4EUEA

Crystal structure of clostridium acetobutulicum trans-2-enoyl-coa reductase in complex with nadh
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
398
structure length
398
Chain Sequence
MIVKAKFVKGFIRDVHPYGCRREVLNQIDYCKKAIGFRGPKKVLIVGASSGFGLATRISVAFGGPEAHTIGVSYETGATDRRIGTAGWYNNIFFKEFAKKKGLVAKNFIEDAFSNETKDKVIKYIKDEFGKIDLFVYSLAAPRRKDYKTGNVYTSRIKTILGDFEGPTIDVERDEITLKKVSSASIEEIEETRKVMGGEDWQEWCEELLYEDCFSDKATTIAYSYIGSPRTYKIYREGTIGIAKKDLEDKAKLINEKLNRVIGGRAFVSVNKALVTKASAYIPTFPLYAAILYKVMKEKNIHENCIMQIERMFSEKIYSNEKIQFDDKGRLRMDDLELRKDVQDEVDRIWSNITPENFKELSDYKGYKKEFMNLNGFDLDGVDYSKDLDIELLRKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of trans-2-enoyl-CoA reductases from Clostridium acetobutylicum and Treponema denticola: insights into the substrate specificity and the catalytic mechanism
pubmed doi rcsb
source organism Clostridium acetobutylicum
molecule tags Oxidoreductase
molecule keywords Putative reductase CA_C0462
total genus 140
structure length 398
sequence length 398
ec nomenclature ec 1.3.1.44: Trans-2-enoyl-CoA reductase (NAD(+)).
pdb deposition date 2012-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07055 Eno-Rase_FAD_bd Enoyl reductase FAD binding domain
A PF12241 Enoyl_reductase Trans-2-enoyl-CoA reductase catalytic region
A PF12242 Eno-Rase_NADH_b NAD(P)H binding domain of trans-2-enoyl-CoA reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4eueA00
1GQYA 1N92A 1NX6A 3D3WB 2VTDA 1HDXA 4EDFA 4XYEA 1I01A 1GQ2A 1D4FA 2PK3A 3NJ4A 5U9CA 4J1TA 2VT2A 1DIHA 3NDRA 1XU9A 3G0OA 4KWIA 4IQ0A 4N5LA 4GQAA 1TB4A 5CFZA 1HTBA 3BAZA 3VAZA 5TLSA 1ZMTA 3PLRA 1ADGA 1P0CA 3WWYA 3KSDO 4GWKA 2NVUA 1W0CA 2ZQYA 3ZN2A 3NX4A 1S7CA 3PDJA 2ZB4A 4U7WA 1IZ0A 1IYZA 2PKRA 3I83A 2FR0A 2Y0CA 4XYBA 1NYTA 1HWYA 1GYPA 3ROMA 1Q7CA 4IDCA 3UICA 3IUSA 4E5YA 1SPXA 3OBBA 2VYVD 5L7TA 2X5KO 3OQ6A 1QV7A 1C1XB 3UGKA 3WICA 4ALLA 1FDTA 3ZV4A 5H82A 3EDMA 4RORA 4IJUA 2HK9A 5HA5A 3C7CB 3JCZA 4NQZA 5IZCA 3FR7A 1FXSA 1UXGA 3WNQA 2RBEA 1K3TA 1N1EA 