4ESOA

Crystal structure of a putative oxidoreductase protein from sinorhizobium meliloti 1021 in complex with nadp
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
250
structure length
250
Chain Sequence
GNYQGKKAIVIGGTHGMGLATVRRLVEGGAEVLLTGRNESNIARIREEFGPRVHALRSDIADLNEIAVLGAAAGQTLGAIDLLHINAGVSELEPFDQVSEASYDRQFAVNTKGAFFTVQRLTPLIREGGSIVFTSSVADEGGHPGMSVYSASKAALVSFASVLAAELLPRGIRVNSVSPGFIDTPTKGVAGITEAERAEFKTLGDNITPMKRNGTADEVARAVLFLAFEATFTTGAKLAVDGGLGQKLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative oxidoreductase protein from Sinorhizobium meliloti 1021 in complex with NADP
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
molecule keywords Putative oxidoreductase
total genus 91
structure length 250
sequence length 250
chains with identical sequence B, C, D
ec nomenclature ec 1.-.-.-:
pdb deposition date 2012-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4esoA00
3O9ZA 5BNFA 1VL6A 4II2A 4FR5A 2EP7A 2I66A 1GAEO 2G0TA 4GMFA 4OQYA 1V35A 4GLLA 1E3EA 4AJHA 1JTVA 1C3VA 3Q1LA 2HMUA 4NBWA 4DGSA 4IDAA 1ULSA 2JCVA 5ITWA 2GYYA 4BNLA 3ROQA 4LW8A 4WK6A 2I6TA 4PLYA 4UUNA 3V2GA 4Z3KA 5JCXA 1PGPA 3FPCA 4Q9NA 2EERA 2E48A 4W4TA 2OXIA 4CLDA 1SMKA 1HYHA 3QA9A 5C7OO 4HX5A 1QLHA 1YB4A 3R1IA 1R4NA 3IJRA 4PFJA 3ZWMA 2Q3EA 3F1LA 5JPIA 1VSUA 1PEDA 2PWZA 5KNLA 1UXJA 4B4WA 4FB5A 1FDUA 4KDEA 1SPXA 1HDYA 3DZJA 3EZLA 4RVGA 4CV2A 4AFNA 3RIHA 3D5TA 4B4VA 3DZFA 1IE3A 3JQGB 1ISIA 3X2EA 5BR7A 2Q1TA 4BNZA 2YHIA 1GQQA 1XR3A 4A27A 4II3A 4GWKA 3H9JA 1HZJA 5T8KA 4XGNA 2VRBA 5EQDA 4YT8A 4WLOA 5CDSA 1ZK3A 2ZQYA 4A03A 2NNLD 4FFLA 1BXZA 5FEUA 3AM3A 5L7WA 4RVSA 4XQ9A 1JU9A 2EJWA 3WB9A 2VZ8A 1KY5A 3DBRB 2FPIA 1W0CA 4IQ8A 5DCUA 3I9OA 1B3BA 3F46A 4I08A 1QYDA 3GPIA 5CFZA 1H93A 2JAPA 4BO8A 3QIVA 1PQWA 1DHTA 3L6OO 3F5SA 5L40A 5DCYA 4N5NA 3WYCA 4XGKA 2Y66A 3PZBA 3AUSA 3PXXA 4XCVA 3GUYA 3HN2A 5BNTA 1PS8A 2CF5A 1C0LA 2HRZA 1DO8A 4BB6A 2NU9A 4LRTB 5JAMA 4EZBA 3C24A 3RC9A 2VYNA 3MJVA 2YQ5A 4MJLA 1UR5A 2PZKA 1WDLA 3D4OA 5F5NA 5C3MA 1DDOA 1Q0QA 2D5CA 1C0PA 4RF4A 5MDHA 1YBAA 4WNCA 5THKA 2C2XA 3AI3A 4NBTA 1G0NA 1K6JA 3V1UA 2P9GA 1VKNA 3H7AA 3OIFA 3WBFA 3AM5A 4TRMA 3DAGA 4Z9XA 4IQGA 2HMVA 3VPFA 2ZB4A 3C1AA 4RQTA 4L76A 5G0WA 2BMAA 3ETDA 3P2OA 4I9NA 1ZK0A 3RFVA 3BTOA 1E6WA 3ITDA 5CDYA 5GY7A 4BNJA 1NASA 5JXWA 1BW9A 3MJEA 1DRVA 3GPDG 4IZIA 3WBBA 3KYCA 1BTOA 5G4LA 4CQMB 2BI7A 2RH8A 3N58A 4RDIA 1QMGA 3DL2A 4P8RA 4RGBA 2EGHA 5AQ1A 6ADHA 3R3SA 2GO1A 4DIBA 5THQA 1DFHA 3HB5X 2BGKA 2QZ9A 3WTBA 2I65A 1NQ5A 4AJKA 3ZWOA 2WYWA 3JQCA 5CEFA 3HB4X 4RVFA 1H6BA 3JQFA 4P38A 1X0XA 4MDHA 1RM0A 1XYGA 4L74A 2X8LA 2V6MA 1R0KA 1V9LA 1ZVMA 2BF7A 2VCYA 3LDHA 1YH3A 5KIAA 1MC5A 4MIOA 1SZJG 3LT2A 2EXXA 1P1FA 3ZHXA 3O8QA 4BIIA 4J1QA 5A9TA 1PZEA 1TXGA 3VDQA 3H9UA 2AEMA 3K2EA 4YR9A 1M75A 3B1KA 4Y98A 4EUHA 1LBEA 4U6SA 3INTA 1B3RA 4INAA 1N9GB 2VOEA 4E2XA 3PWSA 3ICCA 4Z3DA 1ZBQA 3WTCA 1IUKA 1PL6A 3ON5A 4J2HA 1T24A 2ET6A 2VWPA 3ZHYA 3CINA 1HETA 5TJ9A 2V7PA 3E5MA 1X14A 1T2CA 2NADA 1HL3A 1P0FA 2YJZA 4G2NA 3JD3A 1PQPA 1DAPA 1X1TA 4FJ0A 4HP8A 3VPHA 1U2GA 2P9CA 3PHGA 2HJRA 1Z82A 3D4NA 4DPKA 1PZFA 1SOVA 3DHEA 4NU6A 3MTJA 2BFAA 2FR0A 3RC7A 3TQHA 3JD2A 1W4ZA 2RIRA 3WIEA 3SVTA 3KHUA 1ZEMA 1DIHA 4MP8A 5JO0A 2EJVA 3LLSA 3NT5A 4FFOA 2Y0DA 4KMSA 4HFMA 3HQ4O 3VZSA 2BH9A 1E1KA 2NTVA 4E4YA 1JAXA 1ZK1A 4EEXA 3KOUA 2PGLA 3O8QB 2VRCA 2Q99A 1P1KA 5I9NA 1ENOA 3BHJA 2WD8A 3QVOA 4J49A 1H6DA 4JXKA 5A3VA 3M6IA 3NT2A 4XQGA 4BV8A 4FFRA 2GLXA 2O3TA 4IMPA 3ZW8A 3SC4A 1XA0A 3E03A 3E5RA 4CQLA 2BLLA 3L77A 4XD2A 1NNUA 2WE7A 3A28A 4LCJA 1NTOA 3HFGA 3DZHA 3GNSA 4PGFA 3AUTA 3NEPX 4LMPA 1PGNA 2PKQP 3I9KA 4FC7A 4DQUA 4RVDA 1JW9B 2AMFA 4K6FA 5BSEA 2A4KA 1X7HA 1B2LA 3ASUA 5JS6A 3WX0A 1GYQA 5IDYA 3SC6A 3OP4A 1VKOA 2V6GA 2Y67A 1H6AA 1T2DA 3M1LA 3ST7A 3Q2KA 3GZNA 4IS3A 3E9NA 1LLQA 2DBZA 4YQZA 2AHRA 4NFYA 3BTVA 3KSDO 2D0IA 4Z9YA 3FBGA 7ADHA 1SEVA 2DPGA 2E82A 3GZ4A 5AOVA 2NUAA 2O50A 3NX4A 4FJ2A 4OHUA 2H9IA 4LMRA 1LLDA 2VYVD 1F8FA 4CMCA 4NH4A 4CMBA 1TA4A 4YQYA 2DU8A 1OBFO 4PRLA 4IMRA 1Z7BA 5HM8A 1QSGA 1H2HA 3IDSA 2D8AA 3DZIA 4XDYA 2HMWA 4JJIA 2G17A 5KCZA 1PU2A 4RF3A 3WICA 1LDNA 5GZ1A 3FNGA 1LTHR 1U7HA 2O3RA 2YW9A 1UXKA 4BNTA 3UFXA 1BGVA 4CM7A 5U9CA 2C0CA 1XGKA 4BV9A 4BKPA 4D41A 5IN4A 2XXBA 2CVZA 4IDBA 3RCBA 4B4OA 4E33A 5TSDA 1HEUA 5B12A 3RROA 1DC3A 1U9JA 3FWNA 4PLWA 4E5PA 1JAYA 1KC3A 1LC3A 4XRGA 2BFPA 1IULA 1KYQA 3INRA 3TFOA 4RF5A 3PRJA 2OBNA 2Z95A 3H2ZA 3G0OA 4PCVA 3F6YA 4MKRA 3I6QA 2HMSA 1ZNQO 2EW8A 2YDXA 3PIIA 2P5YA 3OEWA 3KSUA 3LF1A 3GFGA 2YHUA 1B8UA 4AVYA 2Y1OA 4JJGA 4ND5A 1FDWA 4YJHB 3WGIA 4WOKA 2G5CA 3F3SA 4JCOA 4E0BA 3QWBA 3ITKA 4WJZA 2YV3A 1C0IA 1LNQA 1G6KA 3LT0A 1NAIA 3PHHA 5A02A 1N1GA 2GZ3A 1WLYA 2VWHA 2O4UX 1GEGA 3GH3A 1IZ9A 2IRWA 4EGFA 1HE5A 3JTMA 1Q1NA 3K8ZA 1AN9A 1HZZA 3LF2A 2I5PO 5JBIA 5DBGA 1O6ZA 1GL3A 1YE3A 3NDRA 2J5QA 4NQZA 4HADA 1BVRA 2B0JA 4R3NA 4OXKA 3AUUA 1V0JA 3GAZA 5MGBA 1U3WA 1HSZA 3OJEA 4FOSA 4CMAA 1NVMB 3TL2A 5JAZA 1ISMA 1P74A 3Q3CA 1AHIA 4OQZA 3WWZA 4CMIA 4XYBA 4M8SA 1E0DA 4BNHA 3D64A 2QRKA 5I8WA 3CTMA 5CDTA 3S2IA 2B5VA 3R6DA 4CMGA 3G1TA 1LUAA 5IDQA 4UEKA 4NJOA 1LI4A 