4ESSA

Crystal structure of e6d/l155r variant of de novo designed serine hydrolase osh55, northeast structural genomics consortium (nesg) target or187
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
161
structure length
158
Chain Sequence
ARIRDVQGDITEFQGDAIVNAANNYLKLGAGVAGAILRKGGPSIQEECDRIGKIRVGEAAVTGAGNLPVRYVIHAAVLGDEPSLETVRKATKSALEKAVELGLKTVAFTAAWVGGLPAEAVLRVMLEEIKKAPDTLEVTGVHGTEKSAEAARRARLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of activated serine-containing catalytic triads with atomic-level accuracy.
pubmed doi rcsb
molecule tags De novo protein, hydrolase
molecule keywords OR187
total genus 57
structure length 158
sequence length 161
ec nomenclature
pdb deposition date 2012-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4essA00
2FG1A 4ZYQA 3GPQA 4J5QA 5DUSA 4TU0A 3VFQA 4ETJA 2EEEA 3EWQA 3V2BA 1YD9A 3PEIA 4R7MA 4JGKA 4K0CA 3KR5A 4K3NA 3H8EA 4R6TA 4ZX9A 4D86A 3GQOA 5CMSA 3ETIA 1SPVA 3KR4A 5HIHA 2BFQA 4JLLA 2EWBA 2J9AA 1LANA 2BFRA 2ACFA 3EWRA 3EWPA 5FSYA 2L8RA 3EJGA 5D8NA 1HJZA 5HOLA 3KQXA 3EWOA 4ETKA 3H8GA 5FSXA 3GQEA 3EW5A 3KZWA 3Q71A 2FAVA 4JVVA 3SIIA 5CB3A 3T8WA 4ZI6A 4IQYA 5FSZA 2LGRA 3V45A 4JCAA 1BPNA 1GYTA 3H8FA 4GVVA 1LAMA 4KYBA 5FSUA 4KSIA 4ZY2A 4ZX8A 4R76A 3GPOA 4ESSA 1LCPA 2X47A 1TY8A 5AILA 1BLLE 4ABKA 4ZY1A 3IJ3A 1TXZA 3KQZA 3SIHA 2VRIA 3EJFA 4UMLA 2AFCA 3SIGA 3EKEA 3GPGA 3Q6ZA 1VHUA 1ZR3A 5E3BA 5CB5A 4J5RA 3IIDA 3JZTA 4X2TA 5CBMA 2FXKA 4GUAA 4J4ZA 4ZY0A 2XD7A 1NJRA 2DX6A 1LAPA 1BPMA 1ZR5A 4J5SA 3JRUA 4GVWA 3IIFA 3SIJA 4ABLA 5FSVA
chains in the Genus database with same CATH superfamily
2FG1A 4ZYQA 3GPQA 4J5QA 5DUSA 4TU0A 3VFQA 4ETJA 2EEEA 3EWQA 3V2BA 1YD9A 3PEIA 4R7MA 4JGKA 4K0CA 3KR5A 4K3NA 3H8EA 2JZFA 4R6TA 4ZX9A 4D86A 3GQOA 5CMSA 3ETIA 1SPVA 2W2GA 3KR4A 5HIHA 2BFQA 4JLLA 2EWBA 2J9AA 1LANA 2BFRA 2RNKA 2ACFA 3EWRA 3EWPA 5FSYA 2L8RA 3EJGA 5D8NA 1HJZA 5HOLA 2JZEA 3KQXA 3EWOA 4ETKA 2JZDA 3H8GA 2WCTA 5FSXA 3GQEA 3EW5A 3KZWA 3Q71A 2FAVA 4JVVA 3SIIA 5CB3A 3T8WA 4ZI6A 4IQYA 5FSZA 2LGRA 3V45A 4JCAA 1BPNA 1GYTA 3H8FA 4GVVA 1LAMA 4KYBA 5FSUA 4KSIA 4ZY2A 4ZX8A 4R76A 3GPOA 4ESSA 1LCPA 2X47A 1TY8A 5AILA 1BLLE 4ABKA 4ZY1A 3IJ3A 1TXZA 3KQZA 3SIHA 2VRIA 3EJFA 4UMLA 2AFCA 3SIGA 3EKEA 3GPGA 3Q6ZA 1VHUA 1ZR3A 5E3BA 5CB5A 4J5RA 3IIDA 3JZTA 4X2TA 5CBMA 2FXKA 4GUAA 4J4ZA 4ZY0A 2XD7A 1NJRA 2DX6A 1LAPA 1BPMA 1ZR5A 4J5SA 3JRUA 4GVWA 3IIFA 2KQVA 3SIJA 4ABLA 5FSVA