2WEKA 2EG9A 3JD3A 4IUYA 3ROPA 1UDAA 3UF0A 2HLPA 1EK6A 3MJTA 1NFQA 1F12A 1B0AA 1I5RA 3OIDA 1XIVA 4NPCA 4E12A 4CM7A 3AUTA 4XGIA 1V8BA 4RVSA 3TZ6A 5L7WA 3GVHA 2BH9A 3ENNA 4ND3A 3WGOA 2O7SA 3AOEC 4B7UA 5ILOA 3ZU5A 1WNTA 1YBAA 2A9FA 3ZWVA 1DC3A 3AFNA 3CTMA 1GQQA 3JD0A 1QG6A 2CDAA 4R1SA 3DL2A 1XKQA 4BO0A 3N7UA 4F6CA 2DUUA 4YAJA 4JBIA 5ES3A 1LLDA 1UDBA 1VJ0A 4HXYA 5BT9A 1QYWA 2G76A 3OM9A 3K9QO 5CEJA 3PRJA 3QW2A 4UEJA 1CYDA 1ADBA 3MJCA 2JFGA 3D4PA 4NFYA 5KVQA 2VZ9A 4KOAA 3RFTA 4ALNA 3OICA 4S1VA 1BXGA 1BSVA 1U5CA 1FDSA 4ZGWA 4AICA 1NPTO 2VRBA 3OF2A 3W8DA 2PNFA 3RBVA 4RVGA 4IS3A 4DLAA 1PU2A 2JFFA 1PGNA 4GSKA 1NBOA 3EHEA 1R4NA 1VPDA 4RPKA 2IZ0A 1QXSA 4WUVA 4WLNA 2FSVA 1KY5A 4YDRA 3FHLA 1XA0A 2NQ8A 3DAFA 3S8MA 1U4SA 2FPGA 4RZIA 4A10A 4RJTA 3ONFA 4XQEA 2X0NA 1AUPA 4ONEA 5JO0A 2VOJA 3WDSA 3NTRA 1E3EA 1KVSA 3GT0A 1L1FA 1LX6A 3F3SA 3D4OA 2EIHA 4RVUA 4BUCA 5G0WA 2E82A 2GYYA 1Q7GA 2J6IA 3ICPA 5DNAA 5BSGA 5JC8A 1X0VA 1KEVA 4D3FA 5JNLA 1PZGA 5CDGA 2Q46A 1NHGA 3S2FA 3GZNB 3VVBA 2HAEA 4LVUA 1VC2A 4ZRNA 5EESA 3AM3A 3GNSA 2GNAA 5K6AC 1C0PA 1D3AA 4A26A 1GD1O 1GYRA 4W7HA 4D44A 3GZ4A 1ISHA 2UUPA 3O03A 1DFGA 1DSSG 1B16A 3IKTA 2VUSA 4NBVA 2X6TA 3Q9UA 1X1EA 4B3IA 2Y0EA 3GEMA 1BRMA 1GU7A 3PIDA 2FPPA 2VYND 3DHEA 3VH3A 4CUZA 4QO7A 4Z3KA 1I36A 5BQFA 2QIOA 2AW5A 2UYYA 4DLBA 1ENPA 1TXGA 3PHJA 3SC6A 4RVFA 2JKVA 4UAGA 1L7EA 1Y7TA 4BO3A 3CMMA 2W4QA 1EQUA 3K5PA 7MDHA 4B7CA 5DF1A 3HN7A 3GMDA 1EBUA 5H81A 3JSAA 2NNLD 2NU9A 5LC1A 1K6IA 1DPGA 1U2GA 1C0KA 4ZQHA 3D5TA 1KVUA 1HYHA 1DC6A 3H9JA 1BDMA 4NNJA 4L75A 3H4VA 5G4LA 5JDIA 2P5UA 3RKUA 3QVSA 4IGFA 2ZTMA 3QE3A 3I6IA 4J1NA 3BTUA 2EGHA 1I24A 4GPD1 1AXGA 4Y98A 3ZU3A 3GK3A 2GN9A 2JAPA 4BO2A 4CMAA 3PI7A 4JLWA 4DIBA 1MB4A 1VE9A 3H2ZA 2B37A 1PR9A 3HHPA 2PZJA 1ISGA 4O59O 2DM6A 2O2YA 3G1TA 5I7SA 1NQ5A 4J3FA 1BW9B 3JQAA 4D43A 3PYXA 1KIFA 5T64A 4J7XA 3C7AA 3G1UA 4YR9A 3HQ4O 1NNUA 4R01A 5TX7A 2J8ZA 1PS9A 3NDJA 5AXBA 3DZFA 1DRVA 3ENKA 3ZI0A 5JSFA 4A0SA 3A1NA 3WNVA 2UVDA 3BHIA 1LJ8A 4XB1A 2O3SA 3S2EA 1EK5A 1ZJYA 3VHRA 3LU1A 