4ETNA

Crystal structure of ywle mutant from bacillus subtilis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
148
structure length
148
Chain Sequence
SMDIIFVCTGNTSRSPMAEALFKSIAEREGLNVNVRSAGVFASPNGKATPHAVEALFEKHIALNHVSSPLTEELMESADLVLAMTHQHKQIIASQFGRYRDKVFTLKEYVTGSHGDVLDPFGGSIDIYKQTRDELEELLRQLAKQLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of YwlE mutant from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Low molecular weight protein-tyrosine-phosphatase ywlE
total genus 58
structure length 148
sequence length 148
ec nomenclature ec 3.9.1.2: Protein arginine phosphatase.
pdb deposition date 2012-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4etnA00
4RK6A 4G0XA 4Z4IA 3VNAA 2X7XA 3OQNA 2QU7A 3HVRA 5BRAA 2PUDA 4ZMSA 5C5EA 1CYEA 4Z99A 2L18A 4JB0A 2NT3A 1DCKA 1YK1A 7ABPA 1EFAA 4KREA 1TMYA 3DGEC 2FTKE 1YMVA 2B4AA 2L17A 3H5LA 3MF4A 1D4ZA 3HUTA 3N0RA 4MAAA 5KQLA 4NICA 3F73A 1W25A 2NUBA 2FMKA 3HDGA 1RPJA 1PHRA 1JLKA 2R48A 4W5RA 3A0RB 1ZAYA 3T8YA 2IPMA 4GNRA 3FFTA 1I3CA 1GCGA 3CTPA 4JASB 1JFVA 2MYTA 2NZVG 2YHAA 3MQ4A 4OLBA 4XXHA 3DZDA 3OLXA 1OXKB 4NCBA 1NXWA 3URMA 1PEYA 3QELB 1M5TA 5BR1A 2HPHA 4OBBA 4Z4EA 1ZN2A 2PUEA 5IUKC 1ZY2A 3G85A 3N0WA 4LE0A 3DGFC 2FEPA 1ZVVA 3I42A 2QR3A 2P4UA 1A0OA 3JVIA 4MQEA 1RXEA 3BRSA 1DC8A 1FFSA 1M5UA 1R8JA 1U8TA 3GRCA 4IRXA 3W9SA 3HK2A 5FWXB 5IEJA 1MVOA 4YR7A 2LP4Y 3KG2A 4PICA 4XASA 5IC5A 3SQNA 1ZESA 3FFXA 3RVOA 1EHCA 2PUCA 2F8TA 3EJWA 2JBAA 5EWMB 2L2QA 2H3HA 1EWVA 2IPLA 2MYNA 2V0NA 1U2PA 2WWVD 1DJMA 1DRKA 1QO0A 1E6LA 1QP7A 4MGEA 2PL9A 3CS3A 3ILHA 4RXTA 4G0MA 3D02A 3LUHA 3GV0A 4NQRA 1P8AA 2NZUG 1MAVA 2PMCA 2QZJA 1CEYA 3NNDA 4IF4A 4W5OA 2QVCA 3O75A 3CG4A 1NXVA 4PEVA 4G97A 1DCMA 1FQWA 4KV7A 4EVQA 3H6HA 5IEBA 4ZPJA 1TVMA 4LDAA 1AB5A 5KQPA 3TMYA 6ABPA 3GL9A 4G0ZA 5JNRA 2R47A 3CU5A 5EWLB 2MSKA 5TQ0A 4QICA 4XAQA 3O1JC 4N0PA 4RXMA 4CBVA 3O2QB 3Q7RA 1FFWA 1USKA 3UUGA 3OM1A 1JFSA 1ISRA 1FSPA 2E4ZA 2GKGA 3CLKA 3JY6A 1T34A 1VRVA 1GUDA 2WJWA 1C0EA 3CNBA 5TPWB 4ZJPA 3CZCA 3N8IA 3QLTA 3KSMA 2ID7A 5TE9A 5BQ3A 1KRWA 3M9WA 3NHMA 4ETMA 4Y9TA 1Z2DA 3ROTA 3MIZA 4MS1A 3LTEA 4N0QA 3O2SB 1ZH4A 3R0JA 4G86A 2FQXA 1S8NA 3CG0A 4ETNA 4Z4HA 4MR8A 1Z26A 1P6UA 1GCAA 2AYXA 3HV2A 4H60A 5TPZA 5HKOA 1Z15A 2CHFA 5TPWA 2FN8A 2WB4A 1NXSA 4JP1A 2JVKA 1LBHA 4RK5A 4WT7A 1OXBB 2ZWMA 2FEWB 3QX8A 2M1ZA 1Z16A 3RVQA 2FW0A 5KQGA 3KS9A 4Q6WA 3MM4A 3EDCA 3HZHA 2LIVA 4D74A 4EYQA 2JVJA 1VKRA 1BAPA 1DRJA 1JYFA 5T7BA 3KYJB 3QK7A 1XHFA 2PLNA 1XWWA 4N41A 3MA0A 3JTEA 1JF8A 4IGAA 5JNUA 2VYCA 3T95A 3OQMA 2QW1A 4EYKA 2E4YA 2HQBA 2RGYA 1EWKA 2QSJA 4L85A 5DGCA 4LX8A 3TB6A 3CFYA 2PE5A 1RZRD 3N75A 4RSMA 5HM6A 1MB3A 4FE7A 2GBPA 2HQRA 4EVSA 1JYEA 3H5WA 4G0PA 2L19A 4WXMA 2OENG 3H5IA 4MPTA 4KQ9A 1BA2A 4DN6A 3LUCA 3A3KA 2I6FA 5IUJC 2QXYA 4TLMB 3I45A 2ZAYA 3L49A 1QO0D 4L4UA 3KTOA 2FN9A 3H1FA 4O1HA 5E3JA 5CNMA 4ZMRA 3JPYA 4RU1A 2H0AA 4YLEA 1IIBA 2JRLA 1P6QA 2FLWA 3UKJA 4KPYA 1Z13A 5DKFA 5TQJA 1BDIA 2E4VA 4TMYA 4ML3A 4EYGA 3HS3A 1TJYA 4OATA 2PUBA 1SRRA 3GBPA 3C6QA 2FLKA 3QEKA 3OLWA 4KRFA 4RY8A 3FDFA 4MS1B 3F6CA 1YMUA 2IPAB 2WRZA 5EWJA 5FBKA 2P9HA 2FKAA 2IKSA 2KYRA 1ZHHA 4S04A 3FMVA 3RVLA 3RVKA 3JPWA 3QLUC 4KVFA 3T6KA 3N6VA 5GQSA 4KMRA 1B00A 4WUTA 3EGCA 3H5VA 3O21A 3DLBA 2HJ9A 4EY3A 3LKVA 4E7OA 3OQOA 3HEBA 4MQFB 4MR9B 5GOTA 1M2FA 3LUKA 4MQFA 1DBQA 2GI4A 3M9XA 3QLUA 5IX8A 1PNRA 2PKXA 2CD7A 1PUXA 3Q15C 4FE4A 5JNSA 4KK3A 4EYOA 1Z2EA 4OG2A 3RVPA 1WETA 1CHNA 1MIHA 5FBHA 1D5WA 1ZITA 5FWXA 4EGSA 1M2EA 3QLVA 4IMIB 5HSGA 1PEAA 3B2NA 4MQEB 9ABPA 4F06A 4LE1A 3T38A 4F8JA 2WJAA 2TMYA 1ZGGA 2DRIA 5IUNC 4H3HB 5F64A 1KMIY 3Q41A 1ISSA 1NTRA 4MRMA 3NNNA 4DQDA 3L6UA 4NV3A 3RVSA 5TPZD 3SG0A 3EODA 3RQIA 1P2FA 1ZGZA 3E3MA 4RXUA 4WXEA 3IP9A 4H3KB 2PUFA 2R25B 4XARA 5PNTA 3HDVA 1W9HA 3KHTA 3F7NA 3TD9A 1Z18A 2IDMA 5JNWA 4YCSA 2IPNA 3CHYA 4JAVC 4MYRA 4Z9AA 3H1EA 4RKQA 4W5NA 5DTEA 3LUJA 3OMWA 4XFKA 3ROFA 2VK2A 3M6MD 1SD5A 5KC9A 4MRMB 2HSGA 3SAJA 1GLGA 3K9CA 4RWEA 3VNBA 4RY9A 4WZZA 1YVUA 3LUFA 4MLDA 4E7PA 4KZKA 1YS6A 5T3YA 2FMIA 1EAYA 2PJUA 2O20A 4JA2A 4PZ0A 3KCNA 1PNTA 4XLTA 3TX6A 3CRNA 1JDNA 3JS5A 4G0QA 1UDRA 8ABPA 5I4CA 2N9UA 5CHYA 4W5TA 3TO5A 2B1JA 3GBVA 3LOPA 3QELA 4MS4A 4OTZA 1QP4A 3A0UA 3E61A 3LKBA 1JFTA 3H5TA 3NHZA 4MR9A 2FXIA 1SXGA 3LUGA 1JHZA 3MYYA 4TN5A 5JNVA 2E4XA 1BDHA 1KRXA 4MR7B 4YRZA 3CKMA 3H5OA 4P1ZA 3S99A 5EWLA 1NXXA 3GT7A 1NY5A 3OLZA 4HNSA 3RVRA 2JVIA 1EWTA 4O5AA 2MSWA 1L5YA 2Q5CA 1C4WA 2PL1A 2MSLA 4W5QA 3LMKA 4RKRA 4YO7A 3IP6A 1ABFA 3EQZA 1NATA 2QVGA 3IPAA 3N0XA 1KGSA 3D8UA 3QEMB 4Z4GA 4JB2A 5ABPA 3HM9A 4YGXB 3O2JA 5KI6A 2M98A 3O74A 1JWLA 5KQMA 2OQRA 2PUAA 3OMXA 3IP7A 4N76A 4Z0NA 2MYPA 4LE2A 1GUBA 2HQOA 3C3KA 3BREA 5JS2A 2LPMA 5DCLA 1D1QA 4N47A 1SXHA 2JK1A 1BVHA 1LJUA 1E6MA 3EQ2A 2FMHA 4RK7A 5BRJA 5FWYA 1VPWA 3O1IC 1AB6A 4KNYA 2FEKA 4RY0A 1Z12A 1FFGA 3EAFA 1TLFA 3I5AA 4NCAA 5HQJA 1YK0A 2GX6A 2FVYA 5IULC 1DP4A 2J48A 3CZ5A 4KFCA 2E4WA 3MMNA 2R4QA 3FGZA 5B3JA 1YTUA 3KYIB 3RVMA 4HYEA 1DZ3A 1Z25A 3C97A 2PUGA 4F11A 3OO1A 1H9CA 2CWDA 3C3WA 3QLVC 3OO0A 2A9QA 1U0SY 1K66A 3GA5A 5C5CA 5CNKA 2IYNA 