2FHSA 1F14A 1ISGA 5IJZA 1JKIA 4W7IA 1XWFA 4J4BA 4ZQGA 4U5QA 3RVDA 2QX7A 3JQDA 4MP6A 5ES3A 1X1EA 4Y8VA 2AE1A 3TSCA 1LEHA 5CEJA 4J1TA 3PWKA 4K28A 3ZZNA 4J4TA 3LT1A 1E5LA 4YCAA 1U28A 5I9LA 2ZK7A 4QQRA 2GGSA 3JQEA 4D46A 5ILOA 3ZU3A 4BHTA 2O3UA 5JC1A 2ZTLA 2Y1CA 3D4PA 2DT5A 3ANLA 2ZYAA 2C2YA 5JW6A 1BVUA 3T4EA 2Y0EA 4MKZA 3DBHB 3WIDA 3DBVO 4KOAA 2DLDA 2FWMX 4GMGA 2VHWA 4KZPA 3SXPA 3UHAA 4CM8A 1PJ4A 2AEJA 3U62A 1SO8A 1UAYA 4AJJA 4E2YA 1KETA 2AW5A 4YAJA 4YWJA 3RSHA 1CYDA 1E6EA 4E32A 5U1PA 1YL6A 4JBHA 1X0VA 4LCEA 1Y8RA 4CLOB 4OL9A 2J3KA 3MJCA 1XKQA 4Q3BA 1MXFA 5EERA 1MX3A 1UDBA 1IOLA 1FF9A 2CD9A 4IXWA 1Y9EA 2JCXA 4GL4A 1D8AA 4M55A 4S3MA 2O3SA 3GF4A 5BSHA 1TVEA 1VM6A 4EJMA 3FRJA 4FJ1A 4Z0PA 2P2SA 1F12A 4KTTE 3JQGA 5FF9A 4YB8A 3I52A 3DBLA 1U5CA 4D0RA 1NFRA 4OKIA 3RFTA 9LDBA 4UEJA 5AXDA 5JMPA 4CUJA 3W6ZA 1DHRA 3GN2A 3BTSA 1R4NB 8LDHA 4M86A 4RVUA 4MVJI 3ULKA 2GZ1A 3WG9A 4CR8A 4H3VA 4EYEA 2I3AA 4WECA 1KBZA 1E1NA 5A03A 2GF2A 3RC2A 1JVBA 1GUZA 5G0UA 3A14A 4PLPA 4JX8A 5BSFA 2CY0A 3JD0A 4JBIA 1I30A 3PHJA 2OL4A 2B4TO 1ZMOA 3VH3A 3PIDA 2ZIZA 1VSVA 1E3WA 2I3GA 4NBUA 5TS3A 5TT0A 3QQPA 2HUNA 2X6TA 2W2LD 4PLGA 4WCDA 3NAQA 5H82A 1I3KA 3HG7A 3ZWVA 2YFQA 2DBQA 2XF8A 4EW6A 1HWYA 1O9BA 4CM9D 1D7OA 4UREA 1ZK4A 2CDAA 3GHYA 3IQDB 2HAEA 3VC7A 2HDHA 3BHIA 4NJMA 2HLPA 3WR5A 3V1YA 3HFSA 3CSDA 4XDZA 3NGXA 3VZPA 3TL3A 1SOWA 1Y8QA 4ND1A 1RYEA 4OYRA 1PL7A 3WSWA 4E5NA 1RPNA 3N74A 1B15A 1LSOA 3BZUA 3C7DB 1GZ3A 4TVOA 4BNWA 4Y67A 2X86A 4CL3A 2B37A 3DMYA 4QX6A 2PFGA 5A05A 3P19A 4CM6A 1RM3A 3EDMA 1PWXA 1KEPA 2VUTA 1M6HA 1IPFA 2X0NA 4B3HA 2OP1A 3PYLA 1XLTA 5A9RA 2ZCVA 3UAGA 5F3RA 3BIOA 1ENZA 3GHHA 2FOIA 4ALMA 4CUKA 5IG2A 5IXYA 2JKVA 3OH8A 1NWCA 2IYOA 3U49A 2WDZA 4PZEA 3EAGA 1MB4A 2YYYA 4W99A 2C5EA 4DREA 2B35A 1OFGA 2IEBA 4YRBA 3DO5A 5T64A 1H94A 5CAEA 4CQMA 4DYDA 4TSKA 3SLKA 2FRDA 4EJ0A 1L1FA 2P5UA 4M1QA 5L7TA 5A4DA 4J6FA 3AK4A 1ZZEA 4YDRA 3FPLA 2W90A 1TLTA 3ANMA 5CDUA 4F3YA 4Q3CA 1HT0A 3GNQA 1R6DA 4LN1A 1DJQA 3OICA 4E31A 4RPGA 2RHCA 3DBLB 4KUEA 1B8PA 3Q6IA 4F46A 2I99A 4L8VA 1E7QA 3DHNA 4JGBA 5A9SB 4EITA 1YOVB 2P4HX 4A5OA 2ZB7A 1R0SA 3S1LA 3IMFA 1BMDA 1LX6A 1DBVO 3TOXA 3GFBA 2CZCA 4YAEA 3G1UA 2A92A 2DM6A 5KKCA 3EHEA 3TZCA 3I3OA 4MVJA 3ZGYA 1NFFA 3KYBA 3KYDA 4AJOA 5IXSA 1VJTA 3BMCB 2ZATA 3H5AA 3DZBA 4TKMA 1PJSA 1ADFA 3HDQA 3OEYA 2FR8A 3CIFA 2EG9A 4L4RA 4YA6A 2J5RA 3D3WB 2Z1NA 3ZV4A 1ARZA 2C82A 4R1NA 4RPHA 3G79A 3FSRA 5A5EA 2J3JA 3PP8A 4YJGB 3SBOA 4ALLA 3ZWBA 4BNVA 1Y1PA 4NI5A 1XG5A 2WYVA 4DVJA 1GEEA 3KLPX 4E13A 1JKJA 1RKXA 3BMQA 3VKUA 3ZCXA 1ID1A 1GCUA 1FK8A 4ZQHA 4L75A 4Y6SA 5GMOA 1HDZA 2WEKA 1I24A 2ZTVA 1HDGO 2H6EA 2VTDA 3WXBA 4E2ZA 4RL6A 1WAMA 3BAZA 3P2YA 4B7UA 1Y8QB 3NDIA 5JLAA 4JN6B 4ESOA 4FCCA 4OM8A 1V3VA 2H63A 1R12A 2GN8A 1EE9A 2GSDA 5ENDA 1PJQA 1M67A 2IE0A 4IJUA 1A7KA 2IYPA 5TJHA 5U4QA 1YQXA 1IHXA 4LISA 4IUYA 1E3SA 1R66A 3IOYA 4ND4A 4ALKA 4ZICA 3GRPA 3DXFA 2CF6A 5G4KB 4WGGA 4RV9A 4WLNA 3L4BA 1EFLA 1RYDA 2BRUA 1HDXA 5IDXA 2UDPA 2ZTUA 2V6BA 5DCWA 1PR9A 3QHAA 3BHMA 1P0CA 5K9ZA 1EVJA 4GKVA 4NNJA 3WGGA 4J2OA 2P91A 2AEFA 2IEDA 2YZ7A 3CZRA 5A1TA 4D0SA 1EUZA 2X23A 5TGDA 1K5HA 4CLHA 1RM5A 4BO6A 3DOJA 4MIEA 1TT7A 5KJEA 4WCFA 4J7XA 2PY6A 3NRCA 4ZRNA 1HDOA 5CPFA 5KKAA 2JJYA 3S2EA 4RO0A 5DDIP 4BL5A 1PJ2A 2D5AA 1HE3A 2B69A 2DC1A 2Y05A 2RAFA 1ZK2A 3ZU5A 2V6FA 3WYBA 3DB2A 3VH2A 3A06A 1VL8A 2NVUA 4Z0TA 1IHYA 1MGOA 1OC2A 4QTZA 2WE8A 3W8EA 5IZ4A 1NYTA 1A7AA 5JNLA 2HU2A 1I32A 3C7CB 2OOSA 2FSVA 3NV9A 3AY7A 4P22A 1UP6A 4CLXA 4NZ9A 3KO8A 1J5PA 4UVGA 1HYGA 3HNPA 3TPCA 3RI3A 1OAAA 3F47A 3JQAD 3QWFA 4NIMA 1TB4A 1UXHA 3AWDA 3T7EA 5KWEA 2DFDA 1EMDA 4ID9A 1X15A 3TZKA 3KRTA 4BO7A 1I0ZA 3AY3A 2XPCA 4AJEA 4GSKA 3PGXA 1IL0A 1YRLA 1PQUA 5IN5A 2W4QA 4EEZA 1YONA 4TZKA 4RCVA 4HFJA 3PJDA 3QWIA 4NHEA 3TOZA 1HE4A 2FP4A 1UZMA 2O3JA 3G3EA 3B1JA 4CM9A 5I7VA 2Y1FA 3FBTA 4DC0A 1U7TA 3MEQA 3O38A 3CEAA 3ZW9A 1GQ2A 3VDRA 1YJQA 3SJUA 1ISFA 3KM0A 4HY3A 3ROMA 3PFWO 1SC6A 2YQ4A 3OETA 2PLAA 3E9MA 4W9NA 4DQXA 1ONNA 4GX2A 3ZWAA 4N5MA 1CJCA 3H9GA 3ABIA 3PHLA 3E1KA 3JV7A 4EBFA 5C7IO 4WCFC 4B3JA 2IZZA 2NSDA 1Y5MA 3JYNA 4O0LA 2B4RO 4Q3DA 3U09A 1KIFA 1MC4A 2O3QA 1YB5A 2G76A 4MP3A 4MVJG 1QYCA 3ROKA 2X58A 4D3DA 5DULA 1GZ4A 1B0AA 5DF1A 3LQFA 4OOFA 1KERA 4CV1A 2C59A 2C20A 3W1VA 2X1HA 5JY1A 3OM9A 3BMOB 2Q46A 1ADBA 4QO8A 1P3DA 2OGUA 2Q4BA 4IDDA 4IIUA 3CXRA 4FD3A 2EV9A 3HADA 3KLMX 2HCTA 1HTBA 2Y1EA 3OSUA 1DIGA 2AXQA 3EW7A 1TEHA 3UGKA 4D43A 3GR6A 4G81A 5EL0A 3OJOA 4PG4A 4UUMA 4M87A 1GQYA 2VHZA 4PRKA 1UUFA 4BMSA 3FTPA 4NPCA 1C14A 2QW8A 3H9QA 3JQ8A 1U4SA 4J7CA 4KUHA 4M49A 1DC5A 2OORA 5EIOA 1DJNA 4W7HA 1QYXA 1ZO8A 4BO4A 4YRAA 3SX2A 5L4LA 1PS9A 2O4CA 1KVRA 4PG6A 5FWNA 1LLCA 2X5OA 3IAHA 3JCZA 4K6CA 4U8GA 5JE8A 2HK9A 3UN1A 4ALIA 5G0TA 2A9FA 5GZ3A 1N7GA 4NFSA 1K6IA 2SCUA 4Q39A 1GUFA 2GUGA 4HBGA 5DNAA 2H1SA 5AXAA 2RH4A 4HKTA 2IXBA 5AXBA 4DXHA 2GR9A 1PIWA 3E6AA 1I2BA 2C7VA 5FYDA 5DBIA 4DBZA 4RZHA 5EESA 4DLAA 1B8VA 4QT0A 4WCFB 1ULUA 3AOEC 3W4IA 1KEVA 3C3XA 1CQIA 5HA5A 4MINA 2RHRA 1DC4A 1W8DA 4JIGA 3KETA 4M89A 2EW2A 4PLZA 4EI2A 1EQUA 3UCEA 3GDGA 1IYZA 3PTZA 2GN9A 4UAGA 2HK7A 1B14A 4BGVA 