2YJTD 4LV5B 4EQ6A 1E2GA 2QPOA 4I1VA 4BZPA 4EJSB 2J0SA 1W46A 2WICA 3I4LA 3ND9A 2WWHA 3D3QA 4B3XA 3MJRA 4EPVA 2O8FA 2YV5A 1QHSA 3QPWA 3A4LA 3FKSD 1PLJA 5DYIA 1R4AA 3FTQA 1UBCA 3SBEA 4AURA 2F6RA 4NCHA 1XJ0A 2F1IA 1NG1A 4YC7A 3C5HA 5BWMA 2NZJA 4S35A 3MD0A 3IKJA 3ZD7A 4O2RA 1GTVA 4NYMQ 2PZGA 3ZIAA 1RYFA 3NHBA 2NMVA 5JEEA 3HU3A 1XZPA 3L8ZA 4JMPA 5HKKD 4HLQB 3LLMA 2KB0A 4GDFA 3MLEA 5EP2A 1Q57A 2KE5A 3ZS8A 1RJ9A 2X19A 2AKYA 3I72A 4IEIA 4LY6A 3IIKA 1OFTA 1DAKA 5CB6A 3W8NA 4CF7A 4BEJA 1NRJB 4EJSA 4LBYA 2WJGA 4Z54A 1Z83A 2ZYWX 4B3CA 4CVNA 2GXSA 5GADl 3VFDA 4C3ZA 2EFHB 3M0EA 1G8PA 1P9NA 4IFBA 4DDTA 2PZEA 4JBXA 1JI0A 1FPMA 4TZ6A 1U90A 1XD9A 3NWJA 1FP7A 2RB4A 2FA9A 4YONB 4F4CA 4L4UA 4ARZA 1P72A 1SULA 2AKAB 4LV8B 1KO4A 3MG9A 4KBGA 2QAGC 4Q03A 3L0IB 1EX7A 1ZJ6A 2G1JA 4JT2A 2H18A 2OHFA 4HB4A 4TWZA 1GITA 2ZRGA 1LS1A 2GK7A 5CJ2A 3VU9B 5C1BA 4AKIA 1W47A 3IO5A 2W0SA 5FFMA 5G3YA 1Z47A 3P1JA 5LDDC 3BB4A 1KMHB 2ZRNA 4PPGA 3E5HA 1SVKA 1E99A 2IEYA 1D8TA 3AVQA 5FBLB 5IK2A 3CX6A 1E69A 3K0CA 2ZRAA 4TLDA 2FN4A 3O47A 4LJ7A 3OIWA 3RS5A 2C2HA 2FZ4A 2V4ZA 2ZROA 4HAVA 3RLFA 3IUYA 3CKLA 1Q22A 4IOJA 1E96A 5FOTA 2JASA 1T91A 4Q7LA 2FSGA 1XJQA 2V55B 4GT1A 4LJ4A 1ZIPA 1HA3A 4HDQB 3LX8A 4R9UC 2AFIE 1KO7A 1S8FA 3V9PA 3D31A 1EG7A 4RD3A 5F3WB 5C2JB 5TARA 4JVSB 2ZUBA 1CKEA 3P20A 1RKBA 1NNEA 1G8GA 2WZQA 4C30A 4GOJA 1WRBA 1US8B 4NONA 4DLYA 2VF7A 1XCMA 1DAMA 3AP3A 1T3LA 1YE8A 2ZSAA 1R5NA 3FFBA 4ZO4A 4C0AC 2VSXA 2PZFA 4URUR 3WBKA 3QKTA 1NBMD 2XOKA 4Z8YA 1PJRA 1TNDA 1YHNA 2IYSA 1XTSA 2GF0A 4G01B 4GI7A 2IBMA 1KMHA 1TQ6A 4DLVA 3GLIB 2JLRA 1DO2A 1TQ2A 1XB2A 5H8WA 1XNJA 2J9RA 3NH9A 3WMFA 1M7BA 1UKEA 5FOUA 2FMXA 4WA7A 4B2IA 1HY3A 3MWLA 3QKRA 3N70A 1OH7A 2VEDA 4GBMA 4IOKA 1XFAA 1FX0B 1IN8A 1ODFA 3RS7A 3KXIA 2QAJA 4LPKA 2IS1A 2F9MA 1YR7A 4TMVA 4IVRA 4HAWA 2VO1A 2R2AA 3Q3JB 2VTKA 221PA 3OAAD 4NZYA 3SYNA 4FMDF 2ZTSA 5EE9A 3QVUA 2FPKA 2FFBA 3W9YA 5C4MA 1W4RA 4RZ3A 1CLUA 1Z22A 4MRPA 1E1RD 1OT3A 1EFTA 4Q66C 4US0R 4DLXA 4KCGA 4PZLA 4DSOA 2ZI6A 3AVUA 1MRNA 2FE4A 621PA 3LH5A 5DHFA 5FR1A 1S4QA 2EFGA 1N2CE 4A8JB 4TTPA 2WMNB 1E6CA 1GUAA 3SFVA 3CX7A 1N0VC 1JALA 3BD9A 3GLIA 2DFLA 5AJZA 2IUUA 3E70C 1V43A 2WKQA 2PT5A 3TQCA 5CDFA 1YZGA 2JIZA 4B74A 1OW3B 3QKUA 4V0KA 1P2TA 1VCIA 5KYKA 3RHFA 2HYIC 3Q9LA 1EFUA 2GVZC 2ERYA 3PUYA 4Z8XA 3U7EB 1WB9A 3UG7A 2JATA 1NVVQ 5AJWA 3FHTA 1FMLA 4LSGA 4QNMA 1OHHD 1JXOA 1BIFA 1GZSA 1UEJA 3EG5A 1XCPA 4B3FX 4U5XA 2P6RA 1SVSA 3IPXA 4IJMA 4KYUA 5L3QB 2KWIA 5JI3E 1CR4A 2QTHA 5FOVA 1JXMA 1P60A 2WJYA 4GP7A 4MRSA 4HB3A 1E9RA 1N6NA 1C1YA 3BS4A 2FGKA 1D9ZA 2ZI3A 5JCPA 2CE2X 2XZPA 2CHGA 2QP9X 1KO8A 1R0YA 3UMSA 1CU1A 4E03A 3U44B 1DPFA 4IDHA 4V02A 4NCIA 3SS8A 1E3MA 4TMKA 2QN6A 4KODA 1G8YA 4MQBA 3TSWA 4W5JA 1E79D 3B13B 4HI0E 4JL8A 4H1VA 1E2MA 4CT4B 3TH5A 4E22A 4MH0R 3UWOA 2OO7A 1KK2A 1GRNA 4OK3A 2HDNB 4CRWB 4M1OA 3DKVA 2G88A 3BORA 3CW2A 4K81B 3KFXA 4XVUA 2WWGA 121PA 4UXHA 4JVNA 5E7MA 4F4IA 1CEEA 1KKLA 1IN7A 2F7SA 4A0FA 2ZE8A 3VR3A 1CTQA 2QMHA 4JLBA 3ADBA 3VHXA 1IXRC 3TSOA 4BFZA 1FW6A 4DZZA 3IBGA 4FN5A 4G5RA 3BB1A 4DLSA 3AUXA 4LGMA 2DY1A 4XJXA 3GFPA 4HUTA 4Q4AB 1W0KA 3MGCA 4D4JA 2QGNA 2H5EA 2Z6VA 1H8EA 1ZUIA 5L8VA 3IHWA 1N25A 3KB1A 2H8KA 2C9YA 3CPJB 2WAXA 3Q5DA 4YMTA 2VP4A 4URWR 2QBYB 3H84A 3DEFA 1Z6AA 2GAAA 3QUSA 3OZXA 4KV9A 2ODNA 3N2IA 4QBHA 2RCNA 3C41J 4OL0A 5IT5A 2Q3FA 3B1XA 2QMEA 1X6VA 1XTIA 2WWWA 2ZXUA 2NTYC 2EFEB 5HPYB 1OE0A 1QBKC 2CLCX 2CEAA 2ZJAA 5L3SB 1ANKA 2ZR7A 1KO5A 4NE2A 3F3YA 4P31A 5FPSA 2QSZA 1U81A 3PV0A 1HYQA 3LAWA 1RE0A 2B8WA 2ZRMA 2O8EB 3MSXA 3M6AA 5FPYA 3FMPB 4M1SA 3GLIE 5KSPA 2QZ4A 3W3ZB 3LBNA 1UKZA 2RGNC 4JLKA 3WP0A 4HSEA 4BFUA 2ZREA 1N6PA 1VG8A 2Y8EA 5FOXA 1IY0A 1YR8A 2P67A 3BH0A 3P26A 1MT0A 4UNPA 4Z1MA 4DIDA 4HATA 2P6UA 4RFSA 2REBA 1UEIA 4HB0A 2BWJA 3JZAA 1YJ5A 5HR5A 1AGRA 4Q7JB 1YR9A 2HCBA 2VH5R 3FHCB 4PXAA 2I1VB 4WXPA 1N6KA 4NKRA 3NBXX 4RD6A 5KDDA 4G5SA 2QAGB 4V03A 1Z6XA 4ZI3A 3IIMA 5KPDA 