1DBWA 1DBPA 2LUOA 4LRQA 1USGA 2MYUA 5TQ0B 4JOQA 4O1IA 4MR8B 1HEYA 2A9OA 3KKEA 4Z9BA 4G0OA 3I09A 1MB0A 5TQ2B 3F6PA 1ZH2A 4WWHA 2RJOA 1E2BA 4RZSA 5JNTA 1A2OA 1DC7A 3NBMA 1L5ZA 1A04A 3SM9A 5KWSA 4IMJB 4HNQA 4MS3A 1VLZA 3IP5A 1QNLA 4P98A 1XHEA 2CHEA 4EUKA 4ZYLA 4RK0A 1QQAA 2YHBA 3SNKA 1JDPA 1NXTA 1ZDMA 3N53A 5DLEA 4TLLB 4EVRA 1QQBA 2A9PA 4Q7EA 1D2AA 3QX9A 4UHKA 1QMPA 2W42A 3HSYA 4F12A 2LBPA 3BILA 3LFTA 3RVNA 2FQWA 3A10A 2XDYA 4UHJA 4F3TA 3JVDA 2WMYA 3OM0A 4QPJC 3RVJA 4LDZA 1JH9A 2NT4A 3G1WA 4QYMA 5CNIA 4M88A 3FFWA 1F51E 3HUUA 4YWHA 1Y1LA 4RV5A 5EWMA 2VUIB 1RNLA 2F8SA 3OLVA 1J56A 2E4UA 3DBIA 4PYRA 4RK4A 3O1HB 4LZLA 4RK1A 3KJXA 3C3MA 1BDJA 1LJLA 1ABEA 4DADA 3LUAA 5ED4A 2BGGA 1JBEA 3QEMA 3K4HA 4YP9A 1E6KA 4D6YA 3HCWA 3KLOA 2GWRA 4IILA 2RJNA 3BRQA 3ILYA 4HNRA 5KC8A 3KLNA 1QP0A 3IPCA 2FQYA 2JB9A 2FMFA 3BBLA 1JL3A 1NXOA 5D2CA 3HJFA 3H6GA 3H1GA 6CHYA 4Q6BA 1U2QA 1U04A 3RH0A 4YV7A 1K68A 1QKKA 1D1PA 5JS1A 2ID9A 4PE5B 4RS3A 2IOYA 2AYZA 3SY8A 3Q9SA 1LK0A 3GYBA 1DG9A 3HO1A 4N03A 2RDMA 1YS7A 4KQCA 3NNSA 3HXMA 4MS4B 3OLYA 1RZRA 4RDCA 2PAFA 2JCGA 1F4VA 4GPAA 3H75A 4B09A 2A9RA 4FB4A 4MS3B 1APBA 5EWJB 1SXIA 3LUDA 5IBQA 1Z17A 1USIA 3IDOA 2QV0A 3GWGA 1TM2A 4S05A 3Q7TA 1QPZA 1LBIA 1JX6A 5CNJA 2VUHB 5TQ2A 4ETIA 1NXPA 4D6XA 2WY2D 3UK0A 4G0YA 1YIOA 3Q7SA 4YS6A 4MR7A 3EULA 2JBAB 4KK4A 4MLCA 3P9YA 1URPA 5FWYB 1DCFA 4Z4FA 4OLAA 4QYWA 1RXIA 5B3JC 4Z4CA 3DLHA 2FSPA
chains in the Genus database with same CATH superfamily
2P1DA 2C5HA 3RRYA 3K8YA 5EY5B 5AKKA 4QJBA 5JXJA 3ZY5A 4MPPA 4A8TA 4HGQA 3RKUA 2QMHA 3VC1A 1P2TA 4L28A 5G0VA 1JR3D 4V0ME 4UULA 3D6JA 4XB6B 1N9GA 2HCFA 2PXCA 3OOJA 4W7HA 5IJXA 3A2LA 4LNAA 4L8LA 1YR3A 2WMOB 4BNFA 1LF5A 4M0EA 4I4CA 1E3DA 4E3ZA 1YK1A 1OI2A 1UT6A 1CEQA 2QTVB 4CCSA 1V8FA 2R5WA 4GKVA 3F8TA 4DGQA 5EJIA 3LC7O 3HUTA 4DR2B 5G41A 1R0WA 4QREA 1BMFD 2YIVX 1RPJA 2PGJA 3RS5A 2W43A 1UC8A 5C7YA 2M6SA 3TTXA 2O0HA 2Q6KA 3ENZA 2IV7A 2JFWA 2PZ8A 1I3CA 1EQAA 1L4EA 3P0IA 1FW8A 5FOSA 1JFVA 1XQ6A 3SXJA 3DQQA 3EDOA 5FPKA 1B8PA 1RYEA 2NZVG 4XFJA 3ER8A 1DWQA 2PT5A 1EVIA 1GEEA 2FFBA 3A6ZA 4H7EA 1OXKB 2GBIA 4JL5A 4A2QA 1E8MA 1XMXA 3DVQX 4P5DA 3WYGA 2Y0CA 2B7CA 5KCZA 5FBVB 2HCTA 2VRCA 5A6SB 4TWRA 4BRZA 4OYHA 2QU8A 2ZJ5A 1VIVA 3M81A 4LKOA 3JQBA 4YRMA 5IUKC 3RAEC 2J3MA 4DV2B 4UUPA 5K3SA 3WZ2A 3DSRA 1CNMA 1ZISA 3MN1A 5AW4A 2ZQYA 2GBFA 1U31A 1TYBE 3M6LA 3QOXA 4TX1A 4AWAA 2ZYDA 2R66A 2Z2XA 2E6KA 1BMQA 4I2VA 4BQSA 3GDFA 2BHTA 4DB2A 1DMSA 2Z8YM 3ROMA 1CX9B 4QJ5A 1JIJA 3WKBA 3ENQA 4L9AA 1PJ2A 4WACA 1MG5A 4ENUA 2C0CA 2VCHA 3OOWA 2JDIA 4NZMA 1BEUB 3SQNA 3OEHD 3N2KA 1ZESA 4F0JA 2QZ9A 3PEUA 2DULA 2KX7A 3AOEA 2KBEA 4X61A 4LNUB 3UV6A 4M49A 4NATA 4BZZA 1LZKA 1W36D 2A9KA 1AU9A 1GD1O 4CLRA 1PLKA 2CBZA 2H2FA 2WVJA 3RG8A 1ENZA 1OTHA 1DRKA 4P3NA 1XALA 2OYCA 1M7GA 2ZRDA 4JLSA 3T5MA 3N2YA 1U7DA 3PFNA 4DLNA 3ROGA 5ALYA 3JQCA 1AA9A 3GLRA 1C1DA 4RHYA 2M2IA 4MULA 4TZTA 4U7PB 3DCYA 4L8FA 4ZOQI 4O2AB 3OT1A 4B33A 3QE2A 3SR0A 1D3AA 3JQFC 3C74A 1L5GB 2FW7A 3Q0EA 1DCMA 2D5IA 1ZGCA 4UM5A 4ZPJA 1TVMA 1LNQA 4LDAA 4P5EA 1USVA 4ENQA 1ACJA 3IOEA 3IP1A 3MQFA 2EBHX 2EL7A 4L9RA 4FDLA 3TW6A 3CU5A 1Z22A 3WADA 2EWVA 1Z0ZA 3BTUA 3TFQA 2IX3A 1ZI8A 3AL3A 5ICGA 4EATA 4AWXA 2HJVA 3IBGA 5F77A 1S2LA 4D5EA 5A5EA 2E85A 5JS8A 1RXWA 1L4NA 4GAEA 2YW9A 4QJIA 3OM1A 3P45A 1HE5A 1FSPA 2L0XA 2AEEA 4B5KA 1JECA 2ZBPA 4E2FA 4WADA 5FXMA 4M9XA 1VRVA 4DDKA 4RULA 3ZJTA 4DMKA 5IVIA 4B2YA 1Q50A 1ZNZA 2PL3A 5DP2A 5GVSA 2VT6A 1HDXA 4V03A 4CGYA 3KSMA 3WLQA 4BNIA 4DBVO 5BQ3A 1WOYA 4WNIA 4M53A 3TOVA 1R9GA 4IJVA 1AS0A 3TMKA 3I64A 2D2VA 3BL5A 4Z49A 1J70A 3TG2A 4HOYA 3T4PA 4HLUA 3KOUA 2LTAA 1DDGA 3CG0A 2H0QA 1W6RA 1Y4UA 2PSJA 1KEUA 3HB0A 1QTIA 3OC6A 4FMDB 1P18A 2AYXA 2ODAA 4NS1A 4XOIA 5FH9A 1DTEA 4Q3LA 1E64A 4K6FA 1HOTA 3OG9A 2O59A 4PONA 2CY0A 1EFHA 1NLMA 2ZWMA 4I5EA 2UUCB 1S7CA 3V2HA 3BD7A 2CHUA 4JYBA 4ZVNA 4PLZA 3EMVA 1LA2A 1AXEA 3QH4A 2JVJA 1V26A 3NIDB 1KI2A 1JIVA 1A9QA 3AP1A 2JFVA 4WHMA 3OZ7A 3EH1A 1N34B 1FCJA 1XUOA 1H8ED 4AM8A 2C57A 3BJIC 1XWWA 1G18A 1W4RA 1RZUA 4AYWA 1RXSA 2ORIA 4GRIA 5DT9A 1ECJA 4TT3D 4IGAA 2VYCA 4AUKA 1PGPA 3D3WA 1N5IA 2P5SA 4X85A 2E4YA 4N82A 4CG1A 5HIAA 4Q39A 3NTVA 4M8LA 1ULHA 1E2IA 4RVCA 3I8XA 1MT3A 4UHCA 3HC7A 1CUIA 5B3AA 4Q3OA 2NTJA 3DZFA 3ESQA 3VR6H 4FU0A 4HFMA 5KREA 3ZY4A 2Y1WA 3N70A 2KLBA 5G0TA 2OENG 1ZNXA 2I1LA 3QU4A 3OPYI 4MPTA 5EJFA 5T4EA 5LOVF 4X6LA 1XKQA 1Z0DA 1ZA2A 5EGNA 4KXLA 1KAOA 5CXXA 5GM2A 1ZK2A 1L5NA 3LQ4A 2WSIA 2HDNB 3TWOA 2QMYA 2ZIXA 1KSHA 6NULA 4IM7A 1OAAA 4C0BA 2QLFA 1UKYA 2FZ4A 1IIBA 3NEPX 2Y67A 1SULA 1IQPA 2ACWA 4IZOA 1T10A 4MV5A 3IJRA 4ZZIA 3JQQA 4WA8A 3IJEB 4OATA 4HMPA 1FXWF 2QTCA 4J8PA 2ZRHA 3OECA 3QNMA 4DXHA 4UE3S 1KFKB 1Q21A 3ISVA 2A0YA 2XMBA 4BLWA 5EWJA 2PSEA 3UTDA 2BAGA 4TN1A 1FDUA 1G8YA 1ZHHA 1YBMA 3JWHA 5H02A 4YRJA 5TDHA 4B6EA 2EJCA 5D1NA 3HR8A 3ZXUB 2W2LD 1OJ7A 2YL2A 2RKOA 2ZS9A 1N6RA 3C6ZA 4X8OA 1R2QA 3IBCA 3M3HA 1JBKA 1ZLYA 2XODA 1XVLA 1GUYA 2PUHA 3KFXA 1T13A 4QUKA 3SSOA 4E7OA 2RSLA 1O4VA 1ADYA 3HVHA 1P3JA 3ZEAA 3GPDG 4JC8A 4MQFA 3W78A 5DBIA 1PNRA 4NLLA 3ESCA 3L46A 1BXRA 3GZJA 4OG2A 3THWB 5JVDF 