4ESSA

Crystal structure of e6d/l155r variant of de novo designed serine hydrolase osh55, northeast structural genomics consortium (nesg) target or187
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
161
structure length
158
Chain Sequence
ARIRDVQGDITEFQGDAIVNAANNYLKLGAGVAGAILRKGGPSIQEECDRIGKIRVGEAAVTGAGNLPVRYVIHAAVLGDEPSLETVRKATKSALEKAVELGLKTVAFTAAWVGGLPAEAVLRVMLEEIKKAPDTLEVTGVHGTEKSAEAARRARLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of activated serine-containing catalytic triads with atomic-level accuracy.
pubmed doi rcsb
molecule tags De novo protein, hydrolase
molecule keywords OR187
total genus 57
structure length 158
sequence length 161
ec nomenclature
pdb deposition date 2012-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4essA00
2ACFA 3GPQA 1BLLE 3JRUA 2LGRA 1LANA 1TXZA 4J5QA 4GUAA 2DX6A 4GVWA 2EWBA 5DUSA 5FSYA 4KYBA 5FSVA 3H8GA 4ZYQA 5AILA 4R6TA 1BPNA 3T8WA 3EW5A 5CMSA 3EJFA 4X2TA 3EWPA 1LAMA 1TY8A 4J5RA 1VHUA 4ETKA 4J5SA 4K3NA 2X47A 3SIHA 3KZWA 4JVVA 2XD7A 4JGKA 3V2BA 4KSIA 1YD9A 4ZX9A 4JLLA 4ZX8A 1ZR3A 4ZI6A 5FSXA 1GYTA 3IJ3A 3EKEA 5D8NA 3GQOA 4K0CA 3SIIA 2EEEA 3KR4A 2L8RA 4TU0A 3EWQA 2FXKA 3SIGA 3EWRA 2FAVA 4J4ZA 4ABKA 3GQEA 3Q6ZA 5E3BA 1SPVA 4JCAA 4ZY1A 5CBMA 4R7MA 1HJZA 2AFCA 3VFQA 3GPGA 2VRIA 4ZY0A 5FSZA 5FSUA 4ZY2A 1NJRA 1LCPA 3PEIA 3KQXA 2BFQA 3GPOA 4ETJA 1LAPA 1BPMA 4UMLA 3EJGA 3KQZA 5CB5A 3JZTA 5HIHA 4ESSA 3H8FA 1ZR5A 3KR5A 2J9AA 3IIFA 5HOLA 2FG1A 3Q71A 3H8EA 4ABLA 4IQYA 4D86A 3V45A 2BFRA 3ETIA 4GVVA 4R76A 3SIJA 3IIDA 3EWOA 5CB3A
chains in the Genus database with same CATH superfamily
2ACFA 3GPQA 1BLLE 3JRUA 2LGRA 1LANA 1TXZA 4J5QA 4GUAA 2DX6A 4GVWA 2EWBA 5DUSA 5FSYA 4KYBA 5FSVA 3H8GA 4ZYQA 5AILA 4R6TA 1BPNA 3T8WA 3EW5A 5CMSA 3EJFA 4X2TA 3EWPA 1LAMA 2WCTA 1TY8A 4J5RA 1VHUA 4ETKA 4J5SA 4K3NA 2X47A 3SIHA 3KZWA 4JVVA 2XD7A 2RNKA 2JZEA 4JGKA 3V2BA 4KSIA 1YD9A 4ZX9A 2KQVA 4JLLA 4ZX8A 1ZR3A 4ZI6A 5FSXA 1GYTA 3IJ3A 3EKEA 5D8NA 3GQOA 4K0CA 3SIIA 2EEEA 3KR4A 2L8RA 4TU0A 3EWQA 2FXKA 3SIGA 3EWRA 2FAVA 4J4ZA 4ABKA 3GQEA 3Q6ZA 5E3BA 1SPVA 4JCAA 4ZY1A 5CBMA 4R7MA 1HJZA 2AFCA 3VFQA 3GPGA 2VRIA 4ZY0A 5FSZA 2JZDA 5FSUA 4ZY2A 1NJRA 1LCPA 3PEIA 3KQXA 2JZFA 2BFQA 3GPOA 4ETJA 1LAPA 1BPMA 4UMLA 3EJGA 3KQZA 5CB5A 3JZTA 5HIHA 4ESSA 3H8FA 1ZR5A 3KR5A 2J9AA 3IIFA 5HOLA 2FG1A 3Q71A 3H8EA 4ABLA 2W2GA 4IQYA 4D86A 3V45A 2BFRA 3ETIA 4GVVA 4R76A 3SIJA 3IIDA 3EWOA 5CB3A