3W6PA 4I4LA 4D4KA 3A4MA 1AQYA 3AKEA 4BLRA 1GAJA 2BKEA 5EUQB 2CCJA 1KK3A 2ONJA 1ZBDA 4F91B 3WP1B 2IYUA 2CLDX 4JLVA 1SVIA 5BN3A 2GJAA 2Q3MA 3TQFA 2OCBA 4MGYR 5IHPA 2ZR9A 4DVGA 2A7QA 2RGGA 1Y63A 3EASA 3QQ5A 4F93B 4A82A 2LKDA 1SGWA 3N2EA 4DEXA 1Q21A 4C0SA 1AS2A 5H1YA 3EZ6A 4KSCA 2YZ2A 2N42A 1EFHA 1E9EA 4US2R 2ZQ5A 1W36D 3PCRB 3THXB 1HURA 1U8AA 3BWDD 4D4MA 1G5PA 2QMUA 3LRPA 1UBEA 2H57A 3K8YA 4NCNA 2HUPA 2N46A 4PO8A 1YZKA 4OI2A 3SR0A 821PA 1NL3A 3L8YA 2JGNA 4CYMA 4A92A 3EA5A 4Q1EA 4EJSC 3IHLA 3GJ6A 3ICEA 3QNUA 1JR3E 1K8RA 1MR3F 1DAIA 1X86B 4TLCA 4D26A 3ECCA 2VHJA 2X77A 1XXHB 4MGZR 5EXXA 5BQ5A 3OIUA 1SHKA 3DVLA 2DHRA 2HEIA 4LC0A 2FF7A 2FG5A 1R10A 4HLCA 4RD0A 4NTZA 4DUGD 4DDWA 2W0MA 4Q00A 5FL7A 5J4LA 1HE1C 4QBGB 1GIAA 5B64A 4EUNA 1L2TA 4FMCB 4LRWA 1EFCA 3EIHA 4NCJA 5FTJA 1M6NA 3HPRA 4KHZA 3X1ZA 1V5WA 1UFQA 3R9IA 1TF2A 2OILA 1FOEB 4Q5IA 3E1SA 3FB4A 2WSSA 1R8QA 4PPFA 5K8UA 3LLUA 4C7OB 1EK0A 1OJLA 2R6GA 2X2EA 1H8HA 1S1MA 1G20E 2D7CA 1G1MA 3K0CC 2ZSBA 2O8CB 1E4YA 2JDID 5GJWC 3OE7A 2FFHA 2BV3A 4YLGA 1PZNA 4LJ5A 4FMBB 2XXAB 2FNAA 2Q0HA 2WSMA 3OESA 3BAFA 3ZJYA 1RC8A 3PUWA 2ZYTX 4RD1A 4LUCA 3ZLJA 5EXTA 3A36A 2ZS9A 5TY0A 1XMVA 2ZAOA 2IWHA 2IHBA 4BWYA 4Q4JA 1M34E 3FFAA 4YXWA 4QJ3A 5KNCA 4BPBA 2WPDD 3I8SA 2VQSA 1XPUA 2Q21A 4KYIB 2VL7A 4B48A 3QBVA 4BFXA 2FPLA 4D6PA 3B7GA 2GILA 2QUZA 1JQJC 2ZE6A 5BW8A 4WIAA 1P9RA 3B85A 2D2FA 1EX6A 2MSCB 4FCWA 2GAOA 4L5BA 1QHXA 1BYIA 4LJAA 2ZI4A 3I32A 2DYKA 3L2OB 3EX7C 8OHMA 4ESHA 4NBSA 4HZIA 1TEVA 1Z5ZA 2IXEA 4AKGA 4QL3A 4RZXA 2PCLA 2QRNA 2VP6A 2NG1A 2WJJA 3OEHA 4JLOA 3U5ZB 3IGFA 3RVBA 1J8YF 1SXJA 3DM5A 2FOLA 1ZIOA 2OFOA 3NC0C 4FMCF 2XNDA 1X8LA 2WHXA 3QXSA 2C9OA 1GVNB 1NVWQ 1CJVC 3E2IA 1KI3A 3A1TA 3K0FB 2IYXA 3ND8A 3K9NA 4LYJA 3RSOA 3ZQ6A 1KK0A 1XEXB 2GEDA 2ZJ2A 2F1RA 4GNKA 3TAUA 4BECA 2W00A 2H7VA 3MRSA 3R8CA 3DPUA 1MV5A 4MKIA 4GPTA 3ZQJA 5LB2A 2AXPA 3OEEA 1DG3A 2DR3A 2HT6A 1CP2A 2BM0A 1JAHA 3SBDA 3UG6A 1PLKA 1WXQA 2W2TA 4JLPA 4URXR 1WCV1 1IAQA 4Q9LA 5L3RA 1W7AA 1KDTA 2RGDA 1SKYE 3LA6A 2OFWA 3NBYC 1TL7C 4Q1FA 3SEAA 2BVNA 3GPLA 1GOTA 1YR6A 3OIVA 1SQ5A 1BS1A 5G40A 1BKDR 4LK2A 4A2WA 4AYTA 1S3GA 3TE6A 2C77A 3A1WA 2VPPA 1FQJA 3GLFB 1KI2A 1AKEA 2WKRA 1SZPA 3KQLA 3KUDA 5J40A 1U94A 4OJQA 2WBLC 1S1CA 2TMKA 2OV2A 2RGAA 4DJTA 4ZV4A 1A82A 3X1WA 1F2TA 1C9KA 1QHHA 1GKUB 2Z83A 3WBJA 3EWAA 4TYYA 5E4FA 5CIWA 3AP2A 3HP1A 2QSYA 1Z3IX 4DLUA 1Z0JA 5DYGA 1IY2A 3UWKA 2XOKD 4DLWA 4I1UA 2CL7X 1QVAA 1ZM4A 2V6IA 3Q7PA 1AZSC 1GP2A 2A5JA 3AKCA 3B6EA 3Q5EA 1KMQA 1YU9A 4IOLA 1EGAA 4M1KA 1II8B 5CK5A 1XXHE 4LDJA 3P27A 1KNQA 1VCMA 2XB4A 1LF0A 4YMSA 4OHVA 3CZPA 2ZI5A 1DOAA 4HAXA 5D3MB 1CULC 4OKSA 1NMZA 2JJ8A 3DMDA 4TT3A 4JBWA 1ZRHA 5SZKB 3GLFA 1N6HA 3HU1A 4TQAA 3R7WB 5CB8A 3U4QB 2F55A 2JJ2D 1WQ1R 5DI3A 4S2EA 4OHWA 4B32A 2JAQA 3GJ3A 2AXNA 1L4UA 1ESNA 1FL9A 1ZC4A 1E1QD 3BFXA 3ZD6A 1XPOA 4NYJR 3KDSE 4FINA 3B82A 3UXMA 1TMKA 2VP9A 5CITA 4UJ3A 4W9MC 2ZUCA 5CM9C 2BJVA 4JBYA 5HCNA 2JLVA 1JAIA 3V4FA 1JPNA 4AWXA 3LVQE 1W4AA 3QXJA 1Z08A 2O0KA 4QGGA 2HF9A 4RFVA 3FE2A 1QDEA 1W0JA 4LCBA 1E2KA 3DO6A 2GKSA 4Q9HA 2XZLA 2DWPA 3PR1A 4J0QA 4PZYA 5K8LA 3MFYA 1U8YA 2QU8A 4P33A 3QXCA 5AUQA 1QHNA 3HWSA 4JJKA 5K8TA 1NKTA 2C04A 3DDCA 3VMFA 2ZRJA 1CR2A 1DVRA 4G5OA 2IC5A 3R7WA 3TVTA 5FH9A 3U4QA 5K8IA 2IHYA 1G16A 1OXXK 2RHDA 2GZAA 4IW3B 5TVKA 3IDQA 4ERNA 1XP8A 2GZHA 1IM2A 5FBQB 3AVYA 4O3MA 1ZVQA 3TUJC 3EZ9A 1AKYA 1P5ZB 3WRYC 1R5BA 3AVTA 2MSEB 1OYYA 4P4UA 5ELXA 1YRBA 5CLQA 5JHHB 1NY5A 4PSVA 1ZD1A 1Z2AA 1E98A 2UZ3A 1KTVA 3WRXC 1UPTA 2PLFA 1TU3A 2NZ8A 5FUVA 2OXRA 3EAQA 4QRHA 4R98A 1VMAA 3NH6A 1XD2B 4ARZB 4A9AA 2OBNA 1R0XA 5DI9A 4M0LA 4KBFA 4MKFA 1ZNWA 5LPNA 1IXSB 5HE8A 5FBWB 1JR3D 5JWOA 2O0JA 4G0NA 2G1KA 4M53A 5G3ZA 4BFTA 1SKQA 3I92A 3RDPA 4HLUA 3SHFA 3ZZ0A 1KI4A 2ZS7A 2XAUA 3PEVA 5AUNB 2OM2A 2Q9CA 3I3SR 4UNSA 3VX4A 2L0XA 1Q3TA 3V4RA 2YWFA 1PUJA 3EPHA 4LHZA 2GDJA 2Z5FA 3L82B 3CF0A 1IONA 1GNPA 2HJGA 2VSOA 