3JZFA 4ZKDA 1CHNA 4BMZA 3ACBA 2G9ZA 4KAXA 4B6OA 2HYIC 2WJIA 3D8SA 2GCIA 3KKZA 4WINA 3IBYA 3WYDA 4YAOA 4NE9A 4U7GA 5LYJF 1ACLA 4BB9A 1U1FA 2NLOA 5L3RA 4IYRA 3RVBA 2OXFA 4NDAA 2P65A 2WJGA 5HKLA 4O4IA 3TOZA 4NP6A 1J8MF 4AJKA 3AB3A 4XVCA 2XNHA 1IY8A 1EUQA 1N0HA 1HNZB 3FRJA 1M1NB 3MRTA 2A5FA 1J99A 2IITA 4GD3Q 1RJFA 3ND7A 1UL1X 4JP3A 3RTGA 3UZUA 1Q84A 4EHJA 4F38A 3EZ2A 1BA3A 4F3NA 1RWQA 2R25B 5ECYA 4MW4A 5IJZA 4D42A 4MWGA 4K5QA 2V7BA 1PL7A 1FLNA 2F6RA 2MTBA 1AHHA 1KE2A 1NMXA 3HKCB 2I1QA 1MPTA 4RADA 5KSWB 4E1AA 4P80A 3QF7A 2QR5A 4K03A 1QVWA 2OV1A 2PJDA 3PC6A 2H1RA 3COVA 4MZXA 4M0PA 1MQSA 3MWKA 4MQ4A 1G1AA 4YQEA 3C4VA 5T3UA 3KOZA 4IVRA 1V5FA 1Y37A 2VHWA 4KQJA 1W1IA 2WV7A 5CRIA 1KZ1A 2XMSA 2YHIA 3FYUC 3O8OA 4RGVA 3FMPB 1XYYA 2AOXA 5I47A 1HK7A 4NI5A 3D6FA 5LKRA 4EP1A 3ZOKA 3B3QA 2OWEA 4CEHB 5F52A 5F5XA 4RF5A 3UXMA 1HY3A 1EG2A 3QI2A 4R9SA 1AKMA 1OA1A 2ST1A 2FK8A 1UWCA 1B0AA 1P45A 2OXCA 3H7AA 4QPCA 2WHQA 3F7OA 1LFAA 3P5BA 3BMQA 4JVOA 2GERA 5IDVA 1SXGA 2JAUA 2VJMB 1PYDA 2X1MA 4TTIA 3QV2A 4E5YA 1X1AA 5A4KA 3QFCA 3C8HA 4C87A 1N0UA 5DCYA 1X7GA 1YH3A 1Z9BA 2H18A 5B5SA 3BULA 2P79A 4K3VA 5EUQB 1XTRA 3DOEA 5F2EA 3QPAA 3FGNA 4CIVA 2Z1DA 4JJAA 5BMVB 2BCGY 4W6QA 3WLRA 5IKMA 2YBDA 2NXCA 4FCVA 4DY6A 4NOLA 1TVEA 3GGGA 4RGBA 2Q4TA 4CF3A 1P2BA 3DXFA 3OZIA 2CVOA 2ZWAA 1WDMA 3KT0A 1LEHA 3SXUA 3VPDA 2ECOA 3OCVA 5D3MA 5CD1A 4W99A 3B7GA 2WUGA 3TR5A 1ENOA 1KZGB 1JLLA 4BCCA 3O7WA 4KAFA 4N76A 3JRNA 1IOWA 4ENTA 5IASA 1E2GA 2OYSA 3NIWA 4EJSC 4DLRA 5LLDA 1GDTA 3QVSA 3B6ZA 4QWWA 4C7BA 2UUAB 1L8OA 3PRHA 3MTAA 2OQ2A 1M6WA 2QG6A 2GJAA 3C1TA 3OSUA 3SS8A 1V16A 1L5QA 2XA2A 1IRIA 2ATXA 1SKUA 1Q1EA 4QBGB 3EPRA 3LU1A 1ISPA 2F3RA 1DI0A 2CVHA 4DIBA 5EMLA 3V33A 1PLJA 4IUDS 1ESMA 3KLPX 1DO8A 3ICPA 4BNTA 5KDOA 3IUSA 4PNPA 3VNRA 2E55A 3B1ZA 3PNKA 1CULC 2QVLA 4F2DA 5LQMA 1IDOA 5ALMA 2XNDD 3NDRA 4JBIA 2QBYA 2C9OA 3QVGA 4BBJA 4B7ZA 2V6GA 1YBVA 3OT5A 4MKIA 5AQ1A 2Q5FA 3GGCA 4BYMA 1AKUA 4H59A 3LLMA 1B0PA 2ORED 4H17A 4R1TA 3AIOA 5IKEA 4GR9A 3IVMA 3WLIA 4BUZA 3RK1A 1O6CA 1T0HB 3VZCA 2WI8A 1GTRA 4IIBA 4H7IA 4HQLA 3OJFA 1KAHA 5IC6A 3E35A 3Q8KA 2Q5LA 1TT5B 1UINA 2EZTA 2FUKA 4K6OA 4TKVB 4A2PA 1YAJA 2XE6A 3VKVA 2C00A 5CA0A 1GRNA 3SEQA 3IQEA 4Q3EA 3VNUA 2YWEA 3I53A 2OILA 4R9UC 3HLTA 4RTPA 1W7AA 2CK3A 2O2ZA 1G16A 3RF6A 1ML4A 3FPGA 5I9TA 3VVCA 3RKSA 1RWOA 1AGXA 2A3NA 1DQSA 2IYRA 4C7MA 3UCEA 3WGLA 2VPYA 1L7EA 1OIXA 1C9DB 2QN7A 2BEUA 3U09A 2D6FA 4J9VA 3U4IA 4MVJI 4UTPA 3PKZA 5HXAA 3AF1A 3G2OA 3OFND 2W58A 1DIRA 1XAGA 3G2MA 3UHOA 3KUDA 4P7JA 2BYTA 4LEIA 1CJCA 1R0KA 2YHBA 3VR4A 1SUAA 4YJGB 1P4AA 1NXTA 5E2IA 3T9CA 3DF7A 1C7JA 1O8CA 1TQ8A 1ZMXA 2FEAA 2ZR9A 2Z3WA 3GY0A 3GLHA 4RFVA 3ASVA 4MLZA 4XEUA 1SR8A 1UMDA 3VOTA 3RBAA 3ME5A 3T4UA 3S1LA 5AW1A 1GSIA 5JCOC 1C4KA 5AVQA 3RVJA 4F3TA 2XSZA 2UKDA 3OM0A 4HS9A 4F84A 3VKGA 4U2FA 3OIYA 3X1YA 4N3NA 5C3UA 3WGNA 3T1NA 3E82A 3K0BA 5CH3A 5LQNA 4X92A 2OHJA 1N9KA 4HLDA 1KFJB 1P1IA 4AUEA 4J49A 1TW3A 2FPIB 4RK4A 1RVV1 2WFAA 2YV3A 2WJ4A 3O03A 2VHCA 4KGDA 4HBGA 1BDJA 2GN0A 3TTSA 2XCIA 1L4HA 1Q2XA 2BOVA 5CLIA 2ZT5A 1KYIA 1XZEA 3QEMA 4PTZA 2DERA 2X9LA 1U3FA 4F72A 5CITA 4ZI5A 1E3QA 2ZYVX 3G9QA 2AE1A 4I9NA 4MUMA 5EEHA 4UUBA 5AVSA 2J9FB 2RJNA 3DBOB 3KJNA 3BRQA 3OE7D 4BVHA 4CKEA 1RRMA 3WTCA 3JWJA 4PLPA 3SM3A 3DL4A 4KE9A 2VXCA 4CIBA 4MO9A 5LL6P 2NZJA 5JW6A 1J8YF 4TQGA 3KQKA 3ZYCA 4QGGA 1BHQ1 4EG6A 1ZEMA 4IDEA 4PE5B 3AWDA 3N8DA 2VDWA 3GYBA 2QM0A 4JJZA 2OAGA 4FHZA 4EX7A 1ZR2A 2LW7A 1KDRA 3OF3A 3RDPA 3SVTA 3GEBA 1E59A 3DNMA 1F4VA 4QRDA 1ISJA 1TQHA 3K6JA 4N7RA 2WP8J 3VV2A 3WO0A 5A4MS 2XB6A 1MH1A 3L2OB 1LVGA 2V65A 2X2OA 2QUZA 3WR5A 3DONA 2ZYSA 5FPPA 3GWGA 2PZJA 1J5XA 1GLNA 4QARA 2VDMB 1F8FA 1MNQA 2OZVA 1OFHA 4OXQA 1T8WA 2O52A 3A6LA 4Q4AA 2A57A 4ETIA 1PLLA 1T25A 1YIOA 1V1MA 2IPOA 3D9QX 1PTJA 3GB9A 4XRGA 3GAFA 1QRRA 2HWKA 1IYZA 2IU4A 4H1UA 4HGOA 4WFIA 1KE1A 3FPFA 5JPDA 3H1TA 1NRIA 2JBWA 4WPGA 4KN8A 2BRUA 4URYR 1R4NB 5THKA 3JQFA 4J1TC 3S27A 2YY5A 5A3VA 1R4MA 4GGOA 4X9XA 2G1KA 3MUOA 1JIIA 1OWPA 4I36A 4JC0A 4ZMSA 5JMWA 1Q0UA 3L1KA 4FGLA 2P35A 2QX6A 1O9HA 1RAEA 1XTJA 4L8VA 4OB6A 2IH4A 5JBNA 2JEYA 1GFZA 1LBTA 3MGGA 1JFLA 3SC2A 1RC8A 2AD5A 3BJMA 4FYYA 4B48A 2D7JA 1GSAA 2I4MA 2JIMA 3E9CA 1YONA 4GR4A 4LXGA 4YP7A 1XFAA 3HRHA 5E6SA 1Q11A 2GPWA 3NDJA 5EJ5A 5KQLA 3BXEA 2G1UA 1L5OA 1ZC3A 1E2HA 4O2AF 4RVSA 2C2YA 2X8WA 2ZRNA 3U7RA 4RHEA 3VDMA 4IR7A 5J59A 3P94A 3P19A 1S4QA 1UXKA 3STUA 3OLXA 4I2NA 1ODCA 2CNBA 3TI9A 5KQRA 2NU6B 2B9VA 2PKWA 4WCDA 3E7DA 3C87A 5TMDA 2EG5A 5IHXA 1SU8A 1UPAA 2C58A 5E1OA 2PV7A 3NGXA 4Q4HA 1T36B 2Z83A 5H3LA 2BFCA 3SX0A 3DKPA 3WL6A 2WKWA 1ZGJA 5HKAA 1OUMA 1AUXA 1SCAA 3NT5A 3UPDA 5CDFE 1H6CA 4WKPA 5KIAA 3LWBA 2BKLA 5JZBA 1G8GA 1HI9A 3GXBA 4PO9A 3L1VA 1FFSA 1M5UA 4LYEA 3HK2A 1RE0A 4M0CA 1HE8B 1RWXA 3IT1A 1V2HE 4KLNA 1DRVA 1QAOA 4LRSB 2D2FA 2QZZA 4X1YA 2HA4A 1ZIYA 4JLAA 1QX3A 4OQLA 4ZAFA 1R12A 2IQ5A 2DTDA 5CX1B 1A9ZA 1ODIA 2XEXA 4LRUA 2F8TA 1M34B 4M8IA 2C9DA 4MW7A 3FW1A 4C6TA 2V0NA 1OWLA 1U2PA 3NVAA 3O83A 5B7PA 3I01M 4F4FA 4ED9A 1ESZA 1NOJA 5AK5A 1EG7A 4CNQA 1ECCA 5KDDA 2QIPA 2IH2A 3UWMA 2OG2A 4DRXA 