The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
15
|
sequence length |
78
|
structure length |
78
|
Chain Sequence |
YFQGAVVTVDGEVYGTYSLAKDQTIEIQDGNRLRIQNGQAKMEWADCPDQLCVHQKAISRTGESIICLPNQVVVSVQG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
hypothetical protein
|
publication title |
Crystal structure of a hypothetical protein (RUMGNA_02503) from Ruminococcus gnavus ATCC 29149 at 2.20 A resolution
rcsb |
source organism |
Ruminococcus gnavus
|
molecule tags |
Structural genomics, unknown function
|
total genus |
15
|
structure length |
78
|
sequence length |
78
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2012-04-23 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | mini-chromosome maintenance (MCM) complex, domain 2 | N-utilization substance G protein NusG, insert domain |
#chains in the Genus database with same CATH superfamily 1NPP A; 4OBI A; 4ESN A; 1M1H A; 1NPR A; 1M1G A; 2KPP A; 3LD7 A; #chains in the Genus database with same CATH topology 1NPP A; 4A0T A; 4OBI A; 4ESN A; 2YQ2 A; 1M1H A; 1NPR A; 4A0U A; 1M1G A; 2KPP A; 3LD7 A; #chains in the Genus database with same CATH homology 1NPP A; 4OBI A; 4ESN A; 1M1H A; 1NPR A; 1M1G A; 2KPP A; 3LD7 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...