4ZI2A 4U00A 1HQCA 3ONWA 2CHVA 1N5KA 1N5JA 1G3MA 2VBCA 5BN4A 2QORA 4GOKA 2CCGA 2BCGY 4DHEA 1AZTA 4LJ8A 4RKFA 4Q01A 2Q6TA 4AD8A 4V0OA 1E9AA 2WWYA 1LW7A 2CK3D 1T6NA 2FJUA 3A1VA 1ELOA 5FR2A 3KXLA 1FQKA 3NXSA 2YKGA 2NO6A 3BK7A 2HJVA 3RNLA 1DAGA 1WE2A 1IOZA 3QJYA 3VQTA 4IHQA 1XD2A 5KUTA 2ZRIA 4BRWA 2FWRA 2RGCA 2J87A 3FOZA 4ASUA 4TLEA 3GLFE 1HT1E 2OCYC 4CEJB 3AB3A 3ICQB 3UANA 2FFQA 5D3QA 1XEWX 3KQNA 5KU1A 1GM5A 5AJXA 3EZ2A 4EPTA 1F60A 5KO2A 2C5LA 1OKKA 3EIEA 3NDBB 2G9NA 2AL7A 1TU4A 2OFXA 2ANCA 2REOA 2YOHA 4EPYA 4QM7A 2QE7D 2QI9C 1ZD8A 3ZYCA 2GCPA 4L15A 4TSFD 2JJ1D 4EFLA 2EYQA 2QENA 3QKRB 1CJMA 1G8HA 2GK6A 2GJ8A 4M9SA 3ZGXA 4FD2A 4Q1DA 4ZIRB 1W5TA 2ONKA 3C7KA 3KJIA 4FXPA 3WHKA 4ZKEA 4UXIA 4BZXA 1Q0UA 1E9BA 5FL3A 4D82A 4Z1MD 2R65A 1U2RA 3K9GA 2YOFA 2W58A 3HDTA 2GEUA 1Z29A 4U02A 2DBYA 3DZDA 3SZRA 4CEJA 5DN6A 2PX3A 3CM0A 4DCSA 2FX3A 4M1TA 2ODBA 4Q7KA 2IUSA 4LYAA 5HTKA 3PVSA 4RJLA 4BFYA 3BJIC 1OXSC 2FEOA 1YRAA 2JCSA 3CIOA 3HU2A 3HYRA 1DADA 4DC9A 1J99A 2JA1A 4KFSA 3K70C 4IDOA 4JS0A 5H70A 1E2NA 2BOVA 3C4JA 3CH5A 4TYPA 4TN1A 3RC3A 1EFRA 3BE4A 4Q02A 3RRYA 4I1SA 1IJFA 4P3YA 1GL7A 2FU5C 3GJXC 4ZIRA 4Q1BA 1G5RA 3TNFA 3F8TA 1RPZA 5LB4A 4B3DA 2WJIA 1VHTA 2BEJA 4W7SA 2J45A 4MA4A 4OHZA 4IDQA 4P0TA 5C46F 1DAHA 1G6OA 3CUEF 1FUKA 1AIPA 2CHQA 3T5GA 1Q44A 2VHCA 3Q7QA 3THOA 4OQXA 3ZH9B 2GEVA 1SXJC 3VAAA 2BBOA 3ETLA 3QXXA 1KI7A 2JEOA 2D3WA 5GVRA 1NJGA 3I73A 4H1UA 4IEEA 1VPLA 1ZCAA 3LD9A 1EWRA 4ZDWA 1DEKA 2IYTA 1NVVR 4N1AA 4AG6A 1P2VA 3K9HA 1KZGB 3VR1A 4LJ6A 4ITRC 2V54A 4KVGA 5JJIA 2IYRA 3UATA 1WP9A 2A3RA 1ZNYA 1JEEA 4JKIA 2YWHA 1GNRA 421PA 1AS3A 2GZDA 3A4NA 2ZRBA 2VA8A 2XSZD 1ZU4A 4K8OA 4TMXA 1I2MA 1I4LD 3EWSA 2D74A 1D2MA 5EXPA 3T1VA 3SQWA 2HLDA 2GJKA 2ZIAA 1CRQA 4PC6A 4D0GA 4D25A 4HAUA 2W6ID 1Z28A 3OFNA 1MO5A 1ZP6A 2IEZA 4I1OA 3SYLA 2PJZA 4QG7A 1CS4C 5DIFA 1LB1B 2CE7A 4NDZA 3SJBA 3TSZA 5GJCA 1P7CA 2ZJOA 4OI1A 1X1RA 2ZJZA 1BMFD 4KAXA 3WMEA 4OK5A 1P73A 2AWOA 3HPQA 5LBIA 3NTUA 5E95A 3VNUA 2AD5A 4XD7A 1XRJA 1DBSA 5HE9A 5KDOA 3DHWC 2H17A 2ODEA 3GLHB 3NEYA 4W5HA 2WJVA 3FDIA 2O8BB 4M21A 5E7IA 2VYFA 1OIWA 4M8NE 5UKDA 1RYHA 2HXSA 3TAHA 2J1LA 2CNWA 4XTRA 4PFSA 3B9PA 4PHTA 2PJRA 3NIBA 1NN3A 1AJEA 3OHMA 3JZMA 1PV4A 2PX0A 3EARA 4XWAA 1GILA 3FYHA 4ACBA 2IF0A 4TMTA 1CJUC 2LKCA 2RMKA 4Q4HA 4MDFA 3BBPA 4JJZA 5FTLA 1GNQA 4G5QA 5EE1A 5KHOC 2MSDB 5H68A 1E32A 1KIMA 4X8HA 3P4YA 4QNRA 1KY3A 2FSHA 1DO0A 1N6RA 1XTJA 2X1VA 2IS4A 4YQFA 1GKYA 3A1UA 4M9ZA 2R44A 2V9PA 1ONBA 3EZ7A 1E0SA 2XTMA 1GRQA 3TR5A 4B6EA 4IKEA 1L8QA 3SE0A 4DBLC 4N0DA 2QRZA 4OI0A 2QL6A 2C03A 4BZQA 2O8BA 3GLHA 2IT1A 1OB5A 2ECKA 3PUXA 1E2JA 4UKDA 2F9LA 2CMKA 3CPHA 5HKKA 2ZUDA 4RFSB 3W8RA 4C0LA 4QBFA 1DS6A 1Q1ZA 2YWEA 4E09A 5EE3A 3U60B 1R2QA 4TZ0A 3U3OA 1KSJA 1T9HA 3THYB 2B7BA 4B2LA 2E1RA 3F5FA 2ZSEA 5JS7A 2IS2A 4CEHA 1S0UA 3IO3A 1JJVA 3BH6A 1X8JA 1ZYUA 2ANBA 4UJ5A 3U2QA 4P4SB 2GA8A 1TPZA 3IEUA 1NY6A 1TUIA 4XOIA 3EC2A 2NO1A 2BMFA 4F92B 3EPLA 2XTZA 4Q4LA 1VYVA 3K0AA 3AV0B 2ZITA 1RRPA 2DPXA 3SFZA 3U3JA 1U0LA 2RH5A 4PZZA 1S9DA 2EQBA 1Q20A 4OYHA 1QHGA 1SVWA 5DO9A 4HAZA 3W6OA 1Z0DA 1NN1A 3CNOA 2ZANA 1MO4A 4UXJA 3TVDA 1TADA 2H92A 3TUZC 4JSYA 4DB2A 5A4JA 4D0LB 5CDFE 3AF0A 2KSQA 2ZRKA 4Q47A 2WM9B 2W2VA 3AEZA 1OSNA 3TMKA 3WXMA 4GFDA 4MYUA 2V1UA 1Z07A 1P3JA 1ZM9A 2OLKA 4H9GA 4IXNA 3SQXA 4DXAA 1T4GA 1ZM2A 2PT7A 2DWOA 3S1AA 3THYA 4L9WA 1D2EA 1U8ZA 2NGRA 2WWFA 1ZNZA 4EPXA 1HH4A 3B1YA 4B71A 4P4SA 3PXGA 2XJ4A 5B30A 3A6PC 4PAMA 1KYIA 2VP2A 1T5LA 3RC8A 4BRUA 2P65A 4ZPXA 2WIBA 4PPNA 1M1YE 2R8RA 1IBRA 1W48A 2J7PD 2D7DA 4KSBA 1G7RA 2Z4RA 3DL0A 1ZW6A 4ZCMA 2G0TA 4IXMA 3UIEA 3U3MA 1E0JA 5J5CA 1TQ4A 4HLUC 2ZSFA 5EZ6B 2QT0A 4M2LA 1YZQA 3LQQA 5EUMA 2I4IA 4B73A 1MO3A 1VTKA 1P6XA 1AQUA 1JNYA 4DDVA 3QG1A 5P21A 3H2YA 1NBMA 3HJNA 3U3KA 2FPMA 5FBVB 3GEHA 5C4GB 3ADKA 3G0HA 2GXAA 3GJ8A 3REFA 2WV9A 4LHWA 4QGFA 1DAEA 3EIQA 3W5IA 4HAYA 4FWIB 3T61A 2QTVB 3TBKA 3MCAA 1G9XA 3NG1A 3PITA 