5MFPA 4OL0A 2F3QA 1E9FA 3ILHA 5KYNA 1O95D 4G67A 1JAZA 1EINA 2F8LA 1N3IA 1AGNA 1EP2B 1XNQB 2W93A 5HS4A 5K01A 3FROA 3GCWA 1RYHA 5KOYA 3P9PA 4GM4A 2QVCA 4DOMA 1XCPA 4W5OA 1E2LA 3AESB 1BN7A 4X84A 3EISA 5G1NA 3B1KA 5P21A 1Z6AA 1VCNA 1NVDA 2HB6A 2QN9A 4W9NC 1PZNA 4K86A 3VVBA 1SO8A 4RJKA 4I55F 1YJCA 2VNHA 4G0ZA 4JJ4A 3NORA 1PJZA 1WKVA 1KVSA 1UK8A 3CN7A 1O6FA 1OR8A 1GZSA 2DQKA 4QG7A 1B42A 1QG2A 2W71A 1U2EA 2A9JA 3Q6IA 3R77A 5EMHA 1Z3CA 1E7YA 2CJWB 4D25A 4UHEA 3EDMA 1ORTA 4RH1A 1E5QA 1YKFA 2UZ4A 1L5MA 1X6VA 3AF2A 1T5HX 3P1JA 3Q12A 2ZB3A 1MENA 3L7NA 1XELA 4UNIA 2XRZA 2ZAMA 3PNVA 3VDNB 3DZGA 4NG4A 2WJWA 4MJLA 5LZ5A 1HQKA 1JAYA 1PQUA 1OWMA 3O3CA 4KTTE 2PKYX 4OJQA 4RD6A 3QW4B 4S3MA 4WZ6A 4G1VA 3GG9A 3KR0A 4QRHA 3V80A 3UGJA 1CQWA 1QS0B 3EEQA 1XKLA 1V35A 2HA6A 4O2LA 5IN4A 3JQAB 5B1EA 2DHDA 5H0IA 2BEWA 2QPLA 2FRDC 4E5DA 5KEIA 3H8VA 2FHPA 2FB9A 3R0JA 1YZGA 4BEJA 3QEBZ 4JU8A 3ICWA 3VPSA 3DDHA 2FKNA 4HQNA 5DMHA 1RAGA 4BNDB 4HDNA 1Y7IA 3P71T 3TZCA 4DRXB 1L3CA 1H85A 4POAA 4B81A 1PJLA 4AS1A 5JFOA 3W4IA 4RWZA 2QSZA 4HQRA 1BFDA 4UD6A 1OFTA 3NDPA 2IZ7A 4HH0A 2G9QA 4Q6WA 3Q8XB 1RP1A 3B60A 4WKOA 4S1NA 1Q91A 5AXBA 1QRUA 2GPYA 4XPZA 1EJ6A 3HL4A 1O54A 2HRZA 4M2LA 3UCFA 1PVVA 4HWGA 3CX3A 5A02A 1J9GA 4BUCA 1LI7A 3CX7A 3ABQB 2N47A 5IDQA 3JR3A 2H2AA 2IYVA 1GAXA 2YWRA 2QM3A 2WHYA 2V8BA 4CI0B 3PT5A 1JDJA 1M8GA 4BO1A 4C4PA 2FFAA 5AW9A 3HXQA 2X14A 2D2EA 1NL3A 2DZDA 3ETHA 4NC9A 4NS4A 3EVBA 2R2GA 3KUUA 3P5SA 4YP0A 1MDBA 1P2UA 5G1PA 4DMGA 4N3AA 1QO7A 2GBPA 4OGWA 4CKWA 2EV9A 1RC1A 2AKAB 2GH1A 2I80A 3DTVD 4B3HA 1JR4A 4OSPA 4L6CA 5G1OA 2I6FA 4G26A 3QA3E 3QYAA 4OA8A 2VDWB 3MFYA 2EFDB 5AW2A 2QUIA 4B7XA 2ZAYA 1Z62A 1Y9ZA 2GVZC 3UXEA 3RU3A 3KVRA 3V2IA 4RELA 2R65A 1L6RA 4U2CA 4YFYA 4ZMRA 3CVJA 3G7SA 3PJEA 1A8UA 3HNRA 4Q93A 1VYTA 1Y1PA 1AUQA 1Z13A 3DZ8A 2GLXA 1K8QA 1Y80A 3P27A 2A94A 3I6YA 4HJRA 4FINA 4BB0A 3A2KA 1U5CA 4ZU1X 1I10A 1OC4A 1HKHA 2Q1WA 3W7BA 2G9NA 1P0CA 1RBYA 2O2SA 1NF3A 5ARBA 2UYGA 5ITWA 4TL9A 2WPDA 2J9XB 2JGDA 1KY5A 3JPWA 4FGSA 2ENUA 1UXJA 2POCA 1QOZA 3GARA 4KMRA 4CG0A 1IVSA 4RPKA 3ZE8A 4G25A 4LJYA 2G5TA 2QMZA 3LXMA 3SKXA 3EEYA 2QUBA 1W94A 3A6DA 4L0MA 1DBQA 1ST3A 3KAPA 3QLUA 4XIFA 2IUUA 4KBGA 4DR3B 1DV1A 1RKBA 2C4NA 2I7DA 1C9MA 2ZJYA 4GR5A 4J43A 3NKVA 3HRKA 2IHJA 4BRWA 2IY8A 4CCYA 3OOYA 2JD2A 2YRXA 2IYZA 3NKLA 3NKFA 4ITUA 4JR0A 5EZYF 4BY9E 3P2EA 2EKDA 1DT5A 2QMQA 3ZDRA 5C18A 1ND5A 4XQ9A 3QVOA 1CP3A 3UA3A 1Y42X 4R69A 3V2UA 4MV1A 4F8JA 4H3HB 4P33A 4NKRA 1L7BA 4JVSB 1BGVA 2BWJA 1KMHB 3RVSA 3GJZA 1QORA 3BMOB 4TPKA 2DHCA 1KJ8A 4N12A 2AMYA 3F8SA 3AUAA 3GRRA 4HQFA 3VKUA 2JGRA 4R2XA 1CUBA 1X7HA 4M9UA 3V34A 3ZW7A 4JB3A 4OUDB 1MJFA 4FSXA 5C37A 1K3UB 3IUBA 3IUYA 4JLKA 2OT3B 5I01A 1YDHA 1GTL1 2NUPA 1XZGA 3L40A 2GESA 2YMLA 4WK6A 4E5SA 5FI0B 1J20A 3RU7A 2GJKA 1Q6ZA 3HCOA 3ZNQA 3DE7X 2OQVA 2AFRA 4BKRA 2OC4A 4W9MC 1NVGA 2JIRA 1BC5A 3GJRA 5M04A 5HM8A 3EVZA 1NUUA 1OTXA 4K9SA 1HT3A 4I66A 1BXZA 4FYKA 3R9XB 3LUFA 4LHWA 2J0VA 4X5OA 4DCPA 1I3KA 3AVXA 1QGED 2WPNA 3B9PA 1PT7A 3S2FA 5D7NA 3BIWA 4FFVA 1L5HA 1R0SA 1FK8A 2A9VA 5EE5B 4R40A 2PGNA 3EDYA 4IDNA 2TMGA 5IPFA 5K8IA 3TG8A 4AX4A 3TO5A 2B37A 3BB3A 5I48A 1I80A 4JJIA 2QG4A 4YUXA 1LTKA 1JFTA 3DKVA 4R1UA 3ORYA 3HJHA 3ZGOA 4RV9A 1CVRA 2G5GX 3BMCB 2Z3VA 2QTLA 1JHZA 1GL9B 3QG1A 5AHRA 3VOAA 3N2LA 3PF8A 2GN8A 2ZETA 3S2GA 1E6UA 4C05A 1RLMA 4DANA 4F92B 5BOVA 1L4FA 2WYUA 2Z98A 4HNSA 3K35A 5FPYA 1L5SA 1BX3A 1OC2A 4CT0A 2P69A 2Q5CA 1OFIA 1P4GA 4ALLA 6PFKA 2G0TA 4LJ4A 5UKDA 2PZMA 4YP5A 5LA6B 4UQLA 2O7NA 3P32A 2QVYX 3ZI7A 4DLBA 3PDIB 3QHAA 4OQXA 2ICAA 3H99A 1H8HA 3MWEB 4I7EA 4Z4GA 2OBFA 3DEKA 2EBUA 4DSNA 1ESCA 1UKBA 3K9GA 3LVBA 4L5IA 2AN5A 4AKIA 1XXHE 2ZYAA 5CXQA 4YPVA 2R5NA 4F21A 3FA2A 3IO3A 3PEVA 4G09A 3NEJA 1N5LA 3FUUA 1GNSA 2X22A 4YT4A 1VPDA 3FZGA 3FKQA 2C4VA 2X1VA 3L1JA 3O2NA 2Q2OA 3SF0A 5TLSA 1G38A 4HT3B 4QUDA 1KK0A 3RGWS 5KOJA 2XKAA 1PFYA 2V74B 3HFRA 3MJDA 4PF1A 4ZDIA 2DBQA 1GR1A 1UKVY 3V42A 3ZIDA 2QAJA 3N2KB 1LTHR 1TF5A 2YNMC 1OFGA 3Q10A 3SGLA 3EAFA 3GFPA 1FUYB 4GDMA 2FUEA 4EFDA 3MELA 1X9GA 1YS9A 2ONJA 1PZGA 3PI6A 5DNWA 2DLCX 2QN8A 5JFGA 2PJRA 5MN6A 1M2NA 3PSAA 2RG1A 2AR9A 5I51A 1PQWA 1F6BA 3DEHA 1H3NA 2XMCA 1DADA 4HRVA 5CT5A 3MMNA 3E05A 4JGBA 3RRJA 4C20A 2XZPA 2VNIA 3OEHA 3TKLA 2XJ4A 2WUEA 1PVDA 4DN6A 5F98A 1V3QE 1OB5A 1FEZA 4M7WA 4X20A 1XDDA 3SU8A 1UFOA 3P2IA 4O4JB 2Z2JA 1H9CA 1NZFA 1YZNA 5CT4A 3RFUA 2ZP1A 1U7ZA 2VPWA 2P2YA 5A3QA 3N6RA 2J08A 3VTKA 3TGWA 5CW2A 4CV2A 2P41A 1IG3A 2BC9A 3JQ9C 3QE9Y 5JFTA 3H8WA 1A4IA 1DBPA 1UP4A 2I2DA 1O03A 5LMNB 1P62B 4V0RA 3ZCSA 1H65A 1K75A 2O6HA 2NU7A 1HEYA 1RJGA 3BDIA 1QHEA 1CUUA 2ODPA 3LNCA 4B76A 4P82A 4YCDA 1G8SA 5TQ2B 3RU9A 3D54D 4FT2A 3TLYA 1DPFA 1XJ0A 3FYUA 1KKUA 2CLIB 2W2PA 4YMSA 5IAKA 2FPGA 5THQA 3SHWA 2FPRA 2IELA 5AKZA 2HHHB 5AKLA 2I33A 4C0SA 2IEBA 3SXUB 4ZVVA 1VLZA 5EXPA 1E9CA 2FPPA 2XAAA 1EWYA 2NSHA 4Y2VA 4ZO9A 5TGDA 3WLKX 3BIOA 2VHYA 1G20E 5GWXA 3KJEA 2BGWA 3U4MA 4EVRA 4JLVA 4UDYX 1LC0A 3UANA 4IIHA 3FNGA 1IJEA 4Q12A 4YMIA 2BE7A 1QU3A 3P9IA 4EIWA 4BB5A 3QOFA 4MI6A 4IWYA 4MITA 1S6YA 1Y8AA 1IBRA 5KNBD 4LY3A 4BMOB 3ZGYA 