3FI9A 3UVEA 1CETA 1H6BA 4HADA 5JE8A 5JO9A 2XXBA 3QY9A 3TFQA 1JA9A 5A03A 2OBYA 2ZATA 2I76A 4XX0A 1ZSNA 4IQGA 1I10A 4QXMA 3ZNQA 3TN7A 5JW6A 5JY6A 1HEUA 3VH1A 1CDOA 1HL3A 3FNEA 4BV8A 1UAYA 3VKUA 2Y1FA 3IIEA 4GBJA 2E49A 2DBQA 1P0FA 4MOWA 4ZVVA 4AJLA 5IF3A 4FJ1A 4AJNA 1H2HA 2PWZA 3DTTA 5CEEA 2GGSA 1H0KA 2GD1O 2Q45A 1Q7BA 1HZJA 3MOGA 4BKQA 4EZBA 2X9GA 2XXJA 3RUFA 2C2YA 2EXXA 2NU8A 3ZDFA 4EBFA 3U09A 5DT9A 4CR8A 2G0TA 2GPTA 2YV3A 3PDUA 4GMFA 4GGOA 1WWKA 2F1KA 4R1NA 4LGVA 5ENVA 1DEHA 3F1KA 1GCUA 1LDMA 4YJFA 4CQLB 4YPOA 3VOSA 5A9SA 2D5CA 3UCXA 1Y8QA 4LMRA 3BMOA 3NKLA 4QFDA 2VHXA 1PZFA 5L53A 4FCCA 4BNLA 1KETA 4FFRA 5IXYA 3DZBA 5DBFA 4QQRA 3Q11A 2POQX 4ZU3A 1O95A 5IDYA 2Y1OA 4U0KA 4ZQFA 2YZ7A 3HFGA 4XYLA 1ADCA 3PQEA 3L4SO 3Q6IA 4PG5A 3SJ7A 3GRKA 3H8VA 1HF3A 1N8KA 1NPDA 3FR8A 2BLLA 1T26A 3U4DA 5ADHA 2VWPA 2X9VA 3O9ZA 4KQXA 1BMDA 4OL9A 4CLEA 5MGBA 2C0CA 2VWHA 1R0SA 4Z0PA 1YBVA 4WNCA 3DZJA 4MPDA 1DJQA 2EEZA 4BNUA 1H93A 5BNIA 3KEQA 3C24A 3PQFA 3HDQA 5KIAA 2PZLA 1BDBA 4R16A 4RF4A 3SX2A 1WMBA 2HU2A 2Z1NA 2Y0DA 5JAMA 3ZWYA 2CMDA 2H9IA 3PJDA 4BNMA 2WJPA 3MTJA 3G49A 3VDRA 4CPDA 5FWNA 3GY0A 1T1SA 2YQ4A 3TWOA 2C2XA 4CUJA 3N74A 1I3LA 3H9QA 4MVJF 1NWHA 2P91A 1EVZA 2ZB8A 2ET6A 4MVJD 4OKNA 3VPSA 3R3JA 3X2FA 4CR7A 2P9CA 4NBWA 3DHNA 2O3UA 4J2HA 4BNJA 4BB6A 3C3XA 4IJWA 3NUGA 1TT7A 2EWMA 1WDLA 4K9DA 3E03A 5C7LO 4TRMA 1DOHA 2RHRA 5G2OA 4RF5A 2IE0A 2NADA 2PA3A 1IHXA 4YVFA 2VWQA 2Q1SA 2JJYA 4CMBA 4B4UA 3DAPA 4GVXA 4QUKA 2W90A 4F46A 2X23A 4WOKA 4WCFA 4J16A 1N9GA 1JWBB 4NBUA 5LDGA 2VCYA 1NR7A 4E2YA 3VPXA 2J5RA 2AEFA 5L45A 3INTA 4RZHA 1PGOA 4TSKA 4E2ZA 4P4GA 4RVDA 2FPIA 2EKPA 4II3A 4WCDA 1LRJA 4TROA 3ZV5A 2RAFA 1U2DA 1QYCA 3GVCA 4M8SA 1LC0A 3RC9A 4ILKA 5KCZA 4FIZA 4RGBA 4N54A 1YS4A 3E5MA 2WE7A 1MA0A 1SEPA 3D64A 3RAJA 2Q50A 3WGGA 4DYVA 4BKUA 1I2CA 3DONA 1IB6A 3AM4A 1LQTA 1VL0A 3DBHB 4MJLA 2Q2QA 4GKVA 5GZ3A 3DQPA 4A5OA 1BHSA 3VZSA 4J4BA 1FDVA 3HUDA 3PLNA 4QFCA 2FN7A 4CL3A 1QLJA 2VOEA 2G82A 1I3KA 4AJ4A 3HZZA 2CDBA 4RCVA 4YB8A 3GDFA 2AG5A 3D0OA 5EL0A 3RSHA 2FRDA 