3W3AA 4IOMA 3F0TA 4NL4H 1E9FA 4TL9A 2IYQA 3H4MA 2ZE7A 3K09A 3AH8A 4HUQB 1T8TA 2KBFA 3CF2A 4Q4JB 4WZBE 4X8MA 5CJPA 1DE0A 1I4TD 4TL7A 4DEYA 1G3RA 4Q48A 1N0WA 4R2IA 2A5DA 3LW7A 3O8RA 1MO6A 2PLRA 1XF9A 2RHMA 4WW0A 4OHXA 2D06A 4ZDKA 3ADDA 2QTFA 1K5GA 4JZKA 3TRFA 3K70B 2XX3A 4LHXA 1CJTC 3R20A 5JRJA 2YWGA 1VKJA 1XDBA 4PAOA 1B0UA 3SJCA 3T12A 5JSZA 1E1RA 1OV4A 1VG9B 3BOSA 3IIJA 3KJEA 4GMXA 4MGIR 5FPTA 1GDDA 1ZCBA 3K9LA 4DSTA 1NSFA 1Z8FA 2NQ2C 1G21E 3REGA 1G19A 1ESMA 1GWNA 2A2ZA 1QHYA 5CM8B 4C4PA 2IUTA 2A30A 3AVWA 2A5GA 3PEUA 2QEQA 1COWA 4IDNA 3V00A 5JFGA 5GJBA 2AD1A 1SXJB 3QEOA 4MDEA 1OIVA 1FTSA 3LNCA 3RWMB 4B44A 3O8CA 2EFDB 4HUQA 3C14C 2JLSA 1TQDA 1IN4A 1XEWY 2F43B 4EAQA 1X8KA 2AFHE 3NKVA 4Q7MB 1MKYA 3VR6A 5CIQA 1OHHA 1JECA 3SJAA 1ZD9A 2OG2A 5AUOB 4M9XA 1RFLA 2GJSA 4G3XA 4TMWA 4IVPA 1WF3A 1FNNA 1UBGA 3ZIAD 4FI3C 3EPJA 4URVR 4Q9KA 4Q1CA 1UBFA 2J0VA 2I3BA 1E2EA 4XSGA 1F5NA 1HEIA 4FCVA 4HDOB 4ILEA 3WYAA 1DAFA 4C0QC 1KY2A 1UDXA 1UKVY 3P32A 2VIIA 2W6JA 4LWZA 4CGZA 3TW4A 3L43A 2OEPA 2ZJYA 4RCYA 5DLQC 3EZFA 3GD7A 4MITA 1ZUNB 3U6BA 3M1IA 3LDAA 4PQRA 1VDZA 3BH7A 4G1UC 4POAA 1Q1EA 5J4HA 3JVUA 4PANA 5DISB 1G41A 2KI5A 4N0EA 1JJ7A 4BQSA 1E79A 3CWQA 4Q1AA 4KFTA 2R6AA 1NF3A 2C8VA 1P9WA 4OJKA 4V0MA 2NPFA 5CYOA 2F43A 2BBSA 4CT5A 2ORVA 4ZCIA 1LF5A 1SVMA 3X1YA 2ZPTX 2ZU6A 4R71A 3KKOA 3K53A 3B1ZA 3R8FA 4A6XA 1L7VC 2BMDA 2QT1A 3ZVMA 2BM1A 1F2TB 2WKPA 1QHHB 4HDCA 1Z0FA 5FTNA 1TUEA 5AWFC 5KNDA 4RD2A 4DKXA 4KLNA 2QPTA 3ZZTA 1NBME 2VLIA 5JMTA 4G5GA 1WBBA 5FI0B 5FPHA 1A5TA 3UMFA 1NN0A 2IYLD 4W5WA 3GJ7A 1KJYA 2V7QA 4IDPA 1ZM3A 4PX9A 2WTUA 3UK6A 4NYIR 5IK2D 1IY1A 3ASZA 1CBUA 1XX6A 2D62A 2G6BA 3CPEA 3K0SA 4ZDJA 4MYHA 4D2IA 4U7DA 4MRNA 3MWJA 3RANA 2REXB 2GBLA 2GNOA 4CEIB 2UKDA 3AP1A 1KDPA 5TXGA 1MRSA 3IBYA
chains in the Genus database with same CATH superfamily
3NEPX 3HBAA 3T3MB 2PD3A 1VMKA 4AW9A 4WD3A 4DDUA 4UE6A 2XT9A 1S9HA 2IYYA 2WB4A 5F7ZA 5DXAA 3IP6A 4BB9A 5EWJB 1G2QA 2JLXA 1NWCA 2P9BA 4LE2A 5AJVB 4GOLD 2CKDA 2GTHA 4TS1A 1Y8ZA 4IJ5A 1J6UA 3C3MA 1SBQA 5EQJB 4LHYA 1CIPA 2BFEA 5C31A 4QAJA 5JQGA 2O2IA 1USKA 5HMLA 1A50B 1RLTA 2C5BA 2EZUA 3U4DA 2ZIEA 3HDJA 2K5UA 1V96A 1K06A 3LHFA 5FF9A 3RS2A 2JLQA 2I3ZA 4C7XA 3FCEA 4F04A 2XBMA 1X15A 2BEKA 2ZAMA 2HSGA 4B87A 4N8DA 1ZD3A 2V03A 5F1PA 3KUCA 3IJPA 4CDGA 4JI5B 2ZWOA 1JL3A 3M1LA 1GCGA 4CEIA 1CXZA 4Y9DA 4DLZA 3D6NB 3N2LA 4IHAA 4BNJA 5AW4A 2PE5A 1ICIA 1E5VA 3I28A 1X9HA 2ZLBA 3BFKA 4JSTA 1WMAA 2P5SA 3WB1A 3ZXIA 3BJZA 3U3ZA 3URMA 4DWOA 5KNBA 5EWJA 2B8EA 5LFAA 3I6ZA 2QQEA 4LJRA 5D5QA 3E81A 4QJIA 5FJIA 4F4DA 2CLFB 3FCAA 3OLVA 2CDBA 1GVHA 4WWHA 2AFIB 4FNGA 1C4XA 4Y6SA 3ND6A 1T8UA 4DCCA 1QF9A 2OT3B 2ZJ7A 3KOXA 3D0RA 3BJEA 3UPDA 2I7VA 2HBRA 3H9QA 2HK8A 2QUAA 3VSAA 2GPBA 4PICA 1VZ2A 4JFRA 5F77A 3AILA 1RBZA 1V8PA 2HCJB 4WLNA 2VRWA 2WSIA 3W6NA 3ZY4A 5JCZA 5TPZD 2WJPA 2XWSA 2JIZD 2IZZA 1X92A 2PGLA 1XALA 4OP1A 4RIHA 1T8SA 3BD6A 4EY5A 4LF5B 2V4MA 3V1MA 3E0XA 2FGJA 3SEZA 2XCSB 2Z0MA 3DE2X 1UBSB 3FETA 3TOZA 4BZWA 3HA7A 2RGRA 1V39A 1Z68A 2FQYA 1XLTA 3I8OA 5KWVA 3I2IA 3G9TA 4XWWA 1VIAA 1QVZA 2AZDA 2N3ZA 2JRCA 2X8AA 2Z5GA 3IX7A 2YC2C 4JOCA 3DP9A 1UPXA 1XU9A 3UUGA 1GQYA 5DGXA 4DIEA 2LIVA 3M1AA 3V8BA 3W6ZA 5GINE 2VYNA 4MGEA 1SB8A 3G5LA 2HX1A 2PBRA 2KJQA 3TTTA 4XDZA 3NOOA 4DT1B 3ZV6A 2AFIA 2MSWA 3WIVA 1FUUA 2NU6B 2VH2A 3VH4A 2EGUA 3R5XA 1EAYA 4P2GA 3OM8A 1IN5A 4UQPA 4CE6A 3NJRA 4IS2A 1GYPA 2ZDGA 2BF7A 3AFOA 2B1JA 3F46A 3OP1A 2IZOA 4O5AA 5CFMA 3HSKA 5KJ6A 1VHLA 1KC3A 4KJXA 4CMAA 1NKSA 4WL0A 1DZ3A 1XL0A 3LA8A 2JDIA 4YWJA 3O0DA 1K7FB 2H63A 1Y6GA 1XWIA 1ZGCA 3LQRA 4NSNA 3ZJ5A 2A8YA 3GEBA 2IXFA 4F3YA 2YTZA 3LUGA 1E4VA 3RHTA 2VI5A 4HY3A 4DWJA 5AD1A 5ICMA 1ND6A 2QYOA 2Y1KA 5LUBA 4NEGA 2WT8A 1CFZA 4QLAA 3QEJA 3LV8A 3W5HA 5DM60 1CB7A 1UPFA 3WYBA 4AIRA 3AR8A 5DTIA 1XELA 5DFAA 1VECA 4U7PB 5A5FA 1MABB 1Y7LA 4AY3A 1TFUA 3A9UA 3TYXA 4LJKA 2WPDA 5LQRA 3C1AA 5B6PA 3TMYA 1KJZA 2N1BA 4OQNA 