2PRSA 1WO8A 3T5BA 1MKYA 4PSAA 4YRLA 3ETNA 2WVAA 1XTZA 1NYTA 3GP8A 2CLHB 1CKEA 4UNQA 3ZHQA 4DWOA 1D7OA 3LYLA 3W5DA 3GHHA 1AHPA 3U48A 4YRCA 2W6MA 1KY2A 1J56A 2W6PA 1N5DA 2XNDA 2RHWA 2FV8A 1ZW6A 2WAOA 3R8XA 4DJJA 3C3MA 2O23A 4Q18A 3VBCA 2J07A 4CJXA 3T0GA 4POOA 2BGGA 3GUVA 3NCTA 2J7PA 3IQGX 4PR3A 1FUUA 1TA4A 4TL7A 4JHXA 3GLGB 3CB4A 2OORC 4D8TA 2G40A 2XIJA 3FZYA 4Q7JB 1VL1A 4C5AA 3DCNA 4RQTA 2YN0A 3DMTC 4M89A 3BBLA 4O4LA 1NXOA 3HDJA 5D2CA 3L7DA 2BHLA 4JI8B 2I6TA 3E1KA 1U2QA 5ALNA 5J3JA 1K68A 3RC1A 3ZWDA 4M9RA 4D5GA 1Z6QA 4KFRA 3WYCA 3BE6A 3HWRA 1NVTA 2GK6A 3T7KA 4KFTA 3UHJA 5HEKA 4LF5B 2RDMA 3A6EA 3D81A 3NNSA 4JROA 3OUUA 4GYKA 3NBUA 2Z8XA 4FR0A 3RARA 3R3XA 1CW2B 4ZIRB 3IL2A 1K7SN 2C8LA 3GFFA 221PA 4GEKA 5D3KA 4RTLA 1SWVA 2ZULA 4M3NA 2H4ZA 5FKJA 5A03A 3U80A 2XE8A 4KXFB 2OGZA 2NU8A 2YINC 5ALRA 1QANA 5IVKA 3GT4A 3E7WA 1YO6A 3PDUA 1RKQA 3DZIA 1ZHFA 2WYOA 4LOLA 3QJ5A 3KR2A 2QK4A 4DG9A 4LJ7A 4N5MA 5CD9A 4Q4LA 4EOGA 3AHIA 1I5OA 4PLYA 5TVKA 1ZIXA 1NJ2A 2YX1A 3N2EA 3Q7SA 4JC5A 2JZNA 2WHRA 3ELUA 4YS6A 2QMUA 4KTVE 2W70A 1JW9B 3REFA 1WUTA 3GRUA 3ZZ0A 2B3TA 4AECA 5HIKA 2O2DA 1FBTA 3LDAA 1TIPA 1YJQA 3DLHA 2OBBA 2VQDA 1SOVA 3C6BA 3LHKA 3E6AA 1SUSA 2QNIA 3OD1A 2YOHA 1I6MA 3LT5A 1H9AA 5EESA 2UV8A 4TS4A 2PGOA 5BY2A 3EGOA 4DA6A 2ZIZA 4OQDA 1SZJG 1DHRA 2PQ2A 1CP2A 4K8RB 3BSSA 4FZRA 4P8RA 4LF7B 1ANKA 4DUGA 3EG5A 2NO4A 2GJ8A 4YH1A 3B6MA 5LBUA 4YRDA 1B14A 1A7AA 7ABPA 4A0QA 5TEVA 1OZ0A 1KO4A 3MYRA 4TUYA 4WASA 4X8HA 4NICA 3HBMA 4OP2A 1BU8A 1UZUA 5AOAA 2KBFA 2Y99A 1JR3A 2ZPAA 4ZOLF 2RGCA 1HDCA 5ALUA 5IKXA 1RJWA 1HFEL 1TJ5A 3KV1A 3MD0A 3AUFA 5HBGA 4ZQCB 3K2EA 1U8UA 1QM5A 2ZJAA 5HMLA 3GCGA 1E3IA 1GZ7A 2ZIXB 3CNOA 3FCXA 4AJPA 3WA7A 4EFKA 3DO8A 2VCEA 3U3DA 1CVLA 4OJTA 2VTDA 3QYJA 3GROA 1F0YA 1JSCA 3RK4A 3ZJUA 3I2KA 2I1VB 3CF4G 4MQ6A 3QELB 1M2WA 4DLKA 3UKOA 3U5TA 4XD2A 4MVJE 1ZN2A 1GL3A 2V55B 2I71A 3DD1A 3PUKA 4L0CA 1ZVVA 2PD3A 1XJ5A 3NWPA 1QHXA 4J6FA 3GX1A 4U7WA 4XDHA 1EB8A 1S8AA 1HRKA 5LU8A 3HCPA 5JAIA 1JHAA 1PT6A 1RWPA 5ALXA 3Q85A 3TCNA 3ZNOA 7YASA 3W79A 3B8HA 3QFSA 1NJ8A 3FD8A 4GRAA 3TVTA 3VR6D 4M8NE 1KAMA 1BZYA 1MVOA 4DMCA 2PWZA 4EG5A 4XX0A 4KB5A 1OASA 1C1DB 1HFWA 2COKA 3FZNA 4GM0A 1JRLA 4UAVA 1GCOA 2GHQA 2J3LA 2G4CA 4EA7A 1UXIA 4Y2UA 3LBHA 2QX4A 2WILA 5LXTF 4XWOA 3IDAA 2UZ1B 1OIWA 4EPXA 3FKJA 1QIFA 2NYAA 3AUKA 3EOBI 4OHOA 2DLNA 5I7FA 1SVKA 3CIOA 1V8PA 2BJHA 2IIVA 2NACA 2RGGA 3BDAA 1MO6A 1N3YA 4J0KA 3ZE0B 3S40A 4AJ2A 2O8FB 2AMLA 1JPNA 1P77A 4AG3A 1R8QA 5EIAA 3N74A 3A7EA 2JHFA 4U3JB 1B2LA 1VPLA 3OPXA 2JZCA 4XR4A 1PGOA 1VI2A 2XZLA 1CSEE 2XUOA 4TXNA 1U9JA 4YMWA 3CRW1 1NR7A 1VFNA 4P7GA 1T0JB 5D6NA 3B7PA 3K16A 4P0TA 1W88A 2VPZA 4S35A 1P7YA 2W4MA 3NDIA 4M7RA 5CG2A 4ND8A 3NOQA 5L3QA 1PTJC 3DP7A 3H11A 3I37X 3K05A 5KKAA 3H4MA 2VCYA 1DAMA 4ZVQA 3BD6A 4XAQA 4YCJA 5PGMA 1W0KD 1R0CA 3IODA 2ORWA 4R8MA 2VZEA 1BEZA 5KB3A 2VJCA 4HYYA 5M34A 4NZOA 1JFSA 1PQYA 2XA9A 1W96A 3RT1A 1HWYA 4B43A 4BN4A 1DCTA 1PFGA 4J1TA 4NJMA 5L4NA 2PCJA 2XOKD 1USWA 3EIHA 1U3VA 1T34A 4XDGA 5EP4A 4HLUC 1C0EA 1ZMBA 4ZVSA 4BVLA 1XLVA 1RI1A 1ABBA 4GX5A 5TPWB 4DKXA 4BX9A 2PGDA 4D82A 3TEJA 5JC1A 3BUSA 3M9WA 4B34A 5EHGA 2RAVA 1RWBA 5B6JA 2NUTA 1KVRA 5HIJA 3PWSA 4A8JB 4B46A 3K0AB 1ISIA 1CD5A 2BMJA 1P75A 1ZH4A 2QLBA 4NWIA 4X7BA 3UJAA 1U2DC 2VHUA 3WB0A 1IBCA 1Z34A 3L06A 1RYFA 3BSWA 3GFGA 1DAFA 3K73O 4LXUA 1RQ7A 5EQDA 2QBYB 4AY2A 3E8XA 3ASZA 5K3EA 3HV2A 5BSKA 2QL5A 4BE4A 5CK5A 1YDFA 3U44B 3QV1A 3IVGA 3CUUA 2Y92A 3HP7A 2GFIA 4DNOA 1AQNA 2RGWA 1OXBB 3ZJYA 4KIGA 1KDZA 2WSSA 4IG4A 4U0KA 3FVRA 3RVQA 1QAMA 3KS9A 4EW1A 3AONB 4LXXA 4OYRA 3I23A 3VR2D 3EDCA 1KETA 3U9TA 3ZIUA 3F4LA 3BHJA 5T8KC 4DT1A 4UMEA 2AMJA 4HSEA 2OV3A 3P2KA 3W1WA 1C9JA 4MMYB 1GILA 2IZZA 1YF3A 3PHBE 4N0DA 3DTVA 1NM5C 2HSZA 3T5TA 3V9PA 2QL6A 2WFZA 3CW9A 3HL0A 5C35A 1F7VA 1PUJA 3WGZA 4P22A 5HJ7A 2YYAA 4MEBA 4UTOA 1ULTA 4Q9IA 5F1PA 1JDSA 3T5AA 5DP1A 2XT6A 3C85A 4RVHA 4W1SA 4WFJA 1RRPA 2C9MA 3KZXA 4ZXFA 2JIBA 4YEDA 1XD8A 2QD2A 4IHJB 4K6CA 3M4JA 5JJBA 3LUCA 4HGPA 4OKNA 1CUJA 1ZK1A 4GOKA 2QM7A 1XYGA 5HK9A 1KI6A 1U7TA 2NX2A 2P11A 1JJIA 1JLHA 1IHOA 1L6IA 4WK0B 3RQSA 4BQNA 4LF6B 4OYYA 2Z5VA 3LY7A 2RGUA 3OCCA 3QPUA 3MAJA 2JLCA 4Q9DA 3SZGA 2OFWA 4UVEA 1XEWX 3DG9A 4YWJA 1ZOLA 1YRYE 2E4VA 2PVSA 3BMQB 4TMYA 4ML3A 3EMBA 1F9AA 1Z88A 3FN4A 4OB8A 4BX2A 1XIVA 1ZRHA 2HBQA 2QTVA 4OMDA 4N9QA 4OYLA 2YHSA 5JBQA 1BQEA 2PTGA 3F6CA 2J9ZB 4BLPA 2W7TA 2BGLA 2JAHA 3B78A 4MWEA 4FEYA 3M5CA 3VHLB 1VHJA 4H15A 3ZQ4A 4D3FA 1A9XB 1PO7A 4F3RA 4REOA 1BW9B 4IRMA 4KXVA 1Q1AA 3WIUA 3F1KA 4KVFA 4D1YA 4M1KA 2XSZD 1VLVA 3NHKA 1BOOA 4JJ6A 2FMUA 1J0BA 2JKVA 4ZV9A 2HJ9A 5L7WA 1CQIA 1VCIA 3LRTA 2CF6A 2GD0A 4DCTA 2GI4A 5FUWA 5C8ZA 3TBHA 1O1YA 1Z5GA 2Q29A 4OBEA 1AKQA 2I67A 1BTOA 1RM0A 4CQLA 2R8RA 1SUCA 5FBHA 3PCRB 1PR3A 1JEYA 1VJCA 3EXG1 1MD9A 3CLHA 4PFKA 1W59A 3HA2A 3IQXA 4TOIA 1U81A 3L7IA 3PQFA 1F4LA 2OMEA 2P5YA 3E22B 4FD2A 5AW8A 1EZZA 2HC9A 3KBOA 5JDIA 3WIDA 1NSFA 1YZYA 3VPXA 1S89A 4JLOA 3T38A 4NH4A 3FTPA 4UMDA 3U1BA 1T5TA 3O6VA 2HREA 3CLRC 1X3LA 4MPDA 3K9FC 2PBZA 3RB8A 2QP3A 1A2KC 2PM8A 2YQ4A 4FNGA 3AFOA 1N5OX 3ZNNA 4DV6B 