4ESYA

Crystal structure of the cbs domain of cbs domain containing membrane protein from sphaerobacter thermophilus
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
163
structure length
163
Chain Sequence
RVAEQARRRAIARAIRQVPIRDILTSPVVTVREDDTLDAVAKTMLEHQIGCAPVVDQNGHLVGIITESDFLRGSIPFWIYEASEILSRAIPAPEVEHLFETGRKLTASAVMTQPVVTAAPEDSVGSIADQMRRHGIHRIPVVQDGVPVGIVTRRDLLKLLLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the CBS Domain of CBS Domain Containing Membrane Protein from Sphaerobacter thermophilus
rcsb
molecule keywords CBS domain containing membrane protein
molecule tags Membrane protein
source organism Sphaerobacter thermophilus
total genus 45
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2012-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 4esyA00
2NYCA 5LXQA 2YZQA 1PVMA 2OOXE 4PCUA 3TDHC 3K2VA 4UUUA 2OOYE 2PFIA 3I8NA 3HF7A 3KPDA 4P1OA 1PBJA 4L27A 3K6EA 2QR1E 2QREE 4IY3A 2ZY9A 5K23C 1XKFA 4FRYA 2YVZA 3PC4A 2QRCE 4IYSA 2YVXA 4O9KA 4ESYB 5K25C 2YVYA 2RIFA 4L3VA 4IY4A 1Y5HA 2P9MA 4IY2A 2UV5A 5MMZA 2QLVC 2UV7A 2RC3A 3DDJA 3LQNA 2EMQA 3LV9A 3OCMA 3FNAA 3PC3A 4P1GA 4GQWA 4ESYA 3LFZA 2QH1A 3FV6A 3GBYA 4DQWA 4L28A 3KPCA 5KS7A 2D4ZA 1YAVA 3LHHA 2O16A 2RIHA 5K22B 3FWSA 4NOCA 3L2BA 4HG0A 1O50A 3KPBA 4IY0A 3OCOA 2QRDE 4GQYA 3OI8A 2UV4A 3KXRA 5K24C 3SL7A 3FHMA 3ORGA 2OUXA 3PC2A 3KH5A 2YZIA 3T4NC 2EF7A 4L0DA 5IIPA 3FWRA 3L31A 4COOA 4FXSA 4GQVA 2NYEA 2UV6A 3TE5C
chains in the Genus database with same CATH superfamily
2NYCA 5LXQA 2YZQA 1PVMA 2OOXE 4PCUA 3TDHC 3K2VA 4UUUA 2OOYE 2J9LA 2PFIA 3I8NA 3HF7A 3KPDA 4P1OA 1PBJA 4L27A 3K6EA 2QR1E 2QREE 4IY3A 2ZY9A 5K23C 1XKFA 4FRYA 2YVZA 3PC4A 2QRCE 4IYSA 2YVXA 4O9KA 4ESYB 5K25C 2YVYA 2RIFA 4L3VA 4IY4A 1Y5HA 2P9MA 4IY2A 2UV5A 5MMZA 2QLVC 2UV7A 2RC3A 3DDJA 3LQNA 2EMQA 3LV9A 3OCMA 3FNAA 3PC3A 4P1GA 4GQWA 4ESYA 3LFZA 2QH1A 3FV6A 3GBYA 4DQWA 4L28A 3KPCA 5KS7A 2D4ZA 1YAVA 3LHHA 2O16A 2RIHA 5K22B 3FWSA 4NOCA 3L2BA 4HG0A 1O50A 3KPBA 4IY0A 3OCOA 2QRDE 4GQYA 3OI8A 2UV4A 3KXRA 5K24C 3SL7A 3FHMA 3ORGA 2OUXA 2JA3A 3PC2A 3KH5A 2YZIA 3T4NC 2EF7A 4L0DA 5IIPA 3FWRA 3L31A 4COOA 4FXSA 4GQVA 2NYEA 2UV6A 3TE5C
chains in the Genus database with same CATH topology
2NYCA 5LXQA 2YZQA 1PVMA 2OOXE 4PCUA 3TDHC 3K2VA 4UUUA 2OOYE 2J9LA 2PFIA 3I8NA 3HF7A 3KPDA 4P1OA 1PBJA 4L27A 3K6EA 2QR1E 2QREE 4IY3A 2ZY9A 5K23C 1XKFA 4FRYA 2YVZA 3PC4A 2QRCE 4IYSA 2YVXA 4O9KA 4ESYB 5K25C 2YVYA 2RIFA 4L3VA 4IY4A 1Y5HA 2P9MA 4IY2A 2UV5A 5MMZA 2QLVC 2UV7A 2RC3A 3DDJA 3LQNA 2EMQA 3LV9A 3OCMA 3FNAA 3PC3A 4P1GA 4GQWA 4ESYA 3LFZA 2QH1A 3FV6A 3GBYA 4DQWA 4L28A 3KPCA 5KS7A 2D4ZA 1YAVA 3LHHA 2O16A 2RIHA 5K22B 3FWSA 4NOCA 3L2BA 4HG0A 1O50A 3KPBA 4IY0A 3OCOA 2QRDE 4GQYA 3OI8A 2UV4A 3KXRA 5K24C 3SL7A 3FHMA 3ORGA 2OUXA 2JA3A 3PC2A 3KH5A 2YZIA 3T4NC 2EF7A 4L0DA 5IIPA 3FWRA 3L31A 4COOA 4FXSA 4GQVA 2NYEA 2UV6A 3TE5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NYC A;  5LXQ A;  2YZQ A;  1PVM A;  2OOX E;  4PCU A;  3TDH C;  3K2V A;  