3GLQA 3A14A 4E4YA 2BGLA 2HRZA 3P19A 2E4AA 4K6CA 4WLFA 3PYLA 5KJEA 1UXKA 3FCOA 1NWCA 1SO8A 3A9WA 4N18A 3WSWA 1EZ4A 3ZU2A 2X0IA 3FBGA 3AM5A 4CM5A 3ZU4A 5FYDA 3VDQA 3P2OA 2VUTA 4YQZA 3UXYA 4BO4A 2D59A 4YJGB 3AI2A 3PFWO 1A9YA 2OUIA 1E1MA 3SLGA 3ORFA 3I9NA 1ONNA 4L8VA 4ALMA 3ICCA 3WQSB 1ZK2A 2IRWA 1I0ZA 3TRIA 1AHHA 1PGPA 3GVIA 4NBTA 3O26A 5KTKA 2IODA 5C3MA 5U1PA 4CV1A 4O1MA 5IJZA 1E3WA 4LCEA 4E30A 5CAEA 1EVIA 4PLPA 1U8FO 3ANNA 5A05A 3NV9A 2CNBA 1Z74A 4IBOA 3QVOA 4E13A 1VJ1A 2JL1A 5F5LA 1YDWA 3DZIA 4JROA 3GA0A 3UCEA 4IMRA 3AY7A 3GGPA 2FOIA 2E48A 3I4CA 1EE9A 2Q4EA 2Z5LA 3OJ0A 4FD3A 4XYMA 3M6IA 2OOSA 1FF9A 3HDYA 3MJEA 4CM9D 4J7CA 5IZCC 3KYCB 3B1FA 4BHTA 1MG5A 1K5HA 1ZK4A 3D3EA 3PZBA 3KSUA 4Y67A 1U3TA 4Q9NA 3I5MA 4HBGA 3H5NA 1J49A 4YAGA 2FR1A 1QYDA 1QLHA 1DRUA 4J1SA 2CF6A 1PZEA 2DAPA 3PFFA 3PXXA 3U4IA 4IY1A 4CLRA 4M1QA 2CUKA 5TQVA 2B35A 1UDCA 4Z9FA 4A7PA 1Y9AA 1ZXLA 4CMEA 3QWIA 4J6FA 2O50A 4XJSA 5FI3A 5KVSA 2EKLA 2QQ5A 2BFOA 4BO7A 3DZHA 3WB9A 4F45A 3P2YA 5GZ1A 3O8QB 4JJFA 1XEAA 5CPFA 2FHSA 1RWBA 1VM6A 2FP4A 4HFRA 4ID9A 4KUHA 1TA4A 5JCJD 4FN4A 4JJIA 4BO9A 5B12A 4BVAA 4BNZA 3RVDA 4PLHA 3A06A 3RUAA 3DOJA 1HXHA 3O4RA 4NFSA 3OMLA 3JQ9C 5B4UA 2VN8A 2VTEA 3S2IA 3IP3A 3BXXA 3JQBA 1EDZA 2AQHA 4E31A 6ADHA 2AE2A 2I66A 4FJ0A 1CQJA 5K0ZA 3T7EA 1GCOA 3C85A 4OH1A 3DBLB 4ALIA 1DJNA 1LEHA 1L7DA 2CVOA 1ZK1A 5TC4A 4WCFC 3IC5A 3N58A 2AEJA 2B0JA 4OGWA 4BIIA 2VHVA 3WBFA 3MCVA 5L4LA 1P31A 1YBMA 4MVJH 2PD6A 1DO8A 3HG7A 2PH3A 3BZUA 5G4KB 4AJJA 4DTIA 1UR5A 3ONDA 3I9KA 4BNVA 1K6JA 2O3JA 4NG5A 3ZWMA 3JYQA 1XG5A 2YDXA 1GL3A 1E3IA 2ZYGA 1ZBQA 3G79A 2I6TA 1I30A 1RM4A 1PWXA 4I5GA 1NTOA 1MXHA 4CMEC 1HDRA 4BOYA 4ZA2A 1ZK3A 3VPHA 3QQPA 3QVWA 4CQLA 5A9RA 2C07A 5B4TA 3ZNPA 2AMFA 3B1KA 1V9LA 4AJKA 5T67A 4ESOA 3SJUA 3CMCO 1LBEA 2D1YA 2I9PA 1YDEA 4KDEA 1YL6A 1X15A 1SOWA 2DC1A 3HFSA 4G5HA 4DPMA 1HYGA 1LSUA 1IY8A 3IDSA 4PG6A 1W8DA 2Y1GA 1GYQA 3GEDA 3MJ4A 1CRWG 1D1TA 1F0YA 1V6AA 4OOFA 3GFBA 3V2HA 4DWVA 1QSGA 3TZHA 3ZWXA 2JD2A 1H6DA 4KTVE 5CHEA 3DBRB 1GZ6A 3QV1A 2EP5A 