1A5ZA 3M3PA 1R6DA 2H16A 3O8NA 3ZLBA 2RI6A 3GEIA 3PNLA 3O3MB 1JQEA 3K4PA 4Q66C 4PLFA 4E51A 5J43A 2DFPA 3O4FA 2VJAA 1K7XB 1XMSA 4DKJA 4RW0A 1V4NA 2NW6A 4ANFA 4NJMB 2P2ZA 2NO5A 4E2WA 4H6WA 5J4VA 1ZD9A 3BYZA 4FDMA 5ER9A 2C7PA 3OE1A 2PX8A 3L7JA 4IS3A 4K6MA 4NU0A 4ZQEA 3A4MA 3IB6A 3UENA 1SMKA 2W83A 1NE7A 2I0FA 3CPSA 2PVPA 1X74A 3NTUA 1TL7C 5DRTA 3LYHA 1ZM2A 2YFYA 4B3MB 3H2JA 1ZJWA 1HXHA 5D84A 1RYDA 2F43A 2HSGA 2B69A 2ZUWA 4QLAA 5C8YA 2HEIA 1CRWG 1Z4MA 1XJCA 1D2CA 2O20A 3HP1A 4UVGA 1IOZA 1PNTA 1L7QA 1Q74A 2EKQA 2NN3C 5JZMA 3TNYA 4Q34A 1NYRA 4JT4A 4BO3A 5JARA 1JDNA 1W2WB 4KWHA 5TB5A 2CV0A 4IG9A 4W5TA 5FLEX 1GT6A 3UJNA 2PBRA 1GPYA 3GJTA 2XNJA 1QVVA 3SZ3A 4O1MA 1ZM4A 2Z43A 4R6WA 3KKOA 1KR5A 1D4FA 1M67A 5ERYA 3E27A 5DGXA 4JXXA 1N6PA 3ZDDA 2FXIA 2HH9A 3OX1A 2NQ8A 4P35A 5EZSA 3QVVA 4MV8A 1U28C 1P0IA 4F96A 3GFRA 3EZFA 4Y1EA 5LVAA 1TQ2A 3THYB 5ALFA 3HZZA 1U9IA 5JT1A 1WSAA 4E70A 4Q16A 1PI3A 2Q3HA 3DOOA 1C4OA 4IXMA 4B7AA 4C7JA 3SYNA 3R4CA 2QG9A 1BD4A 1NATA 2QVGA 5JSUA 1PEDA 3KL4A 3PVCA 4AK9A 1NRWA 1CUSA 3LBNA 4JB2A 1T8YA 4MRPA 1ZBQA 3V4PB 1EEXB 3O2JA 5KI6A 1H3FA 4HEA6 2VUUA 1CIVA 4XI9A 1J8FA 1JWLA 5HQ3A 2ENWA 4HXEB 3EXIB 2QE7A 1T1SA 4UM9B 3WRYC 1F14A 3MJSA 4MLPA 3COJA 1A2BA 1FXUA 1V8OA 1KH1A 4C4RA 1F8UA 3V46A 1D2GA 3LO5A 5IT4A 1FFBA 2XCQA 1KNQA 5GZ3A 2Y93A 1H2AS 1XZHA 2JK1A 3OM9A 4AG6A 1JTFA 5DX0A 4CMIA 4QHSA 3TNJA 3VZQA 4BFWA 5BRJA 5F7ZA 2VBGA 3DE5X 4C3UA 3BH0A 1KR2A 4FDTA 4BLQA 1KEEB 4JUAA 5LJIA 1J49A 3QOWA 3QXCA 1M0SA 1N2CA 3K72B 4DMMA 4RUKA 3Q3HA 3VR5D 1H4QA 1M1ZA 2F1KA 3EB9A 3T1VA 3UPUA 1SURA 1K7YA 4FWTA 1TAQA 2E4WA 2PKRA 3AWIA 4H18A 1AV7A 1HE1C 4FJ0A 5B3JA 4KP7A 3ZXXA 3U60B 2CNNA 3FYDA 1OXXK 1B2RA 1I2CA 1OX4B 4REQB 4UVHA 3RHFA 4CM8A 3EWNA 1XHLA 2VTEA 4NMWA 3ASYA 4JL6A 4Y67A 4B6QA 3LWDA 2P2CA 5FQNA 1ODFA 5EPEA 2FDXA 1E3WB 2Y1OA 1JE0A 3LRPA 1QV6A 4MTCA 4QXRA 5ELLA 5C5CA 2PT7A 1RRCA 5EAIA 4JBGA 1G2QA 1WCXA 3NVMB 4MWTA 4PZZA 5ECGC 3VPAA 1C9YA 2R1VB 5F2NA 4O2BB 1WEKA 3B70A 3D6AA 1ZGHA 1M54A 2GMWA 4QOJA 4QXMA 1YNSA 3F6PA 4Z7NB 4PAQA 1JAIA 2GEJA 2OESA 4YV0A 1E2BA 1HMPA 4RZSA 5COBA 6REQB 3IR7A 3HWSA 3SX4A 1UMBB 2XLCA 4M1QA 1KA9H 4DHWA 5KPJA 5JTTA 4EQ6A 4DR7B 1XHEA 5A4FS 4CFZA 1A8SA 1FPMA 4QYIB 1II0A 4MUHA 1TK9A 4MEJA 5FUXA 5JCPA 1Y8QB 2B7BA 3FNHA 2W8ZA 4R1SA 1ZDMA 3MFQA 5H9WA 1TUIA 3RV3A 1YBAA 2OVBA 3THOA 2C7GA 4F12A 3MK31 5L4LA 3NATA 2ONYA 5FO0A 2GASA 4O25A 2CCGA 3E2MA 5DWDA 1EFKA 4BVGA 4YPOA 2P6PA 4HX2A 4XVUA 1OF1A 3MCVA 2WG2A 2ZIWB 3I73A 1CY6A 3L93A 2P68A 4X62B 1SPBS 4BTLA 3ZGZA 4OHUA 4JCOA 1T9GR 1AUOA 1JLRA 4CMBA 1RI3A 1MW9X 5C4MA 4FYJA 5SZKB 4MMZB 3EZXA 1G8HA 2Q2NA 3GGOA 4QOIA 1YCHA 2GUGA 2YVAA 3HB4X 2WTUA 1J8VA 4GOJA 3LVFO 2X1HA 1VLMA 5BVHB 2F1RA 1SAYA 3R23A 3AL2A 4ZVKA 2GPNA 3VJLA 1SG9A 1NU6A 3ZK7A 5FA8A 2QQFA 3DOHA 1UR5A 2VP6A 4KAJA 3ACCA 3ICOA 4MYUA 2R7AA 4J6EA 5FBRB 2OO3A 3VYVA 3CLSC 1U02A 4HLNA 4BOYA 4HNTA 3G0OA 3KLNA 3AFHA 3KK0A 1RYNA 4UEJA 1RD4A 3GJQA 2ZE8A 2GTIA 5HHTA 4BO4A 1K92A 3CVWA 1J2JA 5H80A 5A4IS 4RY2A 3JZIA 4QJ4A 3ULKA 4JV5B 1OWOA 3ZZTA 4ZYVA 2RHGB 1LDEA 1DNPA 3BG5A 3PU6A 4B3GA 3MXTA 3WFIA 1YCFA 3UUWA 4EGJA 4UHHA 2JLAA 5HCUA 3EXIA 3EXFB 4XZ3A 2VKTA 5CA1A 3FUWA 5H1YA 1G9SA 1Z0JA 2VEDA 1K8XB 3IAS6 4RHTA 5J2TF 3CUEF 4PCVA 3WK5A 1VYHA 2X2FA 4YRKA 4M9SA 3IXQA 1ZD1A 2FJ0A 1FP2A 1C7EA 4D3XA 5BQFA 3ZWNA 1R00A 1N5MA 1E62A 3GFOA 3Q7TA 1ODJA 2FRXA 1A7KA 3C5WP 1WUIS 4S24A 1XOIA 5D3QA 1RPNA 2XWSA 3JYPA 1J9ZA 3KLBA 4ZARA 2K6GA 1MAAA 3H9QA 3M9LA 1NVKA 3GMSA 4PC1A 3W3AA 1DE0A 4IEEA 4EG1A 2AN1A 5B57C 2IIQA 2I2AA 1Z47A 4MWSA 5JI2E 1O94C 1DIAA 4QYWA 2WJZB 4BVEA 4Z4FA 4HH4A 1EM8A 1L0BA 1TE2A 2OEPA 4F4JA 1BQ4A 3FWYA 2ORYA 1TKCA 3ZHUA 5A3RA 4R0MA 2PX6A 3RUPA 3IMKA 2AV6A 4B82A 2MSCB 1G5HA 2EFGA 3B48A 3PUJA 3TJRA 3QENA 2Q1TA 1AK9A 3JQ6A 1S2MA 4I4TA 4WAUA 1A9XA 2Y0DA 3FWKA 2Q8PA 1QVAA 2Z09A 1I2ZA 4KKVA 1H6DA 5ITVA 1JB1A 4QYSA 3NHSA 2B35A 2HU7A 1UWKA 1CU1A 1ZZGA 3E53A 4ILEA 4M8KA 5AXCA 4JB0A 1GPAA 3V9AA 4N7MA 5CLFA 5ALPA 1G8AA 2BW0A 3K9QO 1OQAA 3I04A 5EC8A 3TW8B 1D4ZA 2V59A 1W48A 1XDSA 3H8SA 2JBHA 3FCOA 3L8MA 3ND9A 2FMKA 3PX2A 4RCZA 4WGFA 2LCIA 1TIKA 3O9ZA 3R0ZA 3V8QA 5B1HA 2IVFA 2Q4DA 1ESEA 1RJ9A 5BXQC 3JCZA 4KIUA 1FNDA 4YFVA 1V48A 4XXHA 2Q21A 4BDTA 5T6MA 1FOEB 3DZDA 1TQDA 4U7FA 2A1TR 4YY3B 3ZZNA 1HR0B 4GECA 3I0MA 3OTQA 2XT9A 1O5TA 2O2HA 1LLQA 4HUQA 4JLDA 3V32A 3EMDA 2WJHA 1FYFA 3OQPA 5DLPA 1VL2A 1HE2A 3LOUA 2ZUSA 4CCAA 4DLSA 4HL6A 3G23A 5IXSA 1F8YA 4ZWNA 3DJFA 2EFCB 3E5MA 5AM2A 2QY9A 3BRSA 5I7EA 2ERYA 1K89A 2QT9A 1B3BA 1K5GA 3ZCRA 3EEBA 4JI7B 5HF5A 5KSZA 1Z63A 1IHUA 1T8PA 1UBTS 1VJGA 4J90A 3E84A 3Q2KA 1WD5A 2FF7A 1ITZA 3MWFA 5EHQA 4DARA 1JHQA 1VLHA 1BE6A 2J6BA 3RVOA 4PC6A 4DRZA 3TCKA 1K6MA 5CBKA 2M32A 1SD1A 3R4VA 2K7FA 2JNWA 3KB8A 2X9NA 4Z9YA 2BR3A 2HF9A 2FSVC 2MINB 2ZRIA 2H7CA 2XRMA 3QFFA 1DJMA 1IBLB 3PDHA 2VBIA 2I4IA 2EQ5A 3BZBA 2O8DA 2XXJA 4MGEA 4M1ZA 1FMJA 5JJ5A 5IWAB 5E9JA 4RH0A 2JGEA 4MK4A 2PLAA 4Y7DA 4YI5A 2ABWA 2Q5JA 3CKYA 9GPBA 3D6TB 3HYNA 1DOHA 3BXHA 3LPDA 1V6AA 2W8BA 4FI3C 4G65A 4IF4A 4IWNA 3O75A 4OO3A 4PHGA 4R0NA 4RFSB 2VXOA 4R2HA 1GEGA 2QTRA 4UBIA 8LDHA 