chains in the Genus database with same CATH topology
2ACFA 3GPQA 1BLLE 3JRUA 2LGRA 1LANA 1TXZA 4J5QA 4GUAA 2DX6A 4GVWA 2EWBA 5DUSA 5FSYA 4KYBA 5FSVA 3H8GA 4ZYQA 5AILA 4R6TA 1BPNA 3T8WA 3EW5A 5CMSA 3EJFA 4X2TA 3EWPA 1LAMA 1TY8A 4J5RA 1VHUA 4ETKA 4J5SA 4K3NA 2X47A 3SIHA 3KZWA 4JVVA 2XD7A 4JGKA 3V2BA 4KSIA 1YD9A 4ZX9A 4JLLA 4ZX8A 1ZR3A 4ZI6A 5FSXA 1GYTA 3IJ3A 3EKEA 5D8NA 3GQOA 4K0CA 3SIIA 2EEEA 3KR4A 2L8RA 4TU0A 3EWQA 2FXKA 3SIGA 3EWRA 2FAVA 4J4ZA 4ABKA 3GQEA 3Q6ZA 5E3BA 1SPVA 4JCAA 4ZY1A 5CBMA 4R7MA 1HJZA 2AFCA 3VFQA 3GPGA 2VRIA 4ZY0A 5FSZA 5FSUA 4ZY2A 1NJRA 1LCPA 3PEIA 3KQXA 2BFQA 3GPOA 4ETJA 1LAPA 1BPMA 4UMLA 3EJGA 3KQZA 5CB5A 3JZTA 5HIHA 4ESSA 3H8FA 1ZR5A 3KR5A 2J9AA 3IIFA 5HOLA 2FG1A 3Q71A 3H8EA 4ABLA 4IQYA 4D86A 3V45A 2BFRA 3ETIA 4GVVA 4R76A 3SIJA 3IIDA 3EWOA 5CB3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ACF A;  3GPQ A;  1BLL E;  3JRU A;  2LGR A;  1LAN A;  1TXZ A;  4J5Q A;  4GUA A;  2DX6 A;  4GVW A;  2EWB A;  5DUS A;  5FSY A;  4KYB A;  5FSV A;  3H8G A;  4ZYQ A;  5AIL A;  4R6T A;  1BPN A;  3T8W A;  3EW5 A;  5CMS A;  3EJF A;  4X2T A;  3EWP A;  1LAM A;  1TY8 A;  4J5R A;  1VHU A;  4ETK A;  4J5S A;  4K3N A;  2X47 A;  3SIH A;  3KZW A;  4JVV A;  2XD7 A;  4JGK A;  3V2B A;  4KSI A;  1YD9 A;  4ZX9 A;  4JLL A;  4ZX8 A;  1ZR3 A;  4ZI6 A;  5FSX A;  1GYT A;  3IJ3 A;  3EKE A;  5D8N A;  3GQO A;  4K0C A;  3SII A;  2EEE A;  3KR4 A;  2L8R A;  4TU0 A;  3EWQ A;  2FXK A;  3SIG A;  3EWR A;  2FAV A;  4J4Z A;  4ABK A;  3GQE A;  3Q6Z A;  5E3B A;  1SPV A;  4JCA A;  4ZY1 A;  5CBM A;  4R7M A;  1HJZ A;  2AFC A;  3VFQ A;  3GPG A;  2VRI A;  4ZY0 A;  5FSZ A;  5FSU A;  4ZY2 A;  1NJR A;  1LCP A;  3PEI A;  3KQX A;  2BFQ A;  3GPO A;  4ETJ A;  1LAP A;  1BPM A;  4UML A;  3EJG A;  3KQZ A;  5CB5 A;  3JZT A;  5HIH A;  4ESS A;  3H8F A;  1ZR5 A;  3KR5 A;  2J9A A;  3IIF A;  5HOL A;  2FG1 A;  3Q71 A;  3H8E A;  4ABL A;  4IQY A;  4D86 A;  3V45 A;  2BFR A;  3ETI A;  4GVV A;  4R76 A;  3SIJ A;  3IID A;  3EWO A;  5CB3 A; 
#chains in the Genus database with same CATH topology