5EN4A 4CR7A 1N92A 3V5NA 3U3XA 4IGEA 4I9UA 5HRUA 2BI8A 2P4QA 3FTNA 3K9QO 3UF0A 4CL8A 1I8TA 5CPBA 2HO5A 5KJCA 2Q45A 2RBEA 5IDWA 3TFQA 2R00A 3WGQA 1HDCA 2W98A 2NU6A 1E7MA 3WGTA 4AJIA 3I9NA 4TKLA 3K92A 4JLWA 2PH3A 5J23A 4BO0A 1YDWA 3KZVA 3H5NA 3PVZA 3ZV3A 1HYEA 4R1TA 4LVUA 3I4CA 4LSWA 2PNFA 1MXHA 4R68A 1JKFA 3SEFA 4FFNA 1O8CA 1LRLA 3MTGA 3GZNB 5T5QA 2NACA 3W6UA 4RDHA 1DLIA 3INGA 2GRAA 3WGHA 3NTQA 3B6ZA 3L9WA 5F1OA 3M2TA 1PGJA 3PYXA 1NVGA 3RUAA 1N1EA 2IZ1A 2UAGA 5K6AC 1BRMA 4HFRA 4CM1A 5BT9A 4BS9A 3U4HA 3VZQA 4CM8B 1LC0A 4FN4A 3DBRA 3WGYA 4TRRA 1I5RA 4Q3EA 5T67A 3CPSA 3VPSA 2QG4A 3D3WA 1EVZA 1EZ4A 1KY4A 2O7QA 4GX1A 3B70A 4KWHA 5BNIA 9LDTA 2QRJA 2VTEA 4AJLA 1I3MA 3HHPA 4MKXA 3E48A 4JQCA 2DTXA 4ZJUA 3TNLA 4YJFB 1Y6JA 1TT5B 1H9AA 1SNYA 4FW8A 2HQ1A 3TZQA 1DIAA 1Y81A 3I9LA 1LQUA 1A4IA 3A9WA 3ZI0A 3N7UA 1JWBB 4WKGA 5ITVA 5DZSA 1AXGA 3EUWA 3D3EA 2AG5A 2E6UX 4AJPA 1DFIA 4Z6KA 1LXCA 1ZW1A 3OA2A 4MVJF 1F0YA 2Y1DA 3OA0A 1E7WA 1E7YA 1I3NA 3KEOA 2VZ9A 4XIYA 3W8DA 2JHGA 2E49A 2G1UA 3H65A 3EVTA 4N54A 1LSSA 4YYZA 4R41A 2W2KB 1A72A 1KS9A 2W2LA 4FFMA 4A2CA 4WNIA 3DQPA 5BSGA 3MJ4A 2VQ3A 4CMIB 4ZD6A 4R51A 1ZJYA 5ICMA 1EFKA 3WWYA 2Q49A 1PGOA 4P4GA 4P4LA 1LRJA 1F17A 4QUKA 2WTBA 1B7GO 1I10A 4ZU3A 3AUAA 1PX0A 3KBOA 5TX7A 1J0XO 5A3JA 4NBVA 1T26A 4XR9A 2OUIA 4MO2A 3MWDB 1DRWA 3OBBA 3WNQA 1Q0LA 4KWIA 2O2SA 1P1RA 2EF1A 2O48X 2VOJA 1CETA 1EK5A 1U3UA 3TZ6A 1ZIDA 3LSYA 5AVOA 3S2GA 5TQVA 5L53A 3UW3A 4L73A 2YFHA 3DHYA 3PYMA 3A4VA 3ASVA 1XDWA 3FR8A 3PDJA 4BB5A 4BNUA 3RBZA 1FJHA 1I36A 2B36A 2GDZA 4OH1A 3PJFA 2WMDA 4E30A 3LLVA 3WDSA 2O2YA 1UZNA 2ZJ0A 1SCUA 4BKUA 3CUKA 5IF3A 2QQ5A 4XX0A 3ZHZA 3FNFA 4XJTA 3H5RA 3GC6A 3I83A 1D4FA 4MVJP 2GN6A 4DTIA 1XU7A 3F4LA 3ICPA 2ILTA 4AJ4A 4IJWA 1WZEA 3ZWNA 4XJSA 3MCVA 1Z75A 3DOOA 3PQFA 1KOLA 3KUXA 3CH6A 3I9JA 3B20A 2I9PA 4GX5A 1GZ6A 4YJDA 4PLHA 2NTNA 1TI7A 2X9VA 3VTZA 3C7AA 5T6BA 3EVNA 1SBYA 4A0SA 1Z74A 2GNAA 3DFZA 2F1KA 1H5QA 3WGZA 1ZH8A 1GADO 1J49A 3C85A 4IZHA 3VKVA 3SJ7A 1WDKA 1I2CA 4URFA 3OQBA 4OSPA 3DWFA 3G49A 4QECA 2LDXA 4WLVA 2DVMA 4GGOA 3H2SA 3GAFA 4W6ZA 3TRIA 3R0IA 4EUFA 1N8KA 3QRWA 1TT5A 4OKNA 1LQTA 2VZ0A 3GOHA 4PLCA 5JDCC 1RJWA 4CR6A 3GEDA 3HWRA 3F5QA 3GG2A 2A94A 4IJKA 1AXEA 4UUOA 1WMAA 1R16A 2D1YA 4TRNA 4G65A 3PPIA 5KVVA 2NWQA 1L7EA 3RUDA 2FPGA 3RUHA 2CNBA 2ZYDA 2E37A 4ZQEA 1VI2A 1DAOA 4GGPA 3HN7A 1IPEA 3QVSA 3O4RA 5F21A 3AY6A 4E5KA 3GRKA 4JNKA 4YRDA 5EJ2A 4YPOA 1E1LA 7MDHA 5JMWA 1KVSA 3QW2A 4H16A 4Q3AA 1D3AA 3VVCA 4PN3A 4UVHA 1CDOA 2CDCA 3Q9NA 1ZXBA 4XR4A 4IBOA 1QR6A 1DFGA 3QVXA 1LDBA 4CV3A 1UXIA 4O59O 2G82A 2C07A 3D5QA 1A27A 3JQAB 3TJRA 1PJBA 1VJ1A 1P31A 3MOIA 4FOOA 1XCBA 5B1YA 2EKLA 3JYQA 1KC1A 4GI2A 4J4HA 4S1VA 4U0KA 1P9LA 3ONDA 5A5FA 3HJAA 3LZ6A 3PJEA 4XIJA 4D79A 3VOSA 3CMCO 2X4GA 4LSMA 4FC6A 4BKOA 1CQJA 4I8XA 4I5GA 5KOIA 1WZIA 2PZLA 1HE2A 4OXNA 4CMEC 3RQSA 2YV1A 5EMHA 1M66A 5KJFA 5TC4A 3T7CA 1K6XA 3TN7A 4BNFA 1O95A 4YVFA 4EUEA 1I01A 1GDHA 1YBMA 1M2WA 1E92A 1XQ1A 2PD3A 3NGLA 2R6JA 2PK3A 3VTFA 3QP9A 2W2KA 1H6CA 3LVFO 4TRJA 5TNXA 2VWQA 2PGDA 3GK3A 1I33A 5JCJD 3RFXA 5K0ZA 3NDJA 4JBGA 3X2FA 4MVJE 1GTMA 3I9MA 4R54A 1L7DA 3GGPA 4TROA 4OOEA 2GPTA 1PJCA 3DZGA 2OFPA 5L9AA 3DAFA 4BMVA 3U4IA 1YXMA 1EQ2A 1D1SA 3EY4A 1YL7A 2C7GA 5KJ6A 3IKTA 3L07A 1R15A 4FIZA 2WSBA 5CP8A 3JQ6A 4IGFA 3I5MA 4BKQA 1T2FA 2D2IA 2PD6A 2GCGA 4OO3A 5TIIA 5DOVA 1LJ8A 3OFSA 1I2ZA 3IC5A 2JFFA 1ADCA 4WLFA 2PKRA 4YJFA 3V2UA 4DC1A 1LSJA 1U3TA 3DR3A 4D42A 1CF2O 1R4MB 4A10A 4E21A 3JD1A 3PJGA 5JDCA 4HXYA 2FSSA 3GGOA 1LDMA 3DC2A 2XAAA 3DTTA 4R5MA 1YVEI 2X9GA 3AFNA 2XOXA 3UKOA 3QE3A 1GU7A 4XB2A 4E3ZA 4DRYA 4ONEA 3V2HA 2QRLA 3H6KA 1X13A 1EDZA 3BMNB 1P44A 1DB3A 5EPOA 1MG5A 4XYLA 5KTKA 4Y6RA 3OMLA 2ZB8A 4KQWA 4FPXA 5FI3A 1E6UA 1DIRA 5DBFA 5HWSA 2TMGA 2FN7A 4O5OA 1H9BA 1FDSA 1IY8A 5EQFA 1MG0A 3Q11A 4K9DA 1C0KA 2ZYGA 2AQIA 3P5SA 4CQLB 3K96A 3OJ0A 5JYDA 4A73A 4CM3A 5LDHA 5HTOA 4ZQFA 4FS3A 1YGYA 3JQBC 3NTRA 1KVQA 2VNAA 3OIDA 1Q2XA 4RQUA 4BGIA 3DEYX 3PI7A 4AL4A 4XYEA 3NJ8A 3IUPA 3S55A 3WLEA 2Q1WA 2ZQZA 1K2WA 4E12A 2Q2QA 1F8GA 1QXSA 1LLUA 1WP4A 2PA3A 4F6CA 1ONOA 3BTUA 3OJFA 4R16A 3ZWYA 4AJ1A 3ZWPA 1SAYA 1ADGA 2EEZA 3MZ0A 2V65A 1QKIA 3PGJA 3AOGA 4ROSA 2TMDA 4NU5A 3AI1A 3RC1A 1LSUA 5I7FA 4RLHA 4XYMA 4UVEA 4Q3NA 1CRWG 1DSSG 3IIEA 4KUGA 5JY6A 4J90A 1PGQA 4RVHA 3PQEA 4WASA 1NR1A 3DMTA 3JYPA 3GDFA 1IB6A 2GN4A 5ER9A 1JLLA 1UXGA 3ENKA 2O23A 1W73A 3F1KA 4GH5A 3NYWA 1Q0HA 1C1XA 3V8BA 2DTEA 3RD5A 4DMLA 1QV7A 4YAIA 4DPLA 1YBVA 1ZSVA 3FHLA 3ADPA 4E6PA 2E4AA 4PG7A 2FZWA 4IDFA 5B37A 3WGOA 4P4NA 2EKPA 4B7XA 1G0OA 3NTOA 2IDZA 2P68A 3WLFA 3UCXA 3KSZO 5CHEA 2JHFA 4UUPA 5JCJA 4DMMA 4YT4A 4ZVVA 1XEAA 2R00C 2IXAA 4ND2A 1A71A 4U7WA 3GG9A 3FI9A 3OF2A 2CMDA 4FDAA 4ND3A 4D3SA 2NLOA 4KTVE 3TWOA 4CLRA 1O0SA 5IFLA 2PZMA 3JQFC 2VT3A 4CLRB 3G17A 4PG5A 2AA3A 3TDKA 4DYVA 3JQ8B 4IPTA 4JJFA 4HWKA 2VUUA 4DLLA 3RUIA 2VHYA 4RPJA 4RJTA 3HDJA 1H0KA 1PZHA 3K6JA 3AOEA 3H3JA 2OO5A 4YBZA 5TF4A 1PR3A 2POQX 2ZTMA 1ZXLA 1HLDA 4YJGA 3D1LA 4XWYA 3NJ4A 2DBRA 1GV1A 3WJAA 1U5AA 4O6VA 4BNNA 1GCOA 1XQ6A 1ISJA 4J43A 3VPGA 1QV6A 4CLEA 1KVTA 1KEUA 5I8ZA 4X54A 3BMOA 3RU9A 