4IX9A 2ONZA 3A4VA 1SXJC 4L9WA 4XWTA 1R6VA 5K03A 3HRIA 2WKPA 3QVXA 2RGAA 4JUBA 3BOSA 4DIKA 4YVFA 1QCYA 4QICA 3K09A 1M83A 3STHA 3DBHB 1XMJA 1Z7GA 2F4VB 3BCUA 1VKNA 2Y4NA 2PZBA 2HZBA 5AMXA 5CBPB 3HNPA 4L0QA 1VOTA 3VGPA 1EXDA 3O26A 2WD7A 2BCJQ 4IKEA 5LXTA 4OUDA 4JXZA 2IYUA 2BLNA 3GGDA 3I9JA 2QMOA 3TNFA 1X8LA 3ZDCA 2X1LA 4CMJA 2B6HA 1KFBB 5EEGA 3CEAA 3D64A 5BQOA 3SC4A 3LXRA 3VR5H 1JXOA 3LLSA 2R8XA 3VM6A 4ER7A 2B25A 2CLLB 2I9KA 2ZE5A 3P52A 4NCIA 4L3OA 3KKKA 4MYHA 4MYDA 2JGAA 2QVBA 1IC6A 4BO9A 1DTWA 4RDHA 3JQ7B 3UYKA 1O94D 3DBLB 1Y7PA 5JPIA 3NMUF 4MIOA 2EFJA 3FETA 4LV5B 3WRWA 2G4VA 1X9IA 1YRAA 4D0NA 4CCYB 2ZTUA 2JIZD 4LECA 4OQPA 5DMXA 5F9FA 2AQKA 2QL9A 3KO8A 1NXSA 1BWPA 1WS6A 3GCDA 4CYMA 2G76A 4J3FA 4Q02A 1DAEA 1C7QA 2BMFA 1RJEA 4QYTA 3TRIA 1I2MA 1O97C 3JARA 1YBFA 2UZ1A 1NA5A 4FC6A 8OHMA 1OH8A 5J2UB 1PT5A 2BM0A 5DHQA 1C1XB 4D74A 5DIFA 3A4NA 2IXEA 3DZHA 1VKRA 2AL7A 2OR3A 2PR2A 4BX8A 1DRJA 1Q1BA 5T5QA 2BFEB 3KYJB 3WGJA 3AI3A 1SKYE 2ZJOA 1I6WA 4LCBA 1DXQA 2RKWA 2YWCA 4FGJA 3WLSA 4ZEMA 1MF7A 3GEMA 3JAWB 3H3FA 4QXOA 4LI0A 4J0HA 4LZOA 1I7NA 3L3BA 4MJ3A 2N46A 1UJ2A 4MYSA 4NBTA 5IAJA 1RZRD 3OZUA 1IWOA 1NWHA 4Q1BA 3H1BA 4ZI7F 1X7YB 5KX5A 1I2BA 3H5WA 3EFEA 2V1UA 1VHDA 2XB4A 2NO0A 3GJYA 2O8EA 4TKVA 4OM8A 4TKZA 2DFLA 4II7A 1QFYA 1VCOA 2Z2KA 2DHQA 2KW5A 3TL2A 3KTOA 4Y2RA 1ONOA 4OQFA 4UE2A 3BF7A 4KACA 1E9EA 1IATA 4OIFA 8GPBA 4TRNA 3G5AA 1K0UA 1XPOA 2HN9A 3MNFA 4J7XA 2GBLA 3IPYA 4AW9A 1VLLA 1Z2CA 2NVOA 1YB6A 2HF8A 1FRNA 2PNFA 3OQVA 4J3JA 4QE3A 5GVRA 3V00A 2XDQB 4UHBA 1O5OA 4QUHA 5K8UA 1GAEO 1M2JA 4MOWA 1JKIA 1LX6A 4PV7A 4ZKEA 3C24A 5IKPA 3CF0A 1O0BA 4LGCA 1I7QB 2XUKA 3OTGA 1OPRA 3WOVA 2PSHA 2YOFA 2OD2A 1X0VA 3BAFA 1ACMA 3CISA 2HSEA 3CINA 1CTQA 1YWGO 1JWAB 3F3KA 3F7MA 1V43A 4Y9SA 3PXGA 1TCUA 3QLUC 1DELA 1KEZA 4FS8A 3TZHA 3WLNA 2PKQO 3RFXA 3N7AA 1II9A 5KTKA 1Y8RB 1NX9A 3MRVA 3O21A 1G63A 3OKAA 2HIMA 1GSOA 4RD3A 2V5VA 3E23A 5CP8A 2ZSFA 2NQ2C 1KIMA 5ALSA 2ZUTA 2IKQA 4WK4B 2N75A 1PUXA 3V7UA 3DLIA 2NUAA 3MCWA 3EIFA 4AS2A 1WZNA 3MOGA 4FHDA 1G98A 1UM9A 1YL7A 2RGXA 2FE4A 3DYVA 1VL5A 4BNDA 2DP4E 2DUJA 1Z82A 1Z8NA 2OO5A 4CETA 3W9UA 1L1FA 4M36A 4ZZ2A 4QHTA 1RFGE 4UDXX 4LE1A 4BECA 5CFOA 3KP1A 1PKXA 4MUGA 1I51A 3Q1LA 4I19A 4Q1AA 2Q07A 3IIEA 4L73A 1YQDA 3THXA 3Q41A 4TXHA 5A71A 1QS0A 4YECA 3UM9A 4BB6A 3AR6A 4N48A 5AD1A 4GPTA 1KBZA 1X87A 1FRQA 1QGUA 4H3VA 3R7WA 3TYXA 2GCOA 2RHJA 2H8GA 4XJSA 3ZWPA 1GAQA 2O8BA 1NLZA 3QQPA 2XF2A 3KZNA 3V1UA 1E2NA 4XGRA 2FSHA 3PIDA 2OZPA 3E5HA 3RTCA 4CCWA 4CLXA 1NUSA 3TGPA 1Y9AA 2IPNA 3LQYA 4F46A 2FFJA 3AG5A 4RTMA 2CLCX 2O7RA 2H7XA 1TM1E 4RKQA 4Y9RA 5CVCA 4Q7QA 3D1VA 3ERCA 3IP3A 3AL0C 2FZ5A 3CZPA 2C4KA 2GILA 4TYWA 2YDYA 2R6DA 2AFHA 2XWPA 3MPOA 3NJ8A 2VAWA 1TMGE 3CF2A 1KZ6A 3O94A 1E4VA 4RWEA 1M34E 4RY9A 2OFFA 1YIAA 4O4HA 4BMPB 3UC9A 2HK9A 1CR0A 4LXTA 1OB2A 2J3KA 2VK4A 2FCRA 4P3PA 1E3MA 3C15C 5GJWC 1KYQA 2XV1A 1SRQA 1XRLA 3A28A 3DHYA 4XJTA 1QB7A 2OOKA 5CT6A 5E9AA 1N36B 1UPFA 1DKRA 1TXGA 2YYYA 3DO6A 3GHYA 5I4CA 2VS1A 4R3WA 4DLYA 2PA0A 3RF7A 5K0SA 4MUNA 2B1JA 4GOXA 2DJIA 1FBNA 4KXXA 1FJGB 3LKBA 2O57A 1IIRA 4HN2A 3VNSA 3W0LB 3F8WA 5HWSA 3L92A 2A5GA 4TSRA 3U9SA 4AMUA 4ZYUA 4ERXA 3GRAA 1EFCA 5JJLA 1SUWA 3IKLA 3TDNA 4LMRA 3A9TA 3T12A 4NAHA 3LT0A 4WNAA 3H9UA 4A1FA 3PYMA 4LJAA 3TW0A 5AKGA 2ZI4A 5LBIA 1FUEA 1X14A 3CLTD 3L1IA 2F3TA 3QXXA 3IUQA 4YO7A 2PUJA 2W0MA 3UGKA 2J3DA 4HATA 2D0PB 4H1TA 4IX1A 4XA8A 4UTNA 3TBFA 4PGAA 2VAVA 4OP1A 5ABPA 1OT5A 3M1YA 3LGAA 4ZI7B 4TROA 1A5AB 3ZIAA 1XU4A 1GFWA 2QENA 3EIOA 1F2TB 2PUAA 1IY9A 2RB4A 1JNXX 4C06A 5ITZA 1JI3A 4PSUA 1L2TA 1U2GA 1XD9A 1YQUA 3NWJA 4J1QA 1QQTA 4WFQA 4NG5A 5BSHA 1DGQA 1ULSA 3EGWA 3GD5A 3GLUA 4ZYZA 3CRMA 5FUVA 3AF0A 4FYPA 5DCLA 1REQA 2PUTA 3IE0A 4I14A 1ZCJA 4I1RA 4PFQA 5JO9A 2WWWA 2R3SA 4NECA 1RI2A 1DJOA 1DU4A 2C3YA 1YS1X 4YBRA 4W8OA 5J63A 1XTIA 3PA8A 1NAHA 3G79A 3RAGA 3V4RA 2MOKA 2A1TS 5KTOA 4M4SA 5F73A 4M0MA 3BMCA 5KJFA 1OYYA 1SCQA 4P7BA 1G7RA 4J0CA 1VYVA 1UKZA 3KQWA 4G6ZA 1EM6A 2WT8A 4FMCB 2C2KA 2NVWA 1DKOA 2WSYB 3D4NA 2C2XA 1KYTA 3AEUB 1JXAA 1UQRA 3IR6A 1P7PA 4D9MA 1L5HB 2HM7A 1K5PA 3DMRA 3S2IA 3H9GA 4WXRA 4D2IA 1PU2A 2G7ZA 1WTCA 2WE8A 5TS2A 3WIEA 1U9IC 2O6LA 4CWAA 1IZYA 4FOPA 3AM4A 3ZUPA 1DZ3A 1DWOA 3VTAA 3UBTA 4PAGA 4D46A 4F11A 1FJXA 4B3RB 1VXRA 1O5IA 3ZVRA 2A7QA 3C3WA 6ADHA 1PK7A 1V5IA 4IOLA 2BBSA 4UOZA 5DW3A 2A88A 3QLVC 2G67A 3ZGVA 1OI7A 2Q1UA 5JI3E 4DZRA 3WHIA 3BKXA 1X7WB 2Q49A 2B8NA 2YASA 5F35A 4ME6A 2C96A 1M2OA 2VNSA 1LTQA 4JY7A 1XT6A 1K8YB 4KYVA 2NVBA 1QF7A 4UEOA 4EG0A 3Q7PA 1ESNA 3AM5A 2H3EA 4RD0A 1PGQA 2N1MA 4L5JA 4OQZA 4PIVA 3UEOA 4IL5A 4MCIA 5DI9A 4UVIA 5F2KA 1E58A 121PA 2HLDD 3NIGB 1YOVA 2BGTA 3EGIA 3RUIA 5JMTA 2G70A 2H0RA 3NBMA 4HUTA 5K20A 2ZUEA 1V5GA 5F7XA 1ZM7A 4CE6A 3FYCA 5ALJA 1R0XA 1AGRA 3BTOA 5EIHA 4DLUA 4P4SA 4XE5A 1YR2A 2EP8A 3U13A 1JH8A 2QE7D 4AN0A 5A4DA 2XUJA 1I5RA 4HJXA 2D0IA 2XCSB 3TL6A 2JLVA 2W11A 3ANTA 3DV0A 4BWGA 4ZT6A 2JA2A 4OOEA 4EJ6A 1T91A 3HB1A 2VQEB 3A25A 4MWOA 1YRWA 3GQBA 2O0LA 3O8DA 3D2BA 4ITRC 4MA5A 5DGIA 1Y5IA 3Q0TA 4XPIB 4KUGA 2OAP1 3S8MA 1ZVJA 2ZTLA 3H4IA 1GNQA 3ZW9A 4RKEA 