2V9ZA 4CCWA 4DT1A 4EYOA 3OTIA 1R8XA 3V7FA 4Z7JA 4XM0A 2NU6A 3C5WP 4IGFA 3C24A 4R16A 3DQZA 3TCXB 1KR2A 1ZMTA 4H6PA 4ZFNA 3WYFA 4B34A 3FHJA 2FW1A 3QA3E 4X60A 2HSEA 4XVHA 3VJRA 3A37A 1ZICA 3CJQA 3KV3O 3MLBA 2B6HA 1Q3HA 1FFHA 2OHGA 4I7EA 4NX2A 5B58C 4X65B 2CUZA 3T9DA 1YSCA 1DUVG 2RAVA 1HDYA 2VP0A 3CISA 3KZOA 2QRUA 1BGVA 1J2RA 4F2WA 1UDAA 4D8UA 2JAUA 1AHNA 1GPYA 2BC9A 4QOFA 1N1MA 5A5VA 4UEOA 521PA 5HZHA 2A0YA 4KDEA 3IPLA 1JW9B 4LQ4A 2PT6A 2JAHA 2BD0A 2XMDA 2VKQA 1TEZA 4XOUA 1XQ1A 1ZEMA 1E1YA 3QPUA 1UXIA 4BO8A 3QM1A 1GLGA 4FYKA 5EERA 4AECA 4I50F 1KU6A 1MABA 4B82A 1NN5A 2PUEA 2BBTA 2PEYA 1O77A 2J0QA 4WZAB 2CB0A 4I99A 4MUBA 1ZZEA 5KVCA 5ABPA 2UUPA 3ICPA 1Z06A 3GRCA 4P3PA 3K0BA 3E8MA 1B74A 3BA1A 1U9JA 3B1WA 5K03A 5KWIA 2I1QA 4DC0A 4V1CI 3MUFA 1R0ZA 5CEJA 1EX9A 2G5PA 3HKEA 2J7KA 3NT4A 4FGJA 4GZLA 2NZ2A 2CVFA 1OOEA 4FMDB 2VWPA 3E9MA 1T3HA 5FKJA 1RXVA 5M34A 1ZGZA 5HG0A 3RNOA 4ZTZB 1Y3AA 1OASA 2OYCA 1CZKA 2TECE 1TTTA 1H2FA 2IV7A 2RKWA 1GV0A 1SO8A 2XJ9A 3I37X 2JCGA 4LDNA 6NULA 4HN4B 2RGEA 3DKIA 2ZJ8A 2QVBA 2XNKA 3LO5A 3S5UA 3V97A 4BVKA 1YR3A 4YCDA 7REQB 1Y1QA 2BJWA 4UMVA 2I54A 4JLJA 4KUHA 5KDLA 1VHWA 3G5UA 4TOIA 4NOKA 4FJ1A 2ADFA 4D8TA 5AW3A 1VCHA 2PKEA 3B1VA 4R1TA 4PXYA 1KFJB 2AJBA 2EKLA 2G71A 2WG0A 3TK1A 5CT5A 4DQUA 3KKLA 3EW9A 3UB3A 5CG2A 3RSGA 1TM7E 2HTEA 4Q3BA 1MAWA 1Q77A 4LN1A 1R6BX 2OGTA 4QEKA 1YONA 2D4HA 5EP3A 4MUAA 5LA6F 4BGVA 4EYGA 3IJ5A 4Y9SA 3T1OA 3E7PA 1U6KA 3P9QA 4DG9A 1MJ5A 3JQDA 1SOWA 3L1KA 5H82A 5LMNB 1KOFA 4UC0A 4RLQA 2RHJA 2XMPA 1GPDG 1PR9A 3L92A 4O2AB 4F2DA 1B1CA 1LS6A 1JLMA 4YUWA 5BMVB 5BSGA 5C52B 5BOSA 4X20B 3HB4X 1FDOA 2VJYA 3H4VA 3MUNA 1FLDA 3GFVA 4PN3A 1I36A 3SU8A 3RWOA 2H8GA 3B89A 4EF6A 5F23A 2EU8A 4BU0A 4C07A 1M7GA 3HUUA 5DU2A 5KPJA 4Q19A 1UK6A 2OKGA 1TJ3A 1ODJA 1ZN8A 4FIZA 4YJ3B 5AFSA 1U9IA 2H0AA 5F3RA 5MDHA 1G3UA 1RTKA 5U9CA 4R41A 4BJ6A 1QSGA 1XTQA 5CP8A 4EA7A 3OT1A 1N0UA 1L4YA 2AZXA 2GXUA 5BNZA 1N6LA 4CQNA 3V1UA 3K4HA 1WSWA 2C1XA 4NBUA 4O4JB 1OTHA 3LRXA 5JECA 1QE0A 4PE5B 3BFPA 3I12A 1KERA 1SCKA 5H4GA 2CNLA 2G83A 4GEKA 3I3OA 3HUFA 2HN9A 1LDMA 2B35A 3D3EA 3H11B 1A2OA 2I8LA 3O2NA 3QIAA 3QVJA 4PHFA 3SZMA 1JU9A 1WIWA 1MO2A 3D81A 1P33A 1XMIA 4Z9XA 5JSUA 3ZWXA 2XDWA 1US8A 3AGPA 1QRUA 5F98A 4G26A 1LPSA 2QGZA 2QW8A 3KJZA 5JS8A 4D79A 2IELA 4MW6A 4OHUA 4X20A 3TD6A 3VGJA 1FJHA 1FU8A 3OLCX 4DQXA 1CRPA 1H2RS 4KG7A 3UJ7A 2HA6A 2J3KA 5IYZB 5G0WA 1QGUB 3CU5A 3UTDA 1VMEA 1DEXA 1D2NA 2XH8A 1GGKA 1XG5A 4N0QA 4ZODA 1JE0A 2XUJA 4BTLA 5AXAA 5IDQA 1JFTA 2G5TA 2VATA 3NVAA 5ALZA 3ZU3A 2R6ZA 5LYYA 3PQEA 4A4DA 1L4HA 4GL2A 1KU0A 2FPRA 4QGHA 3U7FB 1YC5A 2C97A 5LR6A 3A1DA 2VVTA 2G9ZA 1UBKS 2A5FA 2FFAA 2VUIB 3II6X 3GFBA 4RF5A 5JSHA 5A02A 1FX0A 3AERA 3E3LA 2PRYA 4F6RB 2QM8A 3GBVA 4IH4A 3RJ5A 3ZWAA 4EECA 4EJ0A 1IZ8A 1T2FA 1A9SA 2R96A 3BYZA 1ZOLA 3O6VA 1NAHA 1RW4A 1X3LA 1EBUA 3A58B 3H11A 2LCIA 3RM3A 2AW3A 3NC1C 1OAOA 3WX0A 1ZXLA 4GI5A 3L6OO 1GG2A 1RI3A 3NM4A 5A04A 1LNZA 3GJ5A 5DNDA 3LLCA 3TZQA 2GWRA 2OBYA 3AF3A 4FBLA 1Z2CA 5FWDA 4PYKA 2AG0A 1LZKA 2CVOA 5ICCA 1D6SA 1ZAKA 1PFWA 3GLGB 3GIWA 4PGFA 1M1NB 2F3SA 4OD0A 3ZCRA 1CR0A 1THTA 1QGUA 2IYZA 1KQ3A 1L4FA 4QECA 2C1EA 3PICA 4ZN6A 4KUGA 3LC2O 2QUJA 5F1OA 3BEDA 2ZBDA 3DE1X 3NFYA 3KR2A 3FRJA 4UNRA 3KUKA 3AF6A 2GTIA 1JR6A 2C4WA 4QELA 2A9VA 1ODTC 2OB2A 1ISIA 1XOIA 2AEJA 3EIUA 2Q5CA 2ZSDA 3MT8A 3GRVA 3FKSA 5HGJA 3ULKA 3GJ0A 4OXNA 3AZQA 3FTFA 1S3SA 2EGHA 4GMKA 1DKMA 4AP5A 4RW0A 5CW2A 3RIHA 5K0ZA 4QLOA 1F3OA 1NVUQ 2AN4A 4WZAE 1J25A 1CUBA 2XNDD 3L0DA 2CVHA 5F9FA 2B94A 3A3KA 1UKAA 5KQLA 2Q2OA 3OH8A 4RKWA 3OURA 4GC5A 4E70A 1F8UA 2I8CA 3CWZA 2LWIA 1SCBA 2E4ZA 2WWXA 4TX1A 3U4CA 4DSNA 4GM0A 4TRMA 5AW2A 5E3HA 1I13A 2OXFA 1J2YA 4FKZA 4HDMA 1M3SA 4OB7A 3R0JA 2B5VA 4ZA2A 1R7RA 2ZI7A 1N2OA 1ZL0A 2B8TA 2Q62A 5HQ3B 3ZDYB 1WD5A 2TMDA 3ANMA 3O9VA 4X1IB 3MELA 1O94D 3E82A 4Z51A 1V3UA 3IP8A 2B4TO 3AY6A 1M1NA 3GLGA 1U28A 5D3MB 4RCZA 2CXXA 2SHKA 3B5JA 