1O5IA 3K73O 3RBXA 1GPJA 1MP0A 2VUSA 1ZUD1 3KYCB 3EK2A 3WFIA 4DWVA 5L51A 3GLQA 2DKNA 3AJRA 3UXYA 3DOCA 5K6AA 4NMHA 2NU8A 3GMSA 2DUWA 2BD0A 5KVSA 1ISHA 1MV8A 2JD0A 2BFMA 2X5KO 4RORA 2J3HA 1AHHA 3VVBA 5DN9A 5G4KA 4R4JA 4BOYA 5HBRA 1V6AA 5I7SA 4H7PA 4IY1A 4L0QA 3RUEA 3RBVA 4O63O 3FF4A 4N7RA 4I5DA 2HJSA 3FD8A 4B8WA 3H3FA 3O03A 4BNKA 4ZHSA 5JFOA 5CG1A 1PS0A 2C5AA 4IM7A 3GGGA 3DZKA 4ZGWA 4IINA 1VC2A 3E82A 2VHXA 3QLJA 1ZEJA 1E77A 2XXJA 5T57A 2PR2A 5ENVA 1YS4A 3LK7A 4QO7A 3S2FA 3FWZA 1IZ0A 2QYTA 1A9ZA 1Y8RB 3RUCA 4CUZA 4CLOA 3SLGA 4J1NA 2WWRA 1V3UA 3GEMA 5TLSA 1MLDA 1QRRA 3DAPA 3DDNA 3GY0A 1NPDA 1LA2A 1PZGA 3PWZA 1Q7CA 4QEDA 2WD7B 3ANNA 5FI5A 4MVJD 2J3IA 5L45A 2NTJA 2BELA 2VWGA 4BKRA 2AQHA 2NM0A 1U2DA 3VAZA 2VYND 4BO2A 1V3TA 2NU7A 3QVTA 3GVXA 3I4FA 3PQDA 4XGIA 4A7PA 4PG8A 3OJLA 4BUCA 1X7GA 5T8KC 2Q1UA 4FFPA 1UDCA 2VRCD 3PHIA 2X9NA 1EVYA 1HRDA 3H8VA 3GQVA 2BGLA 4F45A 5F1PA 4BNYA 3NUGA 4GKBA 3MWEB 3ZHBA 3W8FA 5DT9A 3M2PA 3WS7A 1W6UA 4YAGA 5L3ZA 1EDOA 2NVUB 4C7JA 1KVUA 3OQ1A 3U4DA 1EUCA 3LT4A 3GEGA 4CM4B 3ZU4A 1UAGA 3JQ9A 1DPGA 2OZPA 2WYUA 3C1OA 5COBA 1PWZA 4OJNA 4AJNA 1ENYA 2D3TA 1NHGA 4JP3A 3C8MA 5DP1A 2JL1A 5JSFA 2C54A 5C7LO 1VJ0A 5DP2A 3ZU2A 4AG3A 4B8ZA 1P77A 4ZRMA 1BHSA 3QWAA 1HXHA 4BNGA 1Y9AA 3JQ7B 3Q2IA 1RM4A 1H2BA 4LRSB 3RJ9A 2CVOA 1LU9A 3VH4A 1GYRA 1QORA 4ITUA 2HSDA 4NBRA 1NHWA 4RZIA 3COSA 3U0BA 3VZRA 4NR0A 2J6IA 4OAQA 4KQXA 1NP3A 2HKIA 4R9SA 4XQEA 4YT5A 3KV3O 4D7AA 1YDEA 3ETGA 4MIYA 4D44A 4GWGA 2VN8A 3IP3A 4PVCA 1NAHA 1AE1A 4XA8A 3WMWA 3IUSA 5AXCA 4NFHA 1KEWA 2J5KA 3CMMA 1GR0A 3ONEA 1BDMA 1XELA 1B16A 1E7SA 4QXMA 1GPDG 4R01A 1P1JA 3K2BA 1EE2A 4Z0HO 5F1KA 1A5ZA 3AM4A 1LRKA 1E3JA 3UCFA 1WVGA 4R5HA 3KVOA 4XZ3A 4GX0A 4XEHA 1M76A 3B1FA 4WLUA 1X7DA 4FGSA 3F9IA 1JQBA 2EHDA 4HNHA 2UYYA 1AUPA 3GVHA 1YQDA 4BO3A 4YAKA 1UP4A 3JQAA 3ONFA 3JYLA 4HUJA 2PD4A 4NJMB 1YO6A 4QFCA 1WDMA 4ALJA 4XB1A 4W9NC 4YJHA 4DIFA 1FDTA 2WD7A 1Y7TA 4ZQBA 5C5IA 1ORRA 3PK0A 2QYSA 3L4BC 1JVSA 1DC6A 2Y99A 4KP7A 1E7RA 5LC1A 2ZKLA 1T25A 3ZN2A 4C4OA 5JO9A 3QY9A 1JA9A 3BMCA 1OI7A 4CMKA 3ENNA 3GA0A 1QP8A 4BO9A 3RUFA 1T1RA 2FPPA 3JQ7A 3UH1A 3ZWWA 2Z1MA 3MJTA 4R9RA 3GT0A 4C7KA 4DBVO 2I67A 4F6LA 3I1JA 3UUWA 4FGWA 1P1IA 1EVIA 1P45A 1HLPA 2YY7A 3GNTA 1HKUA 4CM4A 6LDHA 2CSUA 4J16A 4OXYA 4BVAA 4OMUA 5A06A 1A9YA 3F4BA 5JC8A 3PFFA 4ILKA 3JQ9C 1YKFA 3WQSB 4GSLA 4BGEA 5G0VA 3STHA 5FFFA 4IXTA 3W4KA 2X7HA 1JN0A 4R1UA 1ZCJA 3RKRA 2C29D 1F06A 3NKLA 4LVCA 3WJ7A 2D59A 1NVTA 1J4AA 3ZNOA 1WPQA 4DLBA 4BO5A 3FR7A 4IDCA 1NR7A 5ICSA 4R3WA 2HMTA 3GUCA 4RPKA 4LGVA 3RAJA 1OZAA 2PZJA 4R69A 3P7MA 3HE3A 2Y93A 3OHSX 2I76A 1PJ3A 1UZLA 2EGGA 3ZNPA 1WNTA 1YB1A 2IZ0A 1E3LA 3LC1O 5IZCA 4TQGA 3BMNA 3PLNA 2BHLA 4PLFA 3FN4A 3D7LA 4TZTA 3EYWA 2BGMA 3GVPA 4E5YA 1GYPA 1ZMTA 5F5LA 5L4SA 1ZSNA 4E2WA 3IKVA 1WW8A 2DFVA 3GVIA 4DL9A 2AE2A 2JD1A 2FY8A 1R4MA 4K1LA 1BXGA 2JD2A 1NQOA 3RJ5A 2NQTA 4YXFA 3Q0EA 4GAEA 3ADOA 4IDEA 1FDVA 1JDJA 1N5DA 4LK3A 5C37A 5KVCA 4CV0A 4OIMA 2DAPA 3CKYA 2O7SA 1EK6A 3IP1A 1YL5A 3S8MA 2UUPA 3BXXA 2FR1A 5KJ1A 5H81A 4NG5A 1XSEA 1NPTO 1R0LA 2R2GA 1C1DB 5CDGA 4E5MA 3HDHA 1NQTA 3EC7A 4MPDA 3ZWCA 2YV2A 5COQA 1LDGA 4UULA 3L0DA 4J9VA 4AICA 3U9LA 5B4VA 5JAIA 2QIOA 1U1IA 2OMEA 4YT2A 1BWSA 3GDOA 3TF5A 1OMOA 4B3IA 3GVCA 1G1AA 2Q2WA 4IS2A 2Y1GA 2OBYA 5LCXA 3WMXA 1XHLA 3ZV6A 1CEQA 1MFZA 3KEQA 3ETEA 2GD1O 1CERA 4DUPA 4GPD1 1O89A 3H4VA 4BQRA 2DTDA 1K89A 4RPLA 5JDIC 3JSAA 1NBOA 2FMUA 3E9QA 4QSMA 2OHXA 5CEEA 2IODA 3E18A 3NT4A 1Q7GA 1YWGO 4YACA 5ER6A 4CQMD 1BSVA 5L4NA 3LC2O 4G5HA 5L95A 4WUVA 2Q50A 3IL2A 1GUYA 4CPDA 4N18A 1BXGB 2PKQO 4J0FA 4M54A 1GD1O 4J7UA 1NWHA 1EBUA 2VHVA 4J9UE 2JFHA 3JD4A 2AQKA 3QJ5A 1EUDA 4JROA 4L4XA 3L6EA 2EIHA 3CZMA 4KDFA 4L4SA 1S7CA 3KXDA 4PZDA 4BNXA 2PH5A 3I23A 4BQPA 3BMQB 1U8FO 4GBJA 4PIVA 3UOGA 1PL8A 4U6QA 2X5JO 3EZYA 5EINA 4XYGA 1UDAA 2X0JA 5LDGA 3ZNNA 1ZJZA 1B26A 2X0RA 3WFJA 4D3FA 2GERA 5DOZA 5G2OA 1ML3A 1ONPA 4O1MA 1MUUA 4WPGA 2CVQA 1YJ8A 4Y6PA 3BYZA 3A1NA 1A4UA 4UVDA 5GZ6A 4WLEA 3DBHA 1MA0A 4PLTA 2F00A 4RF2A 3WQQA 5ADHA 1PTJA 2PV7A 3AFMA 4TWRA 3U5TA 1C1XB 3H9EO 3KYDB 1S6YA 1T2AA 1ZKMA 3ROPA 2FZEA 3AU8A 3M1AA 1VE9A 2UVDA 3QWHA 3EMKA 3K30A 4CMJA 1VPDA 4OSOA 2VYVA 3U4CA 5JDIA 1WXDA 4NDNE 4MVJH 2Y0CA 3DMTC 1E1MA 1VL0A 1VRWA 2CDBA 4H15A 4MVJM 4UEOA 3WOHA 4I9HA 4XKJA 5JAQA 5HS6A 2BFOA 2ZJ1A 3OIGA 3RKUA 2AQ8A 1CIVA 3QV1A 3VPXA 1NPYA 1OOEA 4J0EA 2B5WA 4MOWA 2Q1SA 1EEHA 1HDRA 4GQAA 1UP7A 4NK5A 4Z9FA 1V8BA 1FXSA 2H5LA 3LYLA 1XU9A 3RU7A 4PVDA 3WNVA 2EWMA 3ORFA 2DQ4A 1DXYA 4GLOA 4I5FA 3TZHA 1GV0A 2J8ZA 4L9RA 4B79A 4WEOA 4CM5A 4TVBA 4B4UA 4XRRA 1E5QA 4IQ0A 1BXKA 1NXQA 1PJLA 4YTEA 3V1TC 3C1TA 2VT2A 2CUKA 1C1DA 3T4XA 3DONA 4WE3A 1PJTA 1SB9A 5B4TA 3FNEA 3RASA 4A26A 3K5PA 1ZSYA 3JQBA 4FSHA 5A04A 1N9GA 3DTYA 4IJVA 2OP0A 3L6DA 4FQ8A 2WJPA 4AJ2A 4HFNA 1QYWA 2DUUA 4BGUA 3ZV5A 3QVWA 3QSGA 1ZFNA 2JCYA 4EDFA 3LC7O 2RCYA 1I3LA 4I5EA 4BO1A 4BNMA 3IJPA 3PLRA 3ZH2A 5L7YA 1SEPA 4U0JA 3PZRA 4TMFA 3L4SO 3WYEA 5IZCC 5I9MA 5I7EA 1MFPA 4CMHA 1NX6A 4WEQA 1HF3A 2Z5LA 1T2EA 2UV8A 4CJXA 1UH5A 1DRUA 2X22A 1P33A 2NVWA 1AGNA 3KTDA 4PZCA 3ZWXA 5JYEA 3HUDA 2B83A 4I1IA 1WWKA 