chains in the Genus database with same CATH topology
2FG1A 4ZYQA 3GPQA 4J5QA 5DUSA 4TU0A 3VFQA 4ETJA 2EEEA 3EWQA 3V2BA 1YD9A 3PEIA 4R7MA 4JGKA 4K0CA 3KR5A 4K3NA 3H8EA 4R6TA 4ZX9A 4D86A 3GQOA 5CMSA 3ETIA 1SPVA 3KR4A 5HIHA 2BFQA 4JLLA 2EWBA 2J9AA 1LANA 2BFRA 2ACFA 3EWRA 3EWPA 5FSYA 2L8RA 3EJGA 5D8NA 1HJZA 5HOLA 3KQXA 3EWOA 4ETKA 3H8GA 5FSXA 3GQEA 3EW5A 3KZWA 3Q71A 2FAVA 4JVVA 3SIIA 5CB3A 3T8WA 4ZI6A 4IQYA 5FSZA 2LGRA 3V45A 4JCAA 1BPNA 1GYTA 3H8FA 4GVVA 1LAMA 4KYBA 5FSUA 4KSIA 4ZY2A 4ZX8A 4R76A 3GPOA 4ESSA 1LCPA 2X47A 1TY8A 5AILA 1BLLE 4ABKA 4ZY1A 3IJ3A 1TXZA 3KQZA 3SIHA 2VRIA 3EJFA 4UMLA 2AFCA 3SIGA 3EKEA 3GPGA 3Q6ZA 1VHUA 1ZR3A 5E3BA 5CB5A 4J5RA 3IIDA 3JZTA 4X2TA 5CBMA 2FXKA 4GUAA 4J4ZA 4ZY0A 2XD7A 1NJRA 2DX6A 1LAPA 1BPMA 1ZR5A 4J5SA 3JRUA 4GVWA 3IIFA 3SIJA 4ABLA 5FSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FG1 A;  4ZYQ A;  3GPQ A;  4J5Q A;  5DUS A;  4TU0 A;  3VFQ A;  4ETJ A;  2EEE A;  3EWQ A;  3V2B A;  1YD9 A;  3PEI A;  4R7M A;  4JGK A;  4K0C A;  3KR5 A;  4K3N A;  3H8E A;  4R6T A;  4ZX9 A;  4D86 A;  3GQO A;  5CMS A;  3ETI A;  1SPV A;  3KR4 A;  5HIH A;  2BFQ A;  4JLL A;  2EWB A;  2J9A A;  1LAN A;  2BFR A;  2ACF A;  3EWR A;  3EWP A;  5FSY A;  2L8R A;  3EJG A;  5D8N A;  1HJZ A;  5HOL A;  3KQX A;  3EWO A;  4ETK A;  3H8G A;  5FSX A;  3GQE A;  3EW5 A;  3KZW A;  3Q71 A;  2FAV A;  4JVV A;  3SII A;  5CB3 A;  3T8W A;  4ZI6 A;  4IQY A;  5FSZ A;  2LGR A;  3V45 A;  4JCA A;  1BPN A;  1GYT A;  3H8F A;  4GVV A;  1LAM A;  4KYB A;  5FSU A;  4KSI A;  4ZY2 A;  4ZX8 A;  4R76 A;  3GPO A;  4ESS A;  1LCP A;  2X47 A;  1TY8 A;  5AIL A;  1BLL E;  4ABK A;  4ZY1 A;  3IJ3 A;  1TXZ A;  3KQZ A;  3SIH A;  2VRI A;  3EJF A;  4UML A;  2AFC A;  3SIG A;  3EKE A;  3GPG A;  3Q6Z A;  1VHU A;  1ZR3 A;  5E3B A;  5CB5 A;  4J5R A;  3IID A;  3JZT A;  4X2T A;  5CBM A;  2FXK A;  4GUA A;  4J4Z A;  4ZY0 A;  2XD7 A;  1NJR A;  2DX6 A;  1LAP A;  1BPM A;  1ZR5 A;  4J5S A;  3JRU A;  4GVW A;  3IIF A;  3SIJ A;  4ABL A;  5FSV A; 
#chains in the Genus database with same CATH topology