3E1GA 1W49A 5B6IA 4GAEA 2P30A 4L8GA 5TV2A 3VNVA 1Q6ZA 2D8MA 3ZR4B 2BMEA 1Y6JA 2ZTVA 3QYAA 4UDOA 1TB4A 2ATXA 3DBOB 3H5TA 3WGZA 4TM7A 4J6EA 2H2AA 2JLUA 3U44A 1BGWA 1XRNA 2D5LA 4IUBS 4P34A 1KDOA 5E9WA 4LXGA 2Q4RA 5TE9A 1NRWA 5CT6A 4WOBA 5IAKA 3CGGA 1MX5A 1B2RA 2R4QA 2RSLA 3HCDA 4P2BA 3SBOA 3EMVA 4IAOA 1ZI6A 2QU7A 1TZCA 1MDBA 1N6OA 3CTPA 3ETJA 4FLEA 4L5YA 4MVXA 4PZ9A 5CLLA 3K73O 1WCIA 3CRMA 3QFRA 1QG2A 4FKBA 1FFWA 3SR4A 1VI5A 3W1WA 3RS9A 1PJAA 1QV9A 5E38A 2FZ5A 4L9RA 3R5TA 4X7RA 2ZB3A 2NACA 4YRJA 4EJ2A 4KLAA 1KF0A 4QUAA 1U3FA 3NCTA 3GRFA 4V0LA 2J67A 4B7UA 3P0JA 4QTTB 2MDTA 1A95A 4YQZA 3UMMA 2IK8A 2BGIA 3KKKA 3OPQA 3IEVA 1M34A 2J32A 4J7XA 4KWTA 4EHLA 1R5OA 2QP4A 2VZLA 4X1IA 1N2BA 2VBGA 1FJ2A 3D6JA 1ULBA 4OFZA 4RZ2A 4YMHA 1KEUA 3UICA 3VR4A 1XLWA 2W2OA 5K4GA 4UTXA 3OPYB 4WRRA 2PZBA 1OF1A 3KX2A 3N53A 1KZ6A 5TQVA 2HRQA 4DMKA 4Q4AA 2PSEA 3MMXA 4H1WA 1S7GA 1UADA 3MMPA 4J91A 3KHSA 2Y27A 1CQIA 1ZY2A 4YRBA 4X3OA 4ENVA 4YXFA 1C29B 3LT5A 4BQNA 1DG1G 1X9GA 3NCHA 4CIDA 4MS4B 3LBIA 4ZJPA 1B4DA 4P4GA 4PZPA 1O8BA 4US1R 4A5SA 1IBLB 4NCBA 4LJ9A 4KQMA 3CO5A 3WYEA 4NBRA 4XXHA 2OPHA 3LQ2A 3AHDA 3SF8A 4EF4A 2FUNB 3I6YA 2JD1A 4TT3D 3MAAC 2X0EA 1E2LA 2DSNA 3R0IA 1KBOA 3WYGA 4AI6A 1LPNA 4I3HA 3M9LA 1PGNA 3OCWA 4UUQA 3WHIA 4AP6A 3LL7A 1HDXA 3O4RA 5FAXA 2QM3A 3CLVA 1B14A 1CZUA 2IYWA 2NO0A 1JEAA 3CH6A 3FYTA 2R8YA 3JWGA 4AMVA 1XD8A 1JWLA 2YNMC 4J1SA 2BL4A 4UUMA 4DLBA 2JLWA 2FW8A 4DABA 5KHAA 2IF2A 1W4ZA 2A0UA 2EFCB 3LVFO 3T4UA 2C61A 3CVUA 1QGAA 5AI4A 2P3SA 3STVA 3V2GA 5A3RA 1CZHA 3Q8KA 1IEVA 5JNSA 1NQUA 4C7MA 3OPYA 4CM9A 3RAPR 5ANRB 2E37A 1QOPB 2D1SA 2ENUA 3T4XA 4L27A 5LD2C 3KELA 3VPHA 3R3YA 4YV1A 1E9VA 4TMFA 4YPOA 1NGSA 4BCBA 4KQJA 2D0PB 4AS1A 5HFAA 4OAPA 1I6MA 1J07A 3H7AA 3SNHA 3NORA 2FPUA 3OAAA 4AULA 1XVTA 3EULA 1OI2A 3O2QB 4CKZA 4HH1A 1N3LA 4B0PA 5JYEA 2JC3A 1F48A 1H65A 5EIBC 1VLJA 2XNSA 3CB4A 4BFLA 3DVRX 1W2HA 1KZ7B 3AF1A 5I5EA 1JBEA 5EE0A 2MOKA 4N3NA 3ZE2B 1H2BA 1CEYA 4HKTA 5FUYA 1I2AA 4FYHA 4BGIA 3M5CA 1F06A 3QG5A 4E7PA 4ZARA 5FOWA 5B1EA 3QPAA 1ORTA 4EFMA 2XYPA 5EZ5A 4YJDA 5A4IS 4UMDA 2FUG1 2EW1A 2BISA 1Q84A 4AJOA 4RD4A 1H05A 1DKQA 2OXEA 1DRJA 4WECA 5DLYA 1U1EA 4OFWA 5DV9A 3V7YA 4AP9A 4F4UA 1LD3A 1BXZA 1FS4A 2ZTHA 1BJKA 3TN7A 2DE0X 3OO0A 3BDVA 2D5IA 5B7QA 4G86A 5JMPA 4FW9A 1JFSA 1J1UA 5AHWA 2ZT6A 1A9ZA 1KQGA 4KDFA 4ARCA 1UQTA 5E7JA 4KFRA 4LC1A 2A35A 5FHQA 3UV3A 3I1FA 1IHYA 4MCJA 1GQFA 1XEAA 5IX8A 2C82A 2CBZA 3FRIA 1E6WA 4KFUA 5A05A 3JQRA 3VZCA 3BZWA 2BFOA 2M2IA 3EOZA 3JX9A 1F9EA 1XPRA 1UT8A 3LDGA 2XMBA 5JO0A 2PLAA 5DHPA 3OO1A 3MTIA 3HWRA 4FPXA 2E48A 3JVIA 3PSAA 2PMEA 3SYRA 4RSMA 3NEJA 1URPA 4LXTA 5TGZA 1UH5A 4RQTA 3D8BA 2FB9A 3KQUA 1YHYA 4NK4A 1F17A 3GZNB 3LECA 1A7JA 1XXHA 4FHFA 4ILKA 3QLVA 2CZCA 2PSHA 2JANA 1CF4A 1NVXQ 2J41A 4CFSA 1D1SA 3EQZA 4Y7CA 3SJUA 1P19A 5IKPA 1GEGA 4NFSA 3R7AA 4GX2A 5JJCA 1D03A 4GRAA 4FCCA 3ROQA 2RKOA 4BBJA 1H4QA 3AF2A 3I04A 4HFRA 1O3YA 2V98A 1W581 3LUPA 3CSSA 4HO1X 4MMYB 5CXSA 3JPWA 3KAQA 1GV1A 1QWOA 1YZTA 3F6BX 1A9RA 5L3ZA 5TMBA 1SG9A 1P61B 2GN6A 3H9UA 2AMLA 1A9XB 2MMCA 2X86A 3ENWA 3MINA 4FSXA 5AJYA 3VZDA 4BBAA 5I9NA 1PG0A 2Q3DA 3O5AA 1UP4A 4JQZA 3E6AA 3BRWD 1QG6A 4Z7QB 3QBDA 3Q7IA 3D5EA 4X1KB 3G13A 5DBOA 3WB9A 1EVIA 2OUIA 1IG3A 1XZAA 4LTMA 2O8CA 2X9QA 3UMRA 1M54A 2Q6IA 5JI2E 1QQ7A 4POOA 2X15A 3B8EA 4R7ZA 1TMOA 2AV6A 1DIRA 1CUYA 3FN4A 4REOA 3WS7A 4ARAA 1ML3A 1N5DA 3CEHA 4UMFA 2JNWA 3LFUA 4KIJA 2HA7A 1CDOA 1ZHHA 2JIMA 3GZNA 4JYZA 4MKXA 1I7NA 3QVMA 3KKNA 1SZCA 3DMFA 3N2YA 5BWBA 3LX4A 3E9QA 1XMSA 4OQLA 1EXWA 2IIVA 2J9GA 2G40A 3HU5A 2H85A 3FI0A 1YQTA 4FFSA 2WUVA 4L8FA 4N3GA 1E1NA 1G4AE 3CRVA 1JYSA 3SEQA 2WQ6A 2QLMA 1P1JA 5LZ5A 3RK0A 3TQSA 3WKAA 3OPVA 5EJ8A 3A9WA 2YINC 4LF6B 5BWNA 4JVMA 1E3EA 3PJFA 1YJCA 3TLCA 2H1OA 5LXTF 3B78A 1HZZA 5HZKA 3L4KA 3NDPA 5MN5A 3DA8A 1LFDB 2Y1EA 3ZWVA 3GK3A 2DFKB 3ILHA 5L95A 1A9XA 2C58A 5U1PA 3F2VA 4KQGA 4YCCA 3O7MA 3U61B 1FTYA 2XHEA 