3GMDA 1FMCA 4Y9DA 4YEDA 3UVEA 2JFGA 3DFUA 2NVBA 3VHRA 4JK3A 1Z45A 1T4BA 2P9EA 3RWBA 1R37A 1UJMA 1HSOA 3WSVA 1P1HA 3EGOA 4K26A 1NM5A 4DA9A 1E3WB 3ZNQA 3MOGA 5CG2A 3AW9A 4HNGA 2GASA 2QHXA 2NQ8A 1K0UA 1U4OA 2Q2VA 4J3FA 1PSDA 1VLLA 5COAA 1SB8A 2LDBA 4N5LA 5KVQA 1T4DA 3FNHA 2PGJA 2DPHA 4GVLA 4EJ6A 3Q9UA 4ZN6A 1U3VA 3LU1A 1T1SA 1D1TA 3IS3A 3OECA 4W82A 2ZCUA 5A9SA 3CE6A 4D45A 4R1SA 1WMBA 3I6IA 2EP5A 3D0OA 4GVXA 4XQCA 3BA1A 3OQ6A 4ZA2A 1Z7EA 1DLJA 1K3TA 3AU9A 2X0IA 4JP2A 4DPMA 8ADHA 2QZZA 3KB6A 1N2SA 1Z73A 4J1SA 4DIOA 5H83A 2YUTA 3K31A 1DOHA 2CFCA 3L9XA 5B4UA 3ZDFA 3R3JA 1XIVA 4DQVA 3HSKA 4CMEA 1M6WA 4BNIA 2Y68A 2VNSA 4OGWA 5TRTA 1LDYA 1O94A 2ZB3A 4RLSA 1Y5RA 2PTGA 5ILGA 1J6UA 2WM3A 5HS4A 3JYOA 5IAAA 3O26A 2UUOA 1N7HA 3AI2A 1GY8A 2HK8A 2YDYA 3W4JA 3GN1A 2A35A 4B7CA 4HV4A 4QFDA 2HRBA 1BG6A 3E8XA 3PEFA 1NQAO 2JAHA 2B4QA 1GFSA 3PDUA 1LDEA 4PLVA 1U8XX 1QG6A 1QLJA 2BKAA 4FBGA 4NK4A 2DBVO 5TT1A 4ALNA 4CODB 1NFQA 3FCOA 1E3IA 2D4AA 4IDGA 1DIBA 4BMNA 2NV6A 4IIVA 1QYVA 3UICA 1YQGA 4UVIA 1Z6ZA 3WQRA 5G0SA 2Q4EA 1JWAB 1OC4A 1CWUA 2GZ2A 3HZZA 5AYVA 4WOJA 1BW9B 3HDYA 2W8ZA 1RWBA 2AG8A 3MJSA 2EKQA 2YHIB 3VH1A 1DEHA 1EBFA 5BQFA 1BDBA 1ENPA 1YOVA 1Q7BA 4J91A
chains in the Genus database with same CATH superfamily
1DZ3A 2O1SA 4LDJA 4ZHQF 3IV6A 1JDTA 5FT9A 1MZVA 3OE4A 1TQ8A 3OZFA 5BNFA 4YY3B 2HTFA 1DJPA 4II2A 1QRAA 2IY7A 4I19A 5IMSA 1L1QA 2G0TA 2PKCA 2C8LA 2YXBA 1M10A 2RGYA 4UHBA 1E3EA 2IY8A 1JTVA 5DX1A 1IXZA 1DNPA 2F8LA 4IDAA 1ULSA 1Z5WA 2A1TS 1JSCA 2EVWX 3D0QA 1R64A 2GYYA 2ZJ3A 3FDJA 1QC5B 2BGWA 1MAAA 2FOLA 2PR7A 3PC2A 3QU5A 4JKIA 3ROQA 5KX5F 2G9UA 3SQWA 3FBWA 1C8BA 3OC0A 3V2GA 3GD7A 3FPCA 4QHTA 1XWWA 1GTRA 4J07A 4ZDJA 1NMZA 2UYGA 3KDAA 4W4TA 4WH0A 2OXIA 5LA6A 4RHFA 4LZPA 1GR1A 3VR3A 2VDNB 5CLGA 1EH5A 3SS9X 4B85A 4RD0A 3G2IA 2JI8A 3ZVMA 1G8JA 4FFBB 4D4MA 1OJLA 4YBRA 5EWJA 2Q3EA 4AWBA 1VSUA 1ESCA 1K4KA 4JHLA 4YO8A 1QIIA 5DISB 1LBIA 3FB4A 3O8NA 1PEDA 4OREX 3B1WA 5SZKB 1NXPA 1UXJA 3RG8A 4BE7B 5KNLA 1SPXA 4HCJA 3KVVA 2R6AA 3D5TA 3LPMA 3AEYA 3JQGB 4Y1RA 3X2EA 1VFNA 1KMQA 2XWBF 4EMSA 3NTLA 3KQNA 2Q21A 1IRIA 2YHIA 1CUUA 2DX7A 2R7AA 2V03A 3GLHE 4XTCS 2DY0A 1OWOA 3AO0B 1HRKA 4RZQA 4RYDA 2X4DA 4F6RB 2QY9A 4F1JA 3FHTA 1PRYA 2O59A 1HZJA 4HLUC 1QFSA 1KAMA 5FBWB 1W88A 1ZK3A 4ZJYA 1FE8A 4O2AF 2VDVE 4WRRA 2ZQYA 5JZMA 3HY3A 4EF5A 1XPUA 2BYTA 1JALA 1NSTA 4PBTA 1PUIA 4RIHA 4RV4A 2C4TA 3WAKA 4RVSA 2RG1A 1FLDA 3RO7A 2EJWA 3TJZA 3WB9A 3AERB 1XJCA 1WNFA 4IQ8A 2FPIA 3EGXA 5DCUA 3HGQA 4ZYVA 1NJ5A 3DD5A 3DE6X 4I08A 4M8IA 3T35A 3W77A 2CV1A 2WVAA 3T3OA 2JAPA 3WAGA 2QMZA 1SVLA 5JUWA 4CG2A 1SBHA 5DCYA 1NT2A 4XGKA 1MB9A 1SXPA 1MC1A 3ZCTA 1JIKA 4BVGA 4RTNA 3ZDBA 4OLHA 5F2EA 4WXPA 3E3AA 1OIVA 4BMDA 3DP7A 5BNTA 2YR0A 1SIWA 1G21E 2RDMA 1XN1A 3CWCA 4C08A 3O75A 4BB6A 2XMDA 2HQBA 1LBHA 3BCSA 4GLFA 3RC9A 2YQ5A 4IX1A 1WDLA 1I14A 2GNOA 3KQVA 4W8HA 1Z0DA 5J2TB 2EKDA 1U2QA 3FVTA 3LT5A 2D5CA 3EG9A 1FNBA 3JVEA 1SUBA 4I50F 4G4SP 1G0NA 3PEVA 3DTVA 5KTPA 2WT9A 1C0EA 1WBDA 3UANA 3DPUA 1V39A 2WHQA 2QUHA 1ZM4A 5EIXA 1JIIA 1XLVA 2E21A 2WFLB 4PU0A 1Z5VA 4AZTA 3UJ3X 2A7XA 4L5AA 4F92B 4DR3B 3BAFA 3HXLA 3NRBA 3HUUA 4QKQA 3A8TA 2VPQA 1SUPA 2BMAA 3ACBA 1Q15A 3GQBA 4I9NA 3UEOA 2J9GA 3Q3HA 1DAHA 2N1BA 4BLVA 1TX4B 4DF3A 5AW3A 3QENA 3DL0A 4G0PA 2XECA 3KYCA 2WWIA 2I1QA 1NLUA 5AJZA 3FHJA 3T0GA 3GLFA 1OBOA 1RKBA 5FBQB 1XL0A 2JKZA 4E5VA 3NC1C 3N58A 4U7HA 1XZIA 3KDPA 4KN9S 5ECYA 2FSIA 3VHXA 4Q3KA 1CZOA 1XZBA 3I76A 4OP2A 1PNQA 1X2BA 4P8RA 3PPXA 3NO4A 3R3SA 2LWIA 4KVGA 4DIBA 5ARBA 4OV6B 4MYSA 4X61A 1MB3A 2AHOA 5K3FB 3HB5X 5ARCA 1Z4MA 4G5QA 2QZ9A 2W6CX 3WTBA 4EPXA 3VDXA 2O8EA 1T5OA 2AYZA 2YJ3A 2QMUA 3E2MA 5GGXA 5CEFA 2C9DA 3O93A 3AR7A 2GB4A 5EOVA 5EXTA 3RNOA 2WHYA 3PGLA 1RYNA 4D9NA 2X8LA 2V6MA 2PL5A 2ZR9A 3KHSA 3LDGA 4C6TA 1R0KA 4ER5A 2FMTA 5C18A 2VCYA 2I22A 1F0KA 3LDHA 5IMBA 3IE0A 4R05A 1Z4IA 2OK8A 4N7MA 4BLWA 3AF3A 4BZPA 4D2IA 2NXEA 1L4GA 1LVGA 1SVKA 3L0IB 1PZEA 1TXGA 1LW6E 2PX2A 2VSNA 4Q7JB 2ZANA 3TLBA 1TYAE 5LFAA 2HW8A 2AEMA 1CB7A 4YR9A 5B1EA 1DRJA 3C8HA 4Y1RB 4Y98A 1GL9B 4I4TA 1LBEA 4IFBA 5IWCA 4MQFB 1B3RA 2RGGA 3KKLA 4HNHA 4L51A 2WP0A 4ZOLA 4FN5A 3C3MA 3HWWA 3SU8A 1TFUA 2ZRCA 4FW9A 4G1EB 2YHBA 3ICCA 3H19A 2HA3A 1ZBQA 4HDKB 5CUQA 3WTCA 4MA4A 2QD1A 4MGYR 2OR3A 3HP7A 3JY6A 3ON5A 2IU6A 4LTMA 3ZE7A 4I4CA 1KZGB 1VKJA 4JEIA 2ET6A 3AHDA 2VWPA 4I50A 4QUAA 1BE0A 1JG7A 3TX2A 2ZJ8A 3IURA 3V8QA 4RULA 1HETA 5TJ9A 4G97A 3OI7A 1X14A 2NADA 1ZISA 1GNVA 1IZZA 1HL3A 1H1LB 2QQFA 3HY4A 3M9WA 1KRHA 3HKCB 4P33A 1RXEA 4QD3A 4ZDWA 5ICEA 2V9PA 2HPAA 3AXTA 1SVWA 3DXXA 4FJ0A 2IVFA 4HP8A 4L9SA 4NAVA 5AJHA 3ES9A 2XZPA 1YC5A 2COEA 1A9RA 3PHGA 3WLOA 1VBKA 3THWA 5FTMA 2HV9A 3OZRA 5LMUB 1DOAA 3E9EA 1PZFA 4YGXB 2DQSA 1PFVA 3AX6A 3DHEA 3TBHA 2YZMA 221PA 2WWGA 4EVQA 5HUQA 4OQEA 3RC7A 2HBYA 2WJVA 4HDNB 1TIKA 2X4LA 3NHPA 3TLMA 2RIRA 3CV3A 4XIFA 2BDUA 2XA9A 3CZQA 3DMFA 3VU3A 4X3OA 4AO7A 3O8RA 4LE2A 4MP8A 4RA9A 3WIBA 4R98A 2EJVA 2QD2A 3LLSA 4EHDA 1RQLA 3EEFA 3M3PA 3EVGA 5AI6A 1QGOA 1HQDA 2EAUA 5ALJA 5ELLA 4HFMA 3VZSA 2W2MA 2NTVA 3UWPA 1EK2A 2H2WA 4KSYA 4G8CA 4QARA 4EX6A 1ZK1A 3I53A 4R8MA 5KNBH 2Q99A 