 2ACF A;  3GPQ A;  1BLL E;  3JRU A;  2LGR A;  1LAN A;  1TXZ A;  4J5Q A;  4GUA A;  2DX6 A;  4GVW A;  2EWB A;  5DUS A;  5FSY A;  4KYB A;  5FSV A;  3H8G A;  4ZYQ A;  5AIL A;  4R6T A;  1BPN A;  3T8W A;  3EW5 A;  5CMS A;  3EJF A;  4X2T A;  3EWP A;  1LAM A;  2WCT A;  1TY8 A;  4J5R A;  1VHU A;  4ETK A;  4J5S A;  4K3N A;  2X47 A;  3SIH A;  3KZW A;  4JVV A;  2XD7 A;  2RNK A;  2JZE A;  4JGK A;  3V2B A;  4KSI A;  1YD9 A;  4ZX9 A;  2KQV A;  4JLL A;  4ZX8 A;  1ZR3 A;  4ZI6 A;  5FSX A;  1GYT A;  3IJ3 A;  3EKE A;  5D8N A;  3GQO A;  4K0C A;  3SII A;  2EEE A;  3KR4 A;  2L8R A;  4TU0 A;  3EWQ A;  2FXK A;  3SIG A;  3EWR A;  2FAV A;  4J4Z A;  4ABK A;  3GQE A;  3Q6Z A;  5E3B A;  1SPV A;  4JCA A;  4ZY1 A;  5CBM A;  4R7M A;  1HJZ A;  2AFC A;  3VFQ A;  3GPG A;  2VRI A;  4ZY0 A;  5FSZ A;  2JZD A;  5FSU A;  4ZY2 A;  1NJR A;  1LCP A;  3PEI A;  3KQX A;  2JZF A;  2BFQ A;  3GPO A;  4ETJ A;  1LAP A;  1BPM A;  4UML A;  3EJG A;  3KQZ A;  5CB5 A;  3JZT A;  5HIH A;  4ESS A;  3H8F A;  1ZR5 A;  3KR5 A;  2J9A A;  3IIF A;  5HOL A;  2FG1 A;  3Q71 A;  3H8E A;  4ABL A;  2W2G A;  4IQY A;  4D86 A;  3V45 A;  2BFR A;  3ETI A;  4GVV A;  4R76 A;  3SIJ A;  3IID A;  3EWO A;  5CB3 A; 
#chains in the Genus database with same CATH homology
 2ACF A;  3GPQ A;  1BLL E;  3JRU A;  2LGR A;  1LAN A;  1TXZ A;  4J5Q A;  4GUA A;  2DX6 A;  4GVW A;  2EWB A;  5DUS A;  5FSY A;  4KYB A;  5FSV A;  3H8G A;  4ZYQ A;  5AIL A;  4R6T A;  1BPN A;  3T8W A;  3EW5 A;  5CMS A;  3EJF A;  4X2T A;  3EWP A;  1LAM A;  1TY8 A;  4J5R A;  1VHU A;  4ETK A;  4J5S A;  4K3N A;  2X47 A;  3SIH A;  3KZW A;  4JVV A;  2XD7 A;  4JGK A;  3V2B A;  4KSI A;  1YD9 A;  4ZX9 A;  4JLL A;  4ZX8 A;  1ZR3 A;  4ZI6 A;  5FSX A;  1GYT A;  3IJ3 A;  3EKE A;  5D8N A;  3GQO A;  4K0C A;  3SII A;  2EEE A;  3KR4 A;  2L8R A;  4TU0 A;  3EWQ A;  2FXK A;  3SIG A;  3EWR A;  2FAV A;  4J4Z A;  4ABK A;  3GQE A;  3Q6Z A;  5E3B A;  1SPV A;  4JCA A;  4ZY1 A;  5CBM A;  4R7M A;  1HJZ A;  2AFC A;  3VFQ A;  3GPG A;  2VRI A;  4ZY0 A;  5FSZ A;  5FSU A;  4ZY2 A;  1NJR A;  1LCP A;  3PEI A;  3KQX A;  2BFQ A;  3GPO A;  4ETJ A;  1LAP A;  1BPM A;  4UML A;  3EJG A;  3KQZ A;  5CB5 A;  3JZT A;  5HIH A;  4ESS A;  3H8F A;  1ZR5 A;  3KR5 A;  2J9A A;  3IIF A;  5HOL A;  2FG1 A;  3Q71 A;  3H8E A;  4ABL A;  4IQY A;  4D86 A;  3V45 A;  2BFR A;  3ETI A;  4GVV A;  4R76 A;  3SIJ A;  3IID A;  3EWO A;  5CB3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...