4U2FA 1P2SA 4GXQA 3DMTA 3F9IA 4H27A 4X1KA 5IDXA 1C7RA 2AHOA 1DI0A 3QUAA 4YAOA 2IX3A 5A0TA 1CUXA 1QFSA 5DH9A 1YL5A 1XZIA 1VYUA 2IY9A 1CIJA 2QZZA 4Y2XA 1XNHA 1RTTA 2BDTA 1NOKA 1AA9A 3EUEA 3KFVA 2IH4A 1Q7TA 1N2EA 1BVUA 3NC4A 4JBNA 4F5DA 3KKPA 1XKTA 1MEJA 2QIOA 2FSIA 4J76A 5TX7A 5CB4F 1OC2A 1XAJA 2C2GA 3WAJA 5IN4A 1MX1A 1XDUA 3UB2A 1JSCA 1A4UA 1X1BA 3UT6A 2YOGA 3HABA 4KW7A 4TKMA 5EJ7A 2ONZA 4F45A 2Q5JA 2BPOA 1K5HA 3MWDB 1OVMA 3MWFA 3TL3A 3KT8A 1OLUA 5AKIA 1GQRA 1V8BA 3WOHA 1P1IA 1UDCA 2PS0A 3PGXA 2VOEA 3ZWCA 4MK4A 4NZMA 3TKAA 3EH2A 1LBSA 1EFRD 2OBFA 1R6XA 2PMKA 3G6KA 2PT9A 3UXEA 3H2HA 4CN9A 2P4SA 5EEHA 9GPBA 2AGVA 3BPSA 1FNCA 4OSOA 4A8JC 4O2BB 1U98A 4NZZA 2VJLA 4YFVA 1Z0KA 1A98A 4B3MB 1LK0A 1ABEA 1BX3A 2IYOA 3BTVA 5HF9A 2OV3A 2V7UA 3KL2A 3JQ8B 4N47A 4A15A 2C7QA 3AEUB 4JT4A 2GCIA 4OYRA 1AUOA 3N8KA 3EAFA 3KKEA 1NVEA 3ZZUA 5BWOA 1U63A 3RUEA 4M1EA 2Z30A 3SSOA 2X2FA 3DE5X 3KD3A 3PD7A 1YUMA 3OZGA 5JQGF 3THWB 1G5TA 4IR7A 4E2ZA 2FHPA 5THQA 1D2CA 5F2EA 3WE7A 3L0SA 4KU4A 5IJXA 1OVGA 2YV1A 4I6EA 1FYXA 3B9RA 3OPYI 4IBOA 2CXHA 1KI6B 4TSKA 1PZGA 4M1MA 1DINA 2QG6A 4X00A 2WWVD 4NXMB 2CD9A 4TL8A 5JAOA 1WDKA 1LV7A 1UANA 1C0KA 2G63A 3MZ0A 4PCVA 2OAQ1 4BMVA 2O8NA 1JA9A 3E3MA 1EX1A 2CD7A 3MWDA 4KK3A 3U3DA 2YZMA 4EDHA 4Y3UA 1FDRA 3DYIA 1RVDA 4WVFA 4HHEA 4CHGA 4LF9B 3DULA 3QKIA 4BN0A 2J6CA 3AF4A 4GMDA 4XM1A 3V2IA 2GESA 3QHQA 4RE5A 5JIBA 3PPVA 1BQ4A 4NCXA 1W35A 2ORWA 2YIMA 5EKUA 3I53A 4NIMA 4IFIA 4D6YA 4O2BA 1AXRA 3LBHA 4R2KA 4GRDA 1SBNE 2CNOA 3R3WA 1PT7A 3PENA 1RLMA 4CMJA 5JR3A 2OFFA 1SCUA 3ED5A 1BE6A 2JLBA 3RG8A 3G49A 3RTEA 3CO0S 4QFCA 1VQ1A 3DOEA 2PH3A 3GMIA 3JQ8A 3AEUA 3RFUA 2OA0A 2AOTA 1T0JB 1W87A 1BOOA 3WWYA 6LDHA 2B3DA 4I36A 4JOQA 4HP8A 1F14A 2R9VA 1QHEA 4Q16A 2GN0A 4Q9IA 1UJMA 1P4RA 3KZNA 3TZCA 1BOFA 4JI0B 1JP7A 3Q6IA 4OH1A 4CODB 4YV7A 1E0KA 3ZVNA 1FYEA 2Q9BA 3VGPA 1ZMXA 4EOGA 1X80A 3EIWA 3VR2A 1KI6A 1R0BA 2PMBA 4BLTA 4CMEA 3EQ7A 3PTZA 3RS4A 5LNK1 2FQQA 5CVCA 3HBNA 4B76A 2QTZA 1CE8B 3O4VA 4WLEA 2FSFA 5BNTA 1P6QA 1I9GA 2E9SA 3H87A 2MT9A 5LD2B 4ZI7A 1NU6A 2VBIA 1BKSB 2RGNA 3BGDA 3BGWA 3I9V1 4A7PA 1J7KA 4O4HB 2CZGA 3AEQB 4W8HA 4XSVA 4YDSA 4N9WA 4ZVMA 1N2CB 3PEWA 4KNYA 1Q1QA 2ATVA 2YX1A 1W5BA 1PEKE 4R5HA 4R8MA 1SRQA 2PX8A 4L08A 4L4ZA 4N3CA 5CCDA 3CVVA 3DW1X 5ALEA 2BUAA 2ZBFA 3AHFA 3X1KA 2Z57A 1E2GA 4I1VA 4TRRA 1KORA 3KPVA 2J0SA 1JIUA 1VP9A 4CKYA 3ZY6A 4J07A 2WWHA 4WE3A 3ZQUA 1UOOA 4NBVA 1WXHA 3FSEA 4KEAA 2YV5A 3HEMA 3VSBA 4EATA 1ENOA 3DTYA 4Q39A 4O8CA 4W63A 3A4LA 1HFKA 3FKSD 3H3JA 3BWXA 1PT5A 1R4AA 1NPDA 2W70A 3FTQA 3BQ9A 2WR8A 1NWHA 3ONEA 3SBEA 4HVTA 5JPCA 1YQEA 2F1IA 2F9FA 3PC4A 1NG1A 3O1LA 3FNEA 4PZUA 1T2DA 1CE8A 3IKJA 3ZD7A 3R41A 5IAEA 4HQOA 2ZB8A 5CW1A 5JEEA 2NUPA 3S2YA 1OFVA 3G2JA 1XZPA 3ZHUA 2D0OB 4M8SA 3UAVA 1P91A 2EKZA 1ZOPA 2AQKA 1NTOA 2H29A 2WP0A 5HKKD 1YKFA 3P2OA 3RYCB 4BNXA 3MLEA 2AI3A 3AEQA 1Q57A 5EP2A 3SK0A 2X19A 4LJLA 1GFSA 5CEFA 4MWCA 4IEIA 4WKCA 3UPTA 3IIKA 4ROSA 2JKZA 4EHAA 3NAGA 1FSFA 1NPTO 4JXJA 2VDMB 3HQ4O 4ZRMA 1UJ6A 2F1OA 4HWKA 5EI5A 1QGDA 3GG9A 5FO1A 3OG9A 4BEJA 4XR9A 4EY6A 1IN1A 2VT3A 2C94A 5IZCA 4MW2A 3ACDA 4LVOA 5M29A 5KJCA 4K9LA 1VLVA 4B3CA 4CVNA 3VFDA 3LZDA 5KJ1A 3M0EA 3KALA 1BU8A 5DP2A 1VRVA 5ALUA 2PZEA 1PR0A 4JBXA 1WX1A 1FSGA 2JIBA 2O1WA 3VNAA 5EHQA 3NWJA 2RB4A 3UV7A 4RO0A 2Y6VA 1X7DA 4H6XA 3MB8A 1ZGBA 3M5WA 3LCMA 4XEUA 5CFQA 1OCEA 2XCOA 3C7CB 3IQDB 5IANA 1P1CA 2FJPA 2H18A 3EEBA 4OUDB 1GITA 3SDBA 3DLHA 2HO5A 4RPKA 3SBXA 3WGVA 2W93A 2ZRGA 5CJ2A 2G7MC 5C1BA 1W47A 3R40A 2BZ0A 2W0SA 4JY7A 3BJRA 1IIRA 2MTBA 4PYOA 5G3YA 3P1JA 5BQOA 3NONA 4UATA 1TJ5A 3RYCA 3I04M 2JBWA 4GF5A 2VCYA 4RGQA 4DDKA 1D8TA 5ALGA 5FBLB 3CX6A 1E69A 2BFMA 1V5IA 1YT5A 2WZBA 3KR1A 4TLDA 3OIWA 3SIWA 3P19A 2XWJI 2V4ZA 1UBLS 1NUPA 1SUCA 2ZROA 3K94A 3ORQA 4HAVA 2JGDB 4HEA1 3S99A 1NXXA 1Q22A 1YCDA 2OPBA 1CJCA 1EE1A 4IGEA 4G23A 1P6UA 4IOJA 5FOTA 5BXYA 3H42B 2OV1A 3A05A 3GFSA 2V55B 1HL3A 