1XT6A 5I9NA 3BHJA 4GKAA 3OPNA 3AVVA 5A3VA 4UTZA 3NT2A 2R65A 2R1VA 2Z04A 4XQGA 1GTG1 5D51S 4BV8A 2LKCA 2GLXA 4IMPA 3FXAA 3EEYA 3GJYA 1VIVA 3AHFA 1NVWQ 2H1IA 2HA4A 1E9EA 3ISJA 1NUHA 2N75A 1XA0A 3LOUA 4PEVA 1SXJD 1X7WB 1DJOA 1QFZA 2CXPA 3AYXB 3NWBA 3R76A 1G18A 3B60A 2WE7A 4LCJA 4M38A 2O07A 1NTOA 3HFGA 3T5BA 3V7WA 1NVUQ 3GNSA 4B3CA 3ELBA 4IR7A 4OHPA 3V32A 5DXAA 1GTSA 2IPLA 4HNTA 2IYTA 4V38A 3WQBA 4CEHB 3I9KA 4FC7A 4DQUA 4RVDA 5C81A 1S96A 4WBSA 1DCFA 3GV0A 1B2LA 2YJ6A 4HOYA 4L0CA 5SZJA 1TIBA 3RF6A 5JS6A 1GYQA 4C2TA 1KZ1A 5NULA 5DB4A 3SC6A 1E0SA 2XRFA 5FBVB 3EUAA 1VKOA 2CV0A 3B5JA 1T2DA 4NEHB 2RSLA 1KFJB 1TAHA 1GKIA 1LLQA 1KJZA 2DBZA 2Q8NA 2ZU0C 3NHAA 3EGVA 3BTVA 3Q41A 4NFYA 2D0IA 4NV0A 3E3LA 3NM6B 1M73E 2E82A 3WMRA 4HH0A 2Y77A 5FP0A 3T5PA 1CY0A 4E1AA 3OU7A 4RVNA 3HDTA 3NX4A 3CLKA 4FJ2A 4BFTA 5HKAA 2NSJA 4OHUA 3DT6A 4MJXA 5AHXA 1LLDA 1NIJA 1FFSA 5F35A 4BC0A 4CMBA 3EYAA 4YQYA 2DU8A 1OBFO 1VMDA 1RABA 3IULA 3N2ZB 1Z7BA 2GK3A 2ECKA 1FP6A 2I2FA 2FG5A 2TS1A 3BE8A 3IDSA 4XJVA 2D8AA 3U16A 4DLTA 3GMTA 4ZI3A 4JJIA 4FE7A 4CM8A 1PU2A 2DRIA 3E22B 3ZJYA 4ESVA 4MO9A 2HIMA 1NY5A 4ZI7B 1MRZA 2YW9A 4BNTA 4BJ6A 1L4UA 1BGVA 3CONA 2Q5OA 4G8JA 4LDQA 1LB1B 3EZXA 3ZXSA 4BV9A 3L8CA 2G88A 4AYXA 3VNVA 1I5OA 2R7KA 3BSFA 2I4IA 4PX9A 1I3OA 1NW7A 3NHFA 1WV1A 2QTFA 3F7MA 4F1KA 4YONB 3FWNA 3HB7A 2JF0A 2BEVA 2UYQA 3CZCA 2DWQA 1JAYA 1LC3A 4B4KA 1UPAA 3VRHA 3ILVA 4DR2B 2VPIA 3FCAA 3HPRA 4ZVUA 5IAEA 1IULA 4AY3A 4RGYA 4F9EA 3TFOA 4HQKA 2FRXA 2OZKA 2FXIA 3M6XA 1ZD4A 3AHEA 3MA0A 1D8TA 2C4MA 4C6SA 2E87A 4F45A 4ENUA 4MS1B 1U63A 2A0FA 1HTWA 1QHYA 2PVPA 3C3CA 3I6QA 4KDRA 3RW9A 2P5YA 3THYA 1EVQA 1LPNA 3LX6A 5E4JA 1B8UA 1R50A 4UCWA 5KPJA 4KPUB 1U5BB 3SCZA 3CSUA 1N8NA 3W05A 4Q9LA 1NW8A 5KYUA 4YIKA 3OZXA 2HSWA 3QWBA 2V7QA 4ZICA 4DHEA 2OCKA 1LNQA 1G6KA 3OFVA 4ODIA 5DNCA 2PLRA 4LNUB 5ERGB 2YNMD 1UJCA 6REQA 3Q3IA 4FYKA 5BWMA 1UMCB 3N70A 4QYSA 1UBNA 3AVYA 3LBIA 4ME6A 1G42A 1JLHA 4L22A 1JQEA 4I3FA 3G85A 4R2MA 1ABFA 4CHGA 4GUDA 3S81A 1RLJA 4PIMA 5KX5A 1FRVA 3QJYA 2J5QA 1B42A 3MTQA 1BVRA 3ILHA 5JD5A 4DZTA 4GOND 1V0JA 3GAZA 3HKBB 2IS6A 3B3AA 4C14A 4C21A 621PA 5TEVA 2PUTA 4URVR 1NVMB 2Q9AA 4J0HA 4KNYA 3TL2A 2P2CA 4L07A 5HMLA 3I6ZA 4E09A 4MROA 1RMYA 3ZS8A 4EF6A 4U7PB 4UNRA 3Q3CA 1P0QA 2BJVA 3Q0IA 3A6ZA 4XDGA 1QHIA 5KYXA 1XMXA 4MEJA 5G53C 4XYBA 8GPBA 2GM3A 5HF5A 2REXB 2ZWAA 4LBWA 4BNHA 2QDKA 1GP2A 2RE8A 2I34A 1POXA 2QRKA 3CTMA 4Z4GA 4MJ3A 2LCQA 2E7ZA 1Y3AA 5DCLA 421PA 4G0NA 3R6DA 1Y4UA 2Q6OA 2HF2A 4GFDA 3ANXA 1LUAA 2ENUA 1XZFA 4LUCA 3M6AA 3R40A 4A0QA 4REQB 1U0RA 1JJAA 4EGSA 5CDFE 4BMPB 1OI4A 2GTIA 2Q6LA 1ISGA 3M34A 3P9ZA 4I0WB 4LJYA 4LZAA 1EIZA 3BEDA 3EPRA 2PZGA 3HU1A 4K8OA 4MP6A 4P3OA 1SOAA 4Y8VA 2HYIC 2XUOA 2BGUA 4G84A 3TSCA 2F1HA 1YTLA 4D80A 5K20A 3U7QB 3KQWA 3GUUA 5CEJA 2ST1A 3OZSA 4J1TA 3N2NA 3AB7A 2PA0A 2DR0A 1ADJA 3MHPA 3LT1A 5JCOA 1O94C 4RQBA 1PJ8A 3KELA 3C6YA 3EG9B 4U2EA 3I3SR 1U28A 3IT0A 2J7PA 3O6VA 4RKEA 1RXCA 3JQEA 5D1NA 1N6KA 4YUZA 5BN3B 4QIHA 1N2GA 3U3OA 2QGNA 3DGEC 4YRPA 3KLNA 2GPBA 3SDBA 3TRDA 4CDMA 5B36A 1IOWA 2NUTA 2C2YA 4K6KA 3T4EA 2VTBB 4IV0A 4B44A 2GSWA 3WIDA 4H6VA 1T9ZA 1SWVA 2H4YA 4PHTA 1QGUB 3FNQA 3PUKA 4GMGA 1Y5LA 2H4XA 3LGAA 1NVDA 1PJ4A 3HNRA 4KZPA 4L3OA 5D7BA 4M1TA 1KQFA 3VGJA 3UYKA 3VC2A 5REQB 1R6AA 1UAYA 3OKPA 4AJJA 3G8AA 5BRJA 4E2YA 1C9EA 2AJBA 2AW5A 3CTPA 4WY2A 3VJLA 4ITVA 4QAQA 2PE5A 3ITNA 1CYDA 1E6EA 1R5BA 4QDZA 3RSHA 5LLTA 2R8RA 3KL2A 3G2HA 3H2KA 3DTNA 4JBHA 3VKWA 3DBOB 4EKGA 3F7NA 4NS1A 1QAOA 1T29A 4PYJA 1OWPA 3HO6A 2XV1A 3K2IA 4RH3A 2OHJA 4Z3OA 3UMMA 1UDBA 4YV0A 1COWD 2JCXA 1NM5C 2QLMA 1L5NA 3P4YA 2O3SA 3GF4A 3ORQA 2PJUA 1TVEA 5BSHA 1HR0B 3B52X 3ELUA 4EJMA 3PFCA 3SS8A 2ZTSA 4FJ1A 3OLQA 5H3HA 5JWRA 5DWDA 1BCSB 4YB8A 4KLZA 1XJWA 1MEJA 2AZ4A 2G40A 4TV9A 5FEMA 3I52A 3HXTA 3KDSE 4P36A 3WIVA 1B23P 4A8JC 1NMQA 1TJ3A 4QQNA 3W2TA 5AXDA 4KC0A 1PL0A 3MSCA 1N5OX 5MFZA 4TLAA 4YJKA 3QE2A 5T4HA 2Q9UA 3RTBA 3C3EA 4RK0A 2JAWA 5DIFA 3ULKA 3ZQUA 1YD7A 1IUPA 2JGDA 1AZTA 3JYHA 5EYPA 4B40A 2ODQA 4EYEA 2WMOB 2OWDA 4JBXA 4WECA 4H17A 1IM8A 5C4MA 1IY0A 2NO7A 4EB3A 2IYEA 1WQ4A 3OAAA 4YJ3A 3J7AC 4O4LA 4YXWD 1UBUS 2RHLA 4EL0A 1TEZA 1BH6A 4DA7A 4MUIA 5DLEA 2ZS7A 3ABSB 4HVLA 3E9CA 1MKYA 3COZA 2CY0A 1L8LA 1CY2A 3GRUA 4TXLA 1YT5A 5F64A 2FRDC 1P4AA 4OD0A 2OQVA 3LUCA 4G0YA 3PIDA 5JYCA 1GKLA 1VSVA 1W59A 1IG3A 4DLZA 2H2GA 1YIDA 2NW6A 1CLEA 4EGQA 5IM4A 3HGMA 2X6TA 4UKDA 3J81A 5IX8A 5E4YA 2C94A 1SVNA 1RE1A 2W11A 2WG1A 3ZWVA 1JJFA 4P4SB 1ZD8A 1KF0A 1P2GA 4OX9B 3V8MA 2JLYA 2EJTA 5ITZB 3I72A 3VU0A 4CM9D 1D7OA 2Q3HA 4K9NA 4UREA 5B5SA 3IQDB 2WZCA 2SECE 2ADOA 2DLCX 3O8BA 3R6LA 4WZBE 2B9VA 4EAAA 4LQLA 1A8PA 4UQOA 5CIQA 2IZ6A 1QRUA 2H1LA 4XDZA 1GN8A 4IKOA 4MZXA 4N9WA 1Y8QA 1DAMA 4GRAA 5A5DA 1N4DA 4OYRA 1EZ1A 1QAQA 3A11A 5KYVA 3VOBA 1SCBA 5MGNA 2IS1A 2QN7A 2DYKA 3NH9A 4H77A 4KACA 3WSWA 1AU9A 3HCWA 1JEAA 4S35A 1MTOA 4ER6A 1NXVA 4W5JA 4C43A 3FZQA 4TVOA 3PEWA 5B1HA 4YRCA 4BNWA 3HBNA 1WW2A 4P7JA 2B37A 3M9LA 1NMEA 3P19A 2QL6A 2Z4SA 4EZEA 5FB3A 3IP8A 2WWFA 4NBNA 2AWNA 1WPXA 1M6HA 3UHOA 1Y4ZA 2HDNB 2OP1A 5KZMB 2EQ5A 4CUKA 1ZJ6A 3MTIA 4KQ2A 5FL7A 2FW1A 