1EP3B 4CKEB 5KU1A 1F51E 3DOCA 4FBLA 3ET5A 4YWHA 5EWMA 3DA8A 2X5JO 4KN9S 4MGZR 4P81A 1PUIA 2J41A 2ZOSA 1R1DA 4IWXA 3LP6A 1Z2PX 2E4UA 4Z2AA 2SBTA 4EB3A 3PKIA 1PFUA 3VH3A 4ZYWA 5JWOA 4TS1A 3SFZA 4Q15A 3W4KA 3M1IA 2HIHA 4LN1A 721PA 1BROA 3G0BA 3U0VA 2YXNA 4PYJA 4RS4A 2DPXA 2YVKA 3Q9UA 4ESHA 1UXGA 5AK6A 5IM4A 1WABA 4FGKA 4JJFA 1N1GA 2PWAA 4B3BA 3WI7A 4TS3A 4MX8A 5SZHB 4M1SA 2X9QA 1DC5A 3BZUA 3MZ0A 4MXDA 4BMYA 4DEXA 3GMTA 3G2LA 3PL5A 1VSQA 3AHDA 2NUPB 4FR2A 5E1MA 3RSQA 3KOWA 3OJOA 5CDGA 3HJFA 1RW4A 2BPOA 3OP4A 4US2R 4G56A 2O5EA 2ZRJA 1EI9A 3FUTA 1RWWA 1Y81A 4KXWA 2ETXA 2ZU6A 5CDYA 2ODNA 4BV9A 2P4SA 3OLYA 4IIVA 4UU0A 2VQ6A 2N3ZA 1XXHA 3DE6X 4JENA 2O9JA 1P5JA 2RHMA 2F00A 2IEZA 1TFUA 1XDGA 1NULA 4LBVA 3TIFA 3WIOA 1HH4A 4CFSA 1N78A 1MABB 2JGFA 3IDOA 2QV0A 1IXZA 3EC7A 4YBZA 3UW3A 1LPNA 3P9CA 4FEEA 3S55A 4YMUA 5IVHA 4OA5A 5DN6D 2VUHB 5AO9A 1NXPA 1E4EA 4D3DA 2ZU0C 5AI6A 3E4CA 3OQHA 1AC5A 5CGZA 2FG5A 1GIAA 1T2FA 1Z73A 2RHDA 1T2EA 4B6RA 2X9GA 4ZCSA 4EL0A 3EPLA 3M2TA 4MQUA 3PGVA 1XX6A 2CLFB 3GVIA 3TMAA 1IZ8A 1D6NA 5ALHA 4BNKA 3R3YA 1GPWB 3CO5A 3G5TA 3VQTA 2G3YA 2I62A 3F9CA 1NG1A 1V96A 1FFCA 1UJBA 3T35A 3NBZC 2H85A 1FMTA 2GEFA 4CF7A 4BXOB 1KDVA 3FNIA 2XJ9A 2XD4A 2LDBA 4E0BA 4BZPA 3H97A 4D9KA 2H4HA 4H7KA 4RVUA 2Y1FA 2Y6UA 3JQAA 1XQXA 3BB4A 5F7OA 3ZKWA 1W25A 4FDUA 3G5UA 1JLKA 1UBKS 1WMFA 2R48A 3KEFA 5CR9A 1I4LD 4N7JA 3MCUA 4GNRA 1LV8A 4J91A 4EB6B 2R0QC 2ZATA 1CRQA 3JYNA 4MRAA 2UYHA 3SVLA 4UAUA 4EZEA 3MQ4A 1S2OA 5FOQA 5EKUA 4M22A 4OLBA 2ZEJA 5IH7A 4LWOA 2Z1MA 4NENA 4NCBA 3DV0B 1Y3BE 1G4HA 2WVHA 3DVAB 2W5UA 4KITB 1R6BX 1QHYA 2HZ7A 3KJGA 4YQZA 3W6ZA 2EATA 3NPMA 2F59A 3QXSA 2DOKA 4MDHA 1I2AA 4X6UA 5AI5A 5LWQA 1ZI9A 1U7PA 2FEPA 2WJYA 3ILVA 3LIPA 3T06B 3SBEA 3HJCA 3OMLA 4ARBA 4C0AC 2V9PA 2P9QA 2AVNA 2ZUDA 3RU2A 8ATCA 3EBLA 1XFDA 4F4IA 2DCUA 4AY5A 3B53X 5KZMB 3GEPA 2DY0A 4IRXA 3GRCA 1NBMD 2A1IA 4D44A 3W9SA 3SWWA 2BZ0A 4BNXA 4DFDA 1KQPA 2ISSD 1U4NA 2HIGA 4ZV7A 2AX4A 5A2QA 5A9SB 1VG9B 3C4QA 1XZBA 4IIJF 5TRTA 1H5UA 4WBNA 1X19A 3UJ7A 2DWQA 2JI4A 3WRXA 1T29A 2QLNA 2MYNA 2REQA 1JWBB 3W3AD 1WB4A 5C4IA 1HZZA 1WQ3A 3VO9A 1P9OA 3WNCA 1H22A 4QU9A 1CRZA 3M0EA 3HKEA 2FR1A 2HXSA 3K2IA 1MHPA 1ZUIA 4QXAA 5DBGA 3R7BA 4B9EA 5IFLA 2B9EA 3U4HA 3AQIA 3RNLA 1ICEA 2CKMA 5AW5A 3ZN2A 2GM3A 5HG0A 2W2MA 1Y3DE 4BAZA 3B20A 3P4UA 2PWYA 4BCDA 4E11A 1XA3A 2J6CA 1UCFA 2PKCA 3IP8A 3DLTA 3VNVA 1E0AA 2GQ0A 3A6FA 3I8OA 2OK8A 1AIPA 3HVIA 3P96A 4KL8S 3OX3A 4JA0A 5BQXA 1DRUA 4QXPA 4BLOA 3L82B 3SCZA 3M1LA 4BQOA 2YHIB 3K0FB 2DYKA 5I4KA 2FN7A 2FWBA 4UEQA 2OCIA 1A5SB 1BMFA 1VE7A 5AJTA 3WGQA 2AGVA 3FDZA 2HOQA 4CU2A 2HU2A 4ZVMA 2LZ0A 3FR8A 4RXMA 3O2QB 2CBXA 1UEJA 5B3KA 3USCS 1T35A 2ZQZA 4V1CA 2WAYA 3C0KA 4DWJA 4ZMBA 4HGYA 5DOVA 5DK4A 9LDTA 1P2DA 3LCUA 3MTDA 2C94A 4OEHA 1VHTA 1GUDA 3BCSA 4E12A 1TI7A 3MWJA 3FZEA 1GT91 2O06A 4CI9A 2WKQA 3UAZA 3D4LA 3I9OA 3L4SO 4FB5A 1Z2DA 1PX2A 2EDCA 3KDSE 3GLIE 3I01A 4P4GA 2IDKA 3LTEA 2CNDA 3NU1A 5D8DA 3TFWA 2Q27A 3N2IA 1AX9A 4YP1A 3NXSA 1NQTA 1P5RA 3PC3A 1AN0A 2RD2A 1EDBA 1T1EA 2YZ7A 3GJ6A 4JI0B 4R1MA 2VHEA 1IQ0A 1GCAA 1NV8A 5EQJB 2CHFA 1U1GA 2Q6VA 2FRDA 4RZXA 4DG8A 4LTDA 2CB0A 5JIBA 1AMOA 3CWCA 2DFVA 3VVLA 1OHHD 2II6A 4RIHA 1MO4A 4NCKA 3HEAA 5DM60 1B0ZA 3WK8A 3GEEA 2O1WA 5FRDA 5LB2A 4YJFB 2ILTA 1J7JA 1QDEA 4F7DA 4EBBA 1MXHA 2Q28A 4TTVA 1EU1A 5AOCA 1MDFA 4L2IB 1A9PA 2YJ5A 5TGZA 1D4AA 1P5ZB 4AZ0A 1E20A 3IMEA 1ZX1A 3R5KA 4YJHA 2HI0A 5AJWA 4AP6A 1IN1A 1XI2A 1Q0SA 4NR0A 5A4AA 3QUSA 2DCMA 4M1OA 2R4TA 4TTPA 4NJEA 2F8MA 1GGHA 2HRQA 1XV5A 2DFNA 2Q5EA 3ZWBA 4IICA 4LX8A 4IYJA 3ZPXA 4AMBA 3CFYA 5AKEA 3TSAA 2Q6IA 3AKEA 2DWCA 1XNJA 3FTQA 4ZZ3A 4LYYA 3D4OA 3OICA 2QX8A 2D1YA 1DAOA 2HQRA 3H9JA 3PNOA 4ALKA 1RMYA 4DBZA 5F21A 3C14C 1X2BA 1QHGA 1Q0TA 4BLTA 1P5HA 3L0YA 2NP6A 2R00C 2IW1A 1PT8A 4AS3A 2F4NA 2VXYA 4X95A 2YS6A 1SFRA 4I3FA 1XCBA 2QTGA 2OLKA 5EQTA 3MGKA 5FWNA 3UQYS 4PWYA 1ID1A 2H0AA 3V1MA 3RYCA 3TTTA 3QY9A 3M5PA 4PGFA 1A7JA 2QUKA 3K0CC 4BX3A 3O0DA 1JPUA 1PSZA 3DLCA 2P2LA 1OSNA 2E3JA 3H2GA 1T8TA 3UJBA 1QFZA 1YMUA 4XDZA 4DC0A 5JECA 1KJWA 2JJ2A 2FKAA 1IHYA 1Z0FA 4UHDA 2Q9AA 5JCXA 4S04A 1BS2A 4AN1A 3IQWA 3ZD6A 2NM0A 2O54A 1HL7A 1RRGA 5AUOB 3EGCA 4A6XA 1UIRA 2K4MA 3DLAA 1G3MA 4NBUA 3LK6A 3HFJA 3LKVA 2VHVA 3U4CA 3AXTA 3W8EA 2PPLA 3TLBA 3U3MA 4NOJA 3QYFA 4DEYA 2X3UA 2HMTA 1TKBA 3SQOA 4UTVA 3QFRA 1CE8B 1F0NA 1NQAO 3B9RA 4PN3A 1IB6A 1UBOS 3L0PA 4EUFA 3DC7A 5DBEX 3VC3A 1G19A 3D5EA 1S1CA 2OSBA 1UOEA 2IOHA 3M6UA 3MS7A 4KQ6A 1WETA 1UT8A 4IV8A 4U9UA 5LQAA 3D8BA 1U2RA 1JA0A 2C1ZA 2AR0A 3VH1A 5KWJA 2EBFX 2FUNB 3VSBA 9ABPA 2ZIUB 1SVIA 2B8TA 4TL8A 2Q2VA 3VYRB 4JNCA 1FLAA 4RMHA 5A04A 1OY1A 1I4EB 2D1TA 3FLMA 2OZLB 1DO2A 4YR9A 2BFCB 1T36A 4I8DA 4DA7A 3EODA 5EXTA 2ZS8A 1XC7A 5K51A 3LSTA 3E3MA 2DEUA 1CY2A 1MT0A 5FR2A 1M8PA 1XEXA 3QWHA 4D9EA 4PZYA 3IP9A 2COUA 3NAMA 3I62A 3DZBA 3DMFA 4DIMA 2PBLA 2FQ1A 3KSZO 1PZEA 2JFXA 1HL3A 1RR6A 1AZLA 1NW5A 3F7NA 1FMCA 4YDSA 2UAGA 1VCMA 2CJFA 3G7NA 4Z9AA 3J7TA 4U9HS 1T9GS 3AHGA 4W5NA 2WTBA 4OHCA 1L7RA 1P29A 4FX5A 4N65A 3TUZC 2VK2A 4XSHA 4I1OA 1UK6A 1TZ2A 1YR1A 5KC9A 4OKSA 3KAKA 5E4TA 3C3AA