 2FG1 A;  4ZYQ A;  3GPQ A;  4J5Q A;  5DUS A;  4TU0 A;  3VFQ A;  4ETJ A;  2EEE A;  3EWQ A;  3V2B A;  1YD9 A;  3PEI A;  4R7M A;  4JGK A;  4K0C A;  3KR5 A;  4K3N A;  3H8E A;  2JZF A;  4R6T A;  4ZX9 A;  4D86 A;  3GQO A;  5CMS A;  3ETI A;  1SPV A;  2W2G A;  3KR4 A;  5HIH A;  2BFQ A;  4JLL A;  2EWB A;  2J9A A;  1LAN A;  2BFR A;  2RNK A;  2ACF A;  3EWR A;  3EWP A;  5FSY A;  2L8R A;  3EJG A;  5D8N A;  1HJZ A;  5HOL A;  2JZE A;  3KQX A;  3EWO A;  4ETK A;  2JZD A;  3H8G A;  2WCT A;  5FSX A;  3GQE A;  3EW5 A;  3KZW A;  3Q71 A;  2FAV A;  4JVV A;  3SII A;  5CB3 A;  3T8W A;  4ZI6 A;  4IQY A;  5FSZ A;  2LGR A;  3V45 A;  4JCA A;  1BPN A;  1GYT A;  3H8F A;  4GVV A;  1LAM A;  4KYB A;  5FSU A;  4KSI A;  4ZY2 A;  4ZX8 A;  4R76 A;  3GPO A;  4ESS A;  1LCP A;  2X47 A;  1TY8 A;  5AIL A;  1BLL E;  4ABK A;  4ZY1 A;  3IJ3 A;  1TXZ A;  3KQZ A;  3SIH A;  2VRI A;  3EJF A;  4UML A;  2AFC A;  3SIG A;  3EKE A;  3GPG A;  3Q6Z A;  1VHU A;  1ZR3 A;  5E3B A;  5CB5 A;  4J5R A;  3IID A;  3JZT A;  4X2T A;  5CBM A;  2FXK A;  4GUA A;  4J4Z A;  4ZY0 A;  2XD7 A;  1NJR A;  2DX6 A;  1LAP A;  1BPM A;  1ZR5 A;  4J5S A;  3JRU A;  4GVW A;  3IIF A;  2KQV A;  3SIJ A;  4ABL A;  5FSV A; 
#chains in the Genus database with same CATH homology
 2FG1 A;  4ZYQ A;  3GPQ A;  4J5Q A;  5DUS A;  4TU0 A;  3VFQ A;  4ETJ A;  2EEE A;  3EWQ A;  3V2B A;  1YD9 A;  3PEI A;  4R7M A;  4JGK A;  4K0C A;  3KR5 A;  4K3N A;  3H8E A;  4R6T A;  4ZX9 A;  4D86 A;  3GQO A;  5CMS A;  3ETI A;  1SPV A;  3KR4 A;  5HIH A;  2BFQ A;  4JLL A;  2EWB A;  2J9A A;  1LAN A;  2BFR A;  2ACF A;  3EWR A;  3EWP A;  5FSY A;  2L8R A;  3EJG A;  5D8N A;  1HJZ A;  5HOL A;  3KQX A;  3EWO A;  4ETK A;  3H8G A;  5FSX A;  3GQE A;  3EW5 A;  3KZW A;  3Q71 A;  2FAV A;  4JVV A;  3SII A;  5CB3 A;  3T8W A;  4ZI6 A;  4IQY A;  5FSZ A;  2LGR A;  3V45 A;  4JCA A;  1BPN A;  1GYT A;  3H8F A;  4GVV A;  1LAM A;  4KYB A;  5FSU A;  4KSI A;  4ZY2 A;  4ZX8 A;  4R76 A;  3GPO A;  4ESS A;  1LCP A;  2X47 A;  1TY8 A;  5AIL A;  1BLL E;  4ABK A;  4ZY1 A;  3IJ3 A;  1TXZ A;  3KQZ A;  3SIH A;  2VRI A;  3EJF A;  4UML A;  2AFC A;  3SIG A;  3EKE A;  3GPG A;  3Q6Z A;  1VHU A;  1ZR3 A;  5E3B A;  5CB5 A;  4J5R A;  3IID A;  3JZT A;  4X2T A;  5CBM A;  2FXK A;  4GUA A;  4J4Z A;  4ZY0 A;  2XD7 A;  1NJR A;  2DX6 A;  1LAP A;  1BPM A;  1ZR5 A;  4J5S A;  3JRU A;  4GVW A;  3IIF A;  3SIJ A;  4ABL A;  5FSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...