4UUU A;  2OOY E;  2PFI A;  3I8N A;  3HF7 A;  3KPD A;  4P1O A;  1PBJ A;  4L27 A;  3K6E A;  2QR1 E;  2QRE E;  4IY3 A;  2ZY9 A;  5K23 C;  1XKF A;  4FRY A;  2YVZ A;  3PC4 A;  2QRC E;  4IYS A;  2YVX A;  4O9K A;  4ESY B;  5K25 C;  2YVY A;  2RIF A;  4L3V A;  4IY4 A;  1Y5H A;  2P9M A;  4IY2 A;  2UV5 A;  5MMZ A;  2QLV C;  2UV7 A;  2RC3 A;  3DDJ A;  3LQN A;  2EMQ A;  3LV9 A;  3OCM A;  3FNA A;  3PC3 A;  4P1G A;  4GQW A;  4ESY A;  3LFZ A;  2QH1 A;  3FV6 A;  3GBY A;  4DQW A;  4L28 A;  3KPC A;  5KS7 A;  2D4Z A;  1YAV A;  3LHH A;  2O16 A;  2RIH A;  5K22 B;  3FWS A;  4NOC A;  3L2B A;  4HG0 A;  1O50 A;  3KPB A;  4IY0 A;  3OCO A;  2QRD E;  4GQY A;  3OI8 A;  2UV4 A;  3KXR A;  5K24 C;  3SL7 A;  3FHM A;  3ORG A;  2OUX A;  3PC2 A;  3KH5 A;  2YZI A;  3T4N C;  2EF7 A;  4L0D A;  5IIP A;  3FWR A;  3L31 A;  4COO A;  4FXS A;  4GQV A;  2NYE A;  2UV6 A;  3TE5 C; 
#chains in the Genus database with same CATH topology
 2NYC A;  5LXQ A;  2YZQ A;  1PVM A;  2OOX E;  4PCU A;  3TDH C;  3K2V A;  4UUU A;  2OOY E;  2J9L A;  2PFI A;  3I8N A;  3HF7 A;  3KPD A;  4P1O A;  1PBJ A;  4L27 A;  3K6E A;  2QR1 E;  2QRE E;  4IY3 A;  2ZY9 A;  5K23 C;  1XKF A;  4FRY A;  2YVZ A;  3PC4 A;  2QRC E;  4IYS A;  2YVX A;  4O9K A;  4ESY B;  5K25 C;  2YVY A;  2RIF A;  4L3V A;  4IY4 A;  1Y5H A;  2P9M A;  4IY2 A;  2UV5 A;  5MMZ A;  2QLV C;  2UV7 A;  2RC3 A;  3DDJ A;  3LQN A;  2EMQ A;  3LV9 A;  3OCM A;  3FNA A;  3PC3 A;  4P1G A;  4GQW A;  4ESY A;  3LFZ A;  2QH1 A;  3FV6 A;  3GBY A;  4DQW A;  4L28 A;  3KPC A;  5KS7 A;  2D4Z A;  1YAV A;  3LHH A;  2O16 A;  2RIH A;  5K22 B;  3FWS A;  4NOC A;  3L2B A;  4HG0 A;  1O50 A;  3KPB A;  4IY0 A;  3OCO A;  2QRD E;  4GQY A;  3OI8 A;  2UV4 A;  3KXR A;  5K24 C;  3SL7 A;  3FHM A;  3ORG A;  2OUX A;  2JA3 A;  3PC2 A;  3KH5 A;  2YZI A;  3T4N C;  2EF7 A;  4L0D A;  5IIP A;  3FWR A;  3L31 A;  4COO A;  4FXS A;  4GQV A;  2NYE A;  2UV6 A;  3TE5 C; 
#chains in the Genus database with same CATH homology
 2NYC A;  5LXQ A;  2YZQ A;  1PVM A;  2OOX E;  4PCU A;  3TDH C;  3K2V A;  4UUU A;  2OOY E;  2J9L A;  2PFI A;  3I8N A;  3HF7 A;  3KPD A;  4P1O A;  1PBJ A;  4L27 A;  3K6E A;  2QR1 E;  2QRE E;  4IY3 A;  2ZY9 A;  5K23 C;  1XKF A;  4FRY A;  2YVZ A;  3PC4 A;  2QRC E;  4IYS A;  2YVX A;  4O9K A;  4ESY B;  5K25 C;  2YVY A;  2RIF A;  4L3V A;  4IY4 A;  1Y5H A;  2P9M A;  4IY2 A;  2UV5 A;  5MMZ A;  2QLV C;  2UV7 A;  2RC3 A;  3DDJ A;  3LQN A;  2EMQ A;  3LV9 A;  3OCM A;  3FNA A;  3PC3 A;  4P1G A;  4GQW A;  4ESY A;  3LFZ A;  2QH1 A;  3FV6 A;  3GBY A;  4DQW A;  4L28 A;  3KPC A;  5KS7 A;  2D4Z A;  1YAV A;  3LHH A;  2O16 A;  2RIH A;  5K22 B;  3FWS A;  4NOC A;  3L2B A;  4HG0 A;  1O50 A;  3KPB A;  4IY0 A;  3OCO A;  2QRD E;  4GQY A;  3OI8 A;  2UV4 A;  3KXR A;  5K24 C;  3SL7 A;  3FHM A;  3ORG A;  2OUX A;  2JA3 A;  3PC2 A;  3KH5 A;  2YZI A;  3T4N C;  2EF7 A;  4L0D A;  5IIP A;  3FWR A;  3L31 A;  4COO A;  4FXS A;  4GQV A;  2NYE A;  2UV6 A;  3TE5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...