5IG2A 5IXYA 2C7QA 4QJBA 2IYOA 3W5IA 1DQYA 2FI1A 1R0XA 2H54A 4KXNA 1FU4A 3CX7A 3QTLA 2FN8A 3IODA 1QU2A 5C53B 2O2IA 5DGIA 3DO5A 2XMBA 3MYRA 2GBPA 4TUYA 3SLKA 1Y1KE 3T95A 3PFGA 2D2XA 3Q8WA 1SN7A 2QD4A 1VPWA 1ELOA 1OHHA 2ASEA 2P5UA 2UZIR 3D7NA 3ETHA 3K16A 1ORWA 1Z06A 2O57A 5A4DA 5A62A 1BDJA 2IOFA 1DG9A 3QKTA 4G1MB 3PENA 4WZBA 3SC2A 4FB4A 4F3YA 5CDUA 3IBFA 2FE4A 1K98A 1YI1A 4CL0A 5EKSA 4EJSC 1ZOSA 4U5XA 3O9VA 1H42A 4DA4A 4YHHB 3E22A 1E59A 4N82A 1Z2DA 4R81A 4TV8F 5F4BA 5TEWA 2IYWA 3QITA 3DBLB 4RPGA 1B8PA 4CDNA 1UPBA 2I99A 2D5IA 3DBIA 3PNOA 4QE3A 2EZ4A 5GIPE 5BQOA 3KR1A 1ZIOA 3QKRB 3UAWA 2Q4DA 3U1TA 4A5OA 2VDRB 3BWBA 2RH9B 4PWYA 1Z68A 4AMZA 4EOGA 4CIBA 1TOAA 1LX6A 2FCRA 3GT7A 3X1WA 4WXEA 1YQEA 1P2SA 4YAEA 3W3ZB 3OTWA 5KKCA 1OTXA 3EHEA 3TZCA 3AMVA 1A8UA 3KYDA 1WU8A 1WCXA 3DOUA 5ALYA 3DZBA 3NMUF 2HI0A 3D8UA 5MN6A 5FH9A 3TAXA 1A8HA 1ZLXA 2IOHA 3IP9A 3L8ZA 3OEYA 2WNHA 4L4RA 4M9CA 2GETA 1RBYA 4EHIA 4HRAA 3CO0S 2IUSA 2Z1NA 3WADA 2XI4A 3IO3A 2OV6A 4RPHA 1AF4A 1OTHA 4YCSA 3FSRA 4DDMA 2CNWA 2KE5A 5A5EA 1FS5A 2Q9CA 4BUZA 4ALLA 4LFAB 1CFJA 4TQUS 4O3MA 3WJ1A 1T36A 3KJEA 3R0VA 1CZNA 3VSAA 4BNVA 4NI5A 1W4CA 1NVEA 1Z4NA 2C98A 1F2TB 2CXXA 1XPJA 2ZFUA 3BMQA 3CW8X 3EMVA 3PB3A 4GYJA 4I55F 3ZCXA 4DW8A 2D7DA 1TZ2A 4QDUA 3KPWA 4FHZA 1XV5A 4Q16A 4L75A 4AXXA 5LB2A 3R7DA 4ZYZA 2ZTVA 3NC0C 3REOA 5JAUA 5DGTA 2H6EA 4E2ZA 2FX2A 1LBTA 4UM9D 3P2YA 2HBRA 4YCJA 1R9NA 4ZARA 3NDIA 3J81k 3DUWA 3UAXA 3PXDA 1T1GA 4YP6A 2HHAA 4RQAA 3V4RA 2FFHA 1TECE 3GJ3A 3M89A 3BDVA 4YX9A 5KNCH 3GBSA 1GVNB 1L7RA 3LPNA 5LQUA 2IE0A 3OTIA 3PR1A 3D6MA 3QXCA 4IJUA 1K9SA 2JGEA 2PEZA 4LISA 3QE9Y 3EXHC 1AKYA 2AI3A 3IOYA 4MMYB 3IUNA 1XXHE 1X3LA 2Q1XA 4URXR 3M5WA 4N4AA 4WLNA 1D07A 4EDHA 5EKTA 3K0EA 4YMIA 1QK4A 4WBNA 4BB9A 1RYDA 2BRUA 2UDPA 1PF7E 1T8WA 3HU3A 1XKLA 3MQ2A 2AZMA 3USZA 3FCXA 4JVOA 1XMPA 3QHAA 3BHMA 3DPSA 1P0CA 1F4LA 1JECA 3W2FA 2XD4A 1U0OC 3WGGA 1AGYA 4CKEA 1TTTA 3CZRA 1J1ZA 2Y9PB 2NUPA 4C1BA 4PGGA 4O4LB 4OU5A 4CLHA 4B3MB 2P79A 5LYJF 2IPMA 1TT7A 4HDRA 4J7XA 4EA7A 2PIDA 1W4RA 4TL9A 2PX6A 2OG1A 5FBKA 5A4FS 5KKAA 3U39A 3K0BA 3IPCA 4DV0B 1E58A 1NQUA 1K08A 3CZ4A 5SYAA 3A37A 1YAJA 2CJWA 2D5AA 3SX4A 1Y5IA 4BL5A 3T3GA 2ILVA 2Y05A 3VX4A 2RAFA 4KIWA 1ZK2A 2BTQA 2V6FA 3ZCRA 3EXIB 4EG1A 3FYTA 1F5NA 1CS4C 4UNQA 2NVUA 2CXOA 4FMBB 3RS8A 4Z0TA 4QGSA 3NPMA 4TLLB 4TTTS 1CC1S 4C2AA 1AA6A 5ICCA 3LY8A 4EHBA 2P8SA 3RK0A 4AP5A 3HEBA 3K32A 1E6MA 2FVXA 2Q5EA 3PHBE 1QH1A 2H4JA 4R84A 1I32A 4F06A 1OLUB 5CFOA 1QH8A 2WDPA 3D6JA 1M2KA 2QLBA 4JXJA 1JXQA 3S8EA 2FSVA 2VF4X 1HE1C 3O2JA 4NZ9A 4BFLA 4CLXA 3A1WA 3LRTA 1KI7A 3L4JA 2GQ0A 1RQXA 3KALA 3HNPA 5KAPA 3RI3A 3TPCA 1OAAA 3O1JC 5J2UA 4FEEA 3T7EA 3AWDA 2NOAA 3UBMA 4ID9A 1SRQA 2ABWA 1CE8B 3KRTA 4PPYA 2QQGA 1VE7A 1Z33A 2CHEA 2OA0A 5A6SA 4F3NA 1CXZA 2XQKA 1F7VA 3AY3A 2C2HA 1L4MA 2GBGA 2O0HA 3S29A 1IL0A 1YRLA 3CM0A 3C8UA 2B8TA 3U3KA 3PICA 1SXJB 4UBJA 2FZCA 3LOPA 4FOLA 2W4QA 2ONJA 1SKYB 4EEZA 1DX6A 1M6YA 4D4IA 3BF7A 1W85A 1QP0A 1VBFA 1XLUA 4NE7A 4NHEA 2GEVA 3G3EA 2PYIA 3B1JA 3NDPA 3QPWA 4PICA 3DNFA 1U80A 4RSMA 5JD3A 1U3DA 4MWBA 1FFCA 1YMVA 2CB9A 4NXMB 1XDDA 1FNSA 1R6VA 2B99A 2GX6A 4CT4B 3I30X 5A3SA 3ROMA 4BX9A 4DUGA 5E6UB 5HW0A 4Z1OA 5DLYA 1SC6A 4EFMA 3EISA 3WLTA 2YQ4A 3B1VA 4G67A 5BVHB 4XCQA 3H1TA 4PQEA 1CZKA 4RMGA 4W9NA 3KXIA 3REQA 5ALOA 4N5MA 1CJCA 1R0BA 2PX5A 1BC5A 3A1TA 3A1FA 3H9GA 3HUEA 3JV7A 5CYGA 2R751 1W8IA 2D3WA 5T4FA 2DLNA 2NSDA 3CLUD 1RU3A 4Y2UA 1MT0A 5TMPA 1P7CA 3JYNA 2PKEA 5FLEX 2BZ0A 5AM0A 3VTKA 4NJEA 4DXAA 3FCUB 3GLIB 3LDFA 3SK0A 4J0IA 1KIFA 5FUWA 1F8YA 5IVDA 5AIBA 4QQKA 1XTKA 1QYCA 5ALDA 1KTIA 1B0AA 5DF1A 3LQFA 3U3ZA 1KERA 1KIAA 1YMQA 2RJNA 4I1RA 4R7TA 3SE0A 4CV1A 5JS2A 3ANYB 3T7KA 5JY1A 3DEIA 1POWA 3IVRA 1QVVA 2NV0A 1GIAA 1XF1A 2Q4BA 1EVEA 2E4VA 4IIUA 4GUAA 4MXDA 5F76A 4FD3A 2YZNA 1Q11A 4WXRA 3AC0A 2F3SA 1AQYA 3MGAA 1Q21A 1YIOA 2HCTA 3HJUA 4HWPA 4UXJA 3DLTA 5ALXA 1T6NA 2AXQA 821PA 1TEHA 2VPPA 3UUEA 4D43A 1OF1A 4OGGA 1V5WA 4LKOA 1GNTA 1E64A 1PW5A 2PMWB 4CGZA 4O4HA 2A5JA 1U1DA 2MINA 1WL8A 1X92A 2ZYRA 3DW3X 3SYTA 3TLCA 4BYGA 2G3YA 1G5RA 2B94A 2EFCB 3JR3A 4MEBA 4K2HA 4BBJA 4FFVA 1GTVA 3SF8A 1E3DA 4NPCA 5CM9C 1JFTA 3JQ8A 3QOFA 1GGVA 3BX1A 5CR9A 2J9FA 5B3JA 1DC5A 1Y48E 2YASA 2X1MA 2H7XA 5CBKA 4LHWA 5EIOA 3SX2A 1YQTA 2O4CA 1KVRA 4CG0A 3ZYCA 1EIWA 3OFJA 1NZDA 1VHQA 2X5OA 3NBMA 3UN1A 2DZDA 1CNFA 5JE8A 4RFLA 2LTAA 5G0TA 1W44A 1FYWA 1DAIA 4RPIA 2A9FA 1CQPA 4NFSA 1I9CA 4XRGA 3PUJA 2C03A 1BS9A 2SCUA 3EXEA 3PE4A 3DE3X 3RTAA 1N78A 2EFDB 1WMDA 4PINA 1QB8A 3DMPA 3MK31 2RH4A 3BULA 1Z22A 3EA5A 3RYIB 5JRZA 3KR0A 4GXTA 1PTKA 4O3FA 1PEYA 1MAUA 5GGYA 4DXHA 1JA1A 1FX0A 1ORTA 1FFGA 1I2BA 2C7VA 5DBEX 5FYDA 3W79A 4B87A 5EWJB 2R79A 5DBIA 3ZGNA 4TMKA 3V4PB 4Q02A 4PSKA 2M6LA 1RADA 2FPGB 3R3UA 1P91A 4FKMA 1NR5A 1IM2A 3FLAA 3O73A 4JS0A 4QT0A 4AU1A 4ERXA 2ZBQA 3AOEC 4K46A 3W4IA 2I87A 1N2CA 2J32A 1KPHA 5AVYA 1CQIA 5KNCD 1I7NA 1BCRA 1SU4A 3N3BC 3L6RA 4JELA 3KQUA 4LRXA 1MOZA 1W8DA 1RWQA 5IM4F 4CF5A 1XRPA 1S4MA 4QYIB 1EQUA 4LX0A 1KEKA 4F3TA 4V0NA 3ILSA 2AKAB 3FFAA 3IUEA 1Y33E 4UAGA 1K5PA 4UAJA 4L4ZA 1ZXXA 3JWPA 4B6JA 2XZLA 5EN4A 1TGYA 