3A06A 1RAFA 3PLRA 3S6JA 2GARA 4X44A 2GR9A 4U9UA 1ZVMA 2OP0A 4HDAA 3UB4A 2RHWA 3T3EA 4N03A 5F3WB 4KAAA 4XEHA 4JVSB 4ZT4A 3ZTYA 1YS9A 1NNEA 3FF1A 2O19A 4JNCA 4GYKA 1WRBA 3GDFA 3RHZA 4LSMA 3NS7A 4DLYA 2Y1FA 2YUTA 4EHJA 5CA1B 4JP8A 4GPEA 1R5NA 2HWUA 2B20A 2IHJA 1SUSA 3JCZA 3QKTA 1A9PA 4BL5A 1W8IA 1Y98A 1IWOA 2I22A 3K4QA 4IJ6A 3G2KA 2IBMA 4RPIA 3PWTA 1TQ6A 1XRLA 2V97A 1P7YA 4DLVA 4AQYB 4GEGA 1E5TA 1TQ2A 1XB2A 1F4PA 2XTAA 3D1JA 3NH9A 1C8LA 1UKEA 3I0NA 4R2MA 4B2IA 3RADC 1L7OA 7GPBA 1WBJB 1FLAA 2JGDA 1YJAA 1OH7A 5K0FA 1H6DA 1GGFA 4ZICA 4QFDA 2XE6A 3CLRC 4XQGA 2QAJA 1U3GA 1WXWA 3QNMA 1W1IA 1PG5A 3QEMA 4R40A 3Q3JB 1LPMA 5BNWA 3RYFB 1POXA 1PNOA 1Q15A 3OAAD 4OF4A 3F3KA 3C39A 4FMDF 5EE9A 5K3CA 2P8SA 2R87A 1A96A 1YDGA 4LXIA 4C6SA 2CMGA 2VZ0A 1LX7A 3CXUA 4RZ3A 6ABPA 2H59A 3TVYA 1CWUA 5CA1A 2BMAA 1E1RD 4MRPA 1NQXA 3OZTA 4MUXA 3RUPA 1BDIA 5TEWA 3H5VA 4MVJP 5KKAA 1MENA 3CUUA 2E6KA 4JROA 1RLIA 1ESCA 2QR3A 3AVUA 1UZLA 4P0PB 4A8JB 2EFGA 1N2CE 2WMNB 1GUAA 4LZOA 5A2QA 3EXFB 5AT1A 3FCOA 4UAUA 1S8AA 3DYBA 4RHXA 5EVCA 5EAIA 4C6TB 4B74A 3QKUA 1SD2A 4P7KA 3NBMA 4I4TB 5I3ZA 4WOJA 3PR3A 1VCIA 1U8EA 5K6TA 1DQPA 4KKXB 1RYDA 2HYIC 4P5EA 2EIXA 3Q9LA 2A7XA 1P4AA 3B3AA 2P0AA 4M8LA 4DQDA 4IIDA 3VDNB 1WB9A 3ZQKA 1UXHA 4MEBA 3I39X 3RAGA 3VR6D 3ZHCA 1JXOA 2PUJA 2WMDA 4M54A 1BIFA 3ROTA 1DC5A 1GZSA 1UEJA 1YOVB 3EG5A 3WB0A 4C76A 4G8CA 4PTYA 3DDWA 5IJ9A 5I51A 2Y68A 3INTA 1SVSA 3N2ZB 3COVA 4KYUA 1Z62A 2KWIA 4MUEA 4UBLA 3LKZA 2FEAA 3IOCA 1C80A 1QTNA 3UY4A 1ZH0A 3MM4A 1HI9A 2C3YA 4G0ZA 4JBHA 4MVJA 3F3SA 1KBZA 1M1YA 2OFPA 2GN1A 1H2WA 4HB3A 5GQSA 5LUAA 1I51A 4ZXPA 4CQMD 1YS2X 2ZI3A 2PFSA 3GRPA 3IOMA 3JAWB 4WN3A 4BO5A 3FVTA 4EB6B 2XZPA 2CHGA 3TIXB 1W75A 3FPCA 3MJSA 4BBPA 5AM5A 3OHSX 3MAJA 2BLLA 2VK4A 3NT2A 4C6TA 1T1GA 4CUJA 1NFQA 1T13A 3N59A 4G24A 1O0BA 3MTAA 1MEOA 4P3OA 4R1MA 4I4TA 2QVGA 1YZFA 3SS8A 1B0AA 2C3MA 3RI3A 1NRIA 4HVCA 1E3MA 1NATA 1G8YA 5BR7A 1XHLA 3EEFA 2PFGA 4GMFA 3TAXA 3TSWA 3T5AA 1O6ZA 3KYBA 2ONCA 1NBWB 3CX4A 5EZYB 1XVVA 2IX9A 3ECAA 3WQRA 2YBEA 2H4FA 4QA9A 5T5QA 1AMUA 1Y8AA 3A1CA 4UM9B 2D54A 3QUBA 7ABPA 3Q6NA 4DIFA 5CLHA 4UXHA 1JDZA 1GPKA 1BU5A 1PEDA 1ORWA 4L6CA 1QYIA 3WQQA 1YOVA 4D99A 5I7SA 2Y1WA 2VHVA 5KNDD 3E5MA 1JQEA 1XRRA 2FZGA 2R1VA 2QTAA 4MI1A 4JLBA 1ISJA 4ZEWA 1IXRC 1Y5LA 5EXEA 3VHXA 1U8CB 2EW2A 5JS1A 1ULHA 3O4IA 3TSOA 2AG5A 1M5TA 2FEKA 1AKWA 2A59A 3PJGA 4TYMA 1W4LA 4D9IA 4NBWA 4G5RA 1FW6A 3BB1A 4DLSA 5HIMA 2VTVA 4OHPA 5LP6C 5E9AA 4U9HS 4XJXA 3N6VA 4LF4B 4HUTA 3JAWA 1W0KA 4DMUB 5I45A 4EB6A 1JG7A 2O7RA 1LPAB 2H5EA 2QGNA 3I9OA 3VA7A 3VH1A 3TNJA 3BXOA 3IHWA 2VWGA 2Z8XA 1PFUA 1KQFA 1AXEA 2X8WA 2H8KA 1E7RA 1ZIXA 4C0XA 3HS3A 4DA8A 1R6AA 3JAMA 4H3HB 2WAXA 3QWBA 2JHCA 2W8BB 2Q4TA 4MUYA 1HR0B 5CNMA 4KR7A 5ALFA 5EZYA 3ZQ4A 2Z9BA 1NNSA 2I67A 1VRWA 3C41J 4YK7A 2WU1A 4BMYA 4EK9A 2QRVB 1XCBA 2Q3FA 3B1XA 1AKVA 1X6VA 1XTIA 2DF8A 1WUHS 2RGWA 3G2NA 3PP8A 3Q2IA 3WLIA 4BE9A 3HLTA 1OE0A 2AVDA 2NNLD 2QTRA 5IABA 3W2EA 1EK1A 4DLPA 4U7WA 3D7RA 3IQZA 2ZJAA 1XLVA 2H7CA 1N57A 1WKVA 4GSLA 2AIRA 2EF0A 4NE2A 2ZR7A 1KO5A 4L5JA 5CCXA 4TTSA 4K9MA 4QYTA 2FWPA 4RYDA 5FPSA 3PV0A 5E6RA 1HYQA 4Z9YA 1EP2B 2Y9PB 5L45A 1NV8A 5D8DA 1YMVA 2EZ9A 2FX5A 3FMPB 3PQ8A 2QZ4A 1AQNA 1JT9A 4MI3A 5JNTA 2NAFA 4DR5B 3NNNA 3EQ9A 5ALXA 1XKQA 3LYUA 1A9OA 5DCWA 4Z4GA 1OV6A 2ZREA 4EUNA 4E5DA 4S0ZA 3QOXA 4RZHA 2Y8EA 1YR8A 3P26A 4WEQA 1FBNA 1ZMRA 2LNDA 5ED4A 1T0PA 3E7XA 3D1LA 2REBA 2Q1TA 3ET4A 5LP1A 2XIJA 1V3TA 1CIVA 1CK4A 2JFGA 1F8FA 3JZAA 3K7EA 3T9AA 5HR5A 3ESAA 1DCTA 1NW4A 5G4KB 1D04A 4WXPA 1N6KA 1Y4DE 3DHNA 4G07A 1YIOA 3KZMA 1LW6E 3NBXX 1U31A 3RTCA 3SG0A 5KVVA 4ZI3A 4N6OA 3S8YA 3SYTA 2C2MA 4FC6A 4AJLA 5AYVA 1I1QB 3AKEA 5F76A 4XIFA 3BWMA 2BKEA 3NIFB 4KSYA 2CCJA 2LZ0A 2ONJA 1TKBA 5FPQA 2GK4A 2ZCJA 1JTFA 3B1JA 3KOOA 1JIJA 1I32A 4QICA 3UMJA 4JLVA 4XPIB 2DHCA 5H7XA 3B1KA 5TJ9A 4DV6B 1PRYA 3TEFA 1XA0A 2CFRA 3FAZA 3ZWKA 2VUSA 3FNQA 4DVGA 2CEKA 4N8EA