2ID4A 3ZWKA 3LW8A 4IGEA 4I9UA 2LXNA 4CL8A 2ZIGA 4F4DA 1YS2X 5CPBA 2YVLA 2LE0A 2Q45A 2RBEA 3QEMB 3TFQA 4BWFB 3NONA 1GSIA 4DDUA 1EG2A 2JC3A 2Z5FA 5CDFA 1FUUA 1WDWB 1DWQA 2JJMA 4JEUA 3KKZA 3AB3A 4L3VA 4GP6A 5DXJA 1E7MA 1A0OA 2DFKB 4LZLA 5EUMA 2BFFB 4LXXA 2PH3A 4RIGA 1X70A 4BO0A 1YDWA 2JBWA 4EHLA 4JA2A 2AN5A 3H5NA 3PVZA 4NX2A 4R1TA 2H51A 4FIDA 3WWPA 2UXCB 1BEZA 2P90A 4PIPA 3BE4A 4LSWA 2WWVD 1GSAA 1MXHA 1LFAA 4R68A 3T5CA 4GD3Q 4CU5A 3MHTA 4FFNA 4IF4A 3U31A 1H4TA 5JSUA 2YVKA 3GZNB 1LTKA 4KYIB 5T5QA 4R31A 4BUJA 5CA0B 4RDHA 1DLIA 1JHOA 1G2PA 1Z5PA 2Y92A 5KB3A 3T41A 4UUBA 4XOUA 2HNKA 2E4YA 5ALPA 2QN6A 2O54A 2C5BA 1KBQA 2RHHA 4GGMX 4DIEA 4P2BA 1HQCA 1L5ZA 4ZT3A 2QLNA 2C1XA 1N6HA 1XL1A 2I6UA 2ISCA 3LQYA 1Z56C 1PR4A 2WM8A 4N0PA 4HFRA 3KWLA 5BT9A 2B25A 2RG7A 3ZW7A 4RZ2A 4DBLE 1VGQA 3OJWA 3KKNA 3PUIA 3L82B 4WDQA 5T67A 3DCJA 1G7CA 3D3WA 3B9RA 1EZ4A 2P7HA 1KY4A 4UBNA 4TYMA 1RW4A 4DMHA 5KQMA 1HNXB 1H22A 1VIYA 1O03A 2CE2X 4YROA 1MO4A 1QG2A 1SCQA 4POAA 5JAPA 2O2EA 1WXGA 3HHPA 4MKXA 1P7VA 3E48A 3TNLA 2DXIA 1SNYA 3NKVA 1FU8A 1N8SA 2AJTA 4RVCA 5KYTA 2HQ1A 3TZQA 3SWWA 3QFHA 3T7IA 2WFZA 1A4IA 2WHPB 1PZNA 4KPEC 3ZI0A 2AOUB 2WZBA 3SNHA 1RZRD 1DEKA 1O58A 2ORWA 2AOWA 3LX5A 4NZMA 2XBUA 3EHDA 1AXGA 3D3EA 5AOBA 2E6UX 4MQMA 2WAOA 2ZIXB 4B5KA 1RLIA 4DLSA 2YS7A 3OA2A 1MIOA 3LAWA 4RKQA 4R2XA 1E7WA 3Q72A 3WRWA 3KEOA 3W8DA 2AXPA 2CKMA 1GSHA 3H2JA 2JHGA 2ZI5A 2G1UA 2ZQ5A 3H65A 2BKVA 3EVTA 3NGMA 4FHEA 4M1EA 1MR3F 5H3CA 5LYJA 3T9FA 4DWWA 2G1KA 1SC4A 2NUPB 5ALKA 1Q19A 2ESRA 4HWTA 4NF2A 3TM4A 3WJ2A 2OK7A 4OLBA 3A6HA 1OLSB 3BOSA 4OUKX 2WD9A 3T0IA 2ZR7A 4DV6B 4OP3A 5BSGA 3MJ4A 4BZWA 4RA6A 4R51A 1ZJYA 2JLUA 4FMCB 4HDKA 1EFKA 3VR0A 3ELYA 3KOWA 1PGOA 4GI1A 3WLAA 1LRJA 2AG6A 1F17A 1RP1A 1RHKA 1NQVA 2EBFX 4G5GA 1GUDA 2WKPA 4ZU3A 1MV5A 3WK4A 1J0XO 3CA8A 4JQYA 2F3PA 4YMTA 2WR8A 2E4UA 2FW8A 3JARB 4X94A 3UAYA 3UNXA 2WVJA 3IMCA 1SA0A 4MO2A 2AN1A 4KHZA 1FNMA 4ENSA 5EIAA 3WNQA 1KE1A 5JJIA 1CUFA 3N0XA 4DMFA 4KWIA 4AWXA 1SCDA 4P86A 4RSGA 4W7SA 1P1RA 1WBBA 3A9RA 4DCTA 1EU1A 1U3UA 1Z36A 1DCMA 1ZIDA 1C4KA 2MMCA 4IIHA 4DYHA 4QYXA 3S2GA 4KBFA 2WV7A 4LJ8A 4XUGB 1XMQB 2C5GA 1GPLA 3H7IA 3PE3A 2YFHA 4L73A 4RK4A 4WFJA 2C61A 2HA0A 5DGDA 3RSFA 4BV3A 4TMTA 3ZLVA 4M0EA 1FJHA 4ECAA 1P7YA 2J9RA 2MDTA 2B36A 4EATA 1WUIS 4A3SA 3C3WA 3LUPA 1CUVA 1T9BA 2R6FA 3DFIA 3CNLA 3A9VA 2OM2A 3HMKA 1AOXA 1PX2A 3N8KA 5DNYB 3ZHZA 4B6FA 5DWQA 2FCAA 1U0LA 3GC6A 3I83A 3FPFA 2GN6A 2GBFA 1LNZA 3E2PA 3F4LA 3H1AA 4EPTA 5CXQA 5EXDA 3EW9A 1Q7RA 4NTZA 3ZWNA 5KAMA 3S7ZA 1EHIA 1Z75A 4UUQA 3PQFA 3AVOA 3I9JA 1C3EA 2FYTA 5H59A 2YZKA 4Q1FA 1QONA 2XAUA 2VH5R 3B20A 3K09C 4GX5A 2JIZA 4LY6A 1OQAA 2QUKA 3EUFA 2J3MA 1KDPA 1QC5A 3IQGX 4PLHA 4KN6A 2JI7A 5AJWA 1TI7A 2ZM5A 4EELA 3DV0A 2ZE6A 5CLJA 1ZBDA 2YINC 4A1OA 1WULS 3SP1A 1SBYA 1JP7A 3DFZA 2XWSA 4IJ5A 1JFFB 4QOJA 4DM3A 4F85A 5EFZA 3C85A 2VK4A 3L1HA 5CXSA 2I8CA 3ZCUA 2R8YA 1PQ4A 3SJ7A 1WB5A 3DWFA 3G49A 3IDAA 4LI0A 3LHIA 3QEKA 4QECA 2FQQA 4WLVA 3REQB 3SR3A 4A2QA 4M9UA 5AVRA 3H2SA 4EL5A 1N6LA 3TRIA 3NWJA 4ZEMA 4IQ4A 5BMVB 1B1AA 4EUFA 4F9FA 1N8KA 5BUSA 2WUEA 3SHTA 1LQTA 1RJEA 3SFTA 2GF9A 1JPNA 1MQSA 4WCVA 3IOMA 4AZ3B 1KAOA 3F5QA 5EJMA 1EX9A 2WSIA 1YNOA 2GAIA 4UUOA 5ERXA 3NW9A 2NUBA 1ND6A 1QO0D 3TOCA 1JNXX 1IATA 2I2WA 4DR5B 2YOHA 4QEZA 4KXQA 3F96A 2QZSA 5E8RA 3F2VA 3RUHA 5JFGA 3R5XA 2CNBA 2ZYDA 2E37A 2WQ6A 2IEAA 3ZDDA 3V9PA 2Q2NA 3DGFC 1DAOA 4O4JA 5FNVB 1DINA 2C5SA 2ZUVA 4RENA 4F2WA 1GFWA 2FKNA 1LPAB 1Q91A 2RGDA 4YRDA 4YPOA 2QL5A 4V1CA 1IB0A 2ZZKA 3RYIA 4PN3A 2VF5X 1ZI8A 3U7GA 3Q9NA 4K9SA 1G5FA 2F17A 1ZXBA 4R9UC 3E4CA 2DCMA 2PEYA 1QR6A 3FYUC 4YP5A 4ZAFA 3QVXA 5DSZA 1M3SA 3HBMA 5I7UA 3WGVA 2IX9A 4RELA 4UNIA 3WHLA 1KMHB 1HT3A 3EXFA 2DF8A 1TVKB 1VJ1A 1P31A 3MOIA 4FOOA 4EMBA 4NCAA 1N6PA 1BJTA 1O54A 2H0RA 2UZ3A 1UPCA 4LX8A 1KC1A 3L7OA 4M6WB 5K3OA 1YQQA 1VRCA 3VR4H 1ZNWA 1JJVA 4WW0A 4S1VA 4Y9UA 4B1FA 3FVWA 3ZDXB 5BYKA 1DC8A 2O06A 5A5FA 2Q4RA 2EFYA 3S28A 2R60A 2AEEA 2OCDA 3KUDA 2A14A 3KFXA 3M9XA 1CQJA 4MWEA 4I8XA 1L3IA 3PEYA 5KOIA 1ZVVA 1VSQA 3W9SA 4ANFA 4LJAA 1U1CA 4ES6A 1SU8A 4S12A 5JSKA 2C9BA 3N2EA 4L28A 2IYQA 5TC4A 4IZOA 1K6XA 5HJ5A 2ECPA 1VSTA 3MMSA 4YVFA 3OZ7A 5J4HA 1GDHA 1TCCA 4P9NA 4IDHA 2HCBA 1BDIA 5A3RA 5C8YF 2PD3A 2IHVA 1LNSA 2H1VA 1TUGA 3NGLA 2ZSBA 3TE6A 4IJMA 4REQA 4IIGA 3VTFA 5JNRA 1KARA 5FI0B 2FPWA 4AM8A 1HYBA 1PR6A 3CH4B 5I4CA 2W6JD 3LVFO 3E3MA 4W9RA 2YKGA 3PNQA 1D09A 1P8AA 1I33A 3NIGB 3RFXA 5K0ZA 3I5UA 4NU8X 1GTMA 4C5BA 3I9MA 4RZXA 5DNUA 1E6KA 1XOIA 2IKSA 1J8QA 1HMYA 1J09A 2OE2A 1PJCA 3GGPA 3OOEA 4LYFA 2QTLA 1YCGA 5DHPA 3ETNA 2NSLA 3U4IA 4BMVA 1IDOA 4UHHA 1RRKA 1T8UA 1YXMA 2I55A 1P2VA 1FNDA 2P9BA 3EZFA 2X0FA 3HJFA 4QM6A 3N2KB 4HN2A 1KJWA 2WSBA 3N59A 1P2TA 3JQ6A 4IGFA 2ZWMA 4YWHA 3RRNA 4BKQA 2D2IA 4C1NA 3BD8A 5DRYA 1FSPA 3LVRE 4YDSA 5EE5B 5C3UA 4IH4A 5SY4A 2JHPA 4NH0A 2JFFA 4D3XA 2JZNA 2Q3LA 2TECE 2X9QA 5CLIA 1JHMA 4MI1A 2R7MA 1EQAA 1CF2O 2GUWA 5H4GA 2RHDA 2B30A 2E2WA 3CT6A 3GGOA 3BCUA 3JRWA 1WMSA 4KIUA 4U00A 4R5MA 4FYYA 4DSOA 1L5WA 2AW3A 2XOXA 3AFNA 4F4FA 5IHXA 4XB2A 3P9RA 3OKCA 4Z4FA 2PRZA 1X13A 1FFXA 2C4KA 3H6KA 3B53X 4OHXA 4FQ7A