4YRBA 2P9GA 2EF1A 5K9ZA 3BTVA 1M76A 3F47A 3GG9A 3INGA 3PK0A 3KYCA 1X7DA 1WDKA 3DBVO 4XD2A 3WXBA 1SOVA 5HBRA 1Q2XA 5ITWA 4XYGA 3L77A 4XIYA 1QR6A 1PTJA 4NHEA 4UUOA 1LNQA 1PR3A 2LDXA 3WFIA 1OC2A 3WSVA 4GGPA 5CP8A 1KEUA 3QWHA 2DTXA 3S55A 4AJIA 1HYEA 5A9SB 2OL4A 4LVCA 5FEUA 1KVRA 1N2SA 1JU9A 5JBIA 4E2WA 1T4BA 2YW9A 5L4NA 3ZZNA 2AEMA 1EUDA 1WVGA 4IIVA 3KETA 1ORRA 2OBNA 3UOGA 2X86A 4O6VA 2HJRA 4KQWA 4PRLA 3IJRA 5JXWA 2GASA 3FSRA 1OI7A 1DAPA 2B5VA 3AK4A 1H9AA 1M67A 4IZHA 2PZMA 4RQUA 1T2CA 3GGOA 2I3GA 4HUJA 3ST7A 4PLVA 4AJ2A 2PY6A 3MWEB 5JAIA 3ZHXA 1CF2O 2CDCA 1SNYA 3A28A 4DQUA 4BO1A 3FTNA 4NJMA 4EUHA 4LN1A 4B3HA 2Q99A 5KVCA 4YJGA 1GEEA 1XQ1A 2YHIA 1PS0A 1XWFA 1F8FA 3BMNA 4GWGA 4JQCA 1YOVB 3RUIA 2QHXA 4CMIA 2P9EA 4KWHA 2IXAA 3VC7A 3ZV6A 4CV3A 1FDWA 4BNWA 5LDHA 1I2ZA 1HETA 4IQ8A 3UCFA 2Q2WA 1GEGA 1U1IA 3IJPA 4OOEA 2EJVA 2D3TA 1PL6A 1N1GA 3G17A 3CXRA 1YH3A 1ULSA 1PJQA 1Z7BA 4UVEA 2YJZA 4LCJA 2WD7B 4PLYA 2P4QA 1A9ZA 1U8XX 4KDFA 4WLOA 4RQTA 3GPDG 3EVTA 4XQCA 5FF9A 2Y66A 5DCYA 1YKFA 4U6QA 3EYWA 4OSPA 1YQDA 3KXDA 3NDIA 5EQFA 2FZEA 2B4TO 4IM7A 4MP8A 1BXKA 3WTCA 3FNHA 3PWSA 4MVJG 1YL7A 4DC0A 4RF2A 1I3MA 5TJHA 4CMIB 3PGXA 1K6XA 4RLHA 1UXIA 1LRLA 3AFMA 3ZV3A 3DBLA 3AI3A 4B8WA 1E7YA 3EK2A 5THKA 4OYRA 3CINA 3KB6A 1UJMA 5LCXA 3GZNA 4QX6A 4XKJA 4RPJA 3OECA 1XGKA 1DIAA 3GOHA 5EJ2A 3KLMX 2B36A 1GUZA 1MGOA 4IMPA 4YEDA 1T2AA 3GRPA 5COAA 3H7AA 2H63A 1M6HA 1R16A 1SB9A 3KOUA 2BFPA 4YJDA 2AG8A 4RPHA 3W4KA 3WG9A 1JQBA 1O94A 5DCWA 4G65A 1P1JA 2IDZA 3K6JA 4EYEA 3H9UA 5HM8A 3OJLA 2DT5A 4XB2A 3IS3A 4NMHA 1A7KA 4WEOA 5DDIP 4JXKA 4BGEA 4BNXA 4EW6A 1YJQA 1Y8RA 2AQIA 3GUYA 4OSOA 1LDNA 4MIYA 2ZIZA 3GGGA 2HQ1A 1TI7A 4UEOA 2CD9A 3GN1A 5DZSA 4CLDA 4DIOA 3DWFA 1LUAA 3OA2A 4DQXA 3ITKA 4NIMA 4ZD6A 1ZIDA 3H5RA 1Z45A 2I3AA 3CE6A 4WGGA 5TGDA 3MJVA 4E2XA 2YFHA 1PJTA 1C1DA 4CM3A 2H6EA 4PLCA 4GX0A 5BNFA 4DXHA 5CG2A 5BSFA 4U8GA 1HLPA 3L4BC 1HT0A 4OM8A 3PPIA 4CMCA 5C7IO 1NP3A 4DQVA 1RJWA 5TIIA 2NU6A 4I1IA 5DOZA 1LDBA 3BMQA 2DUWA 4IPTA 4CLHA 1NVGA 4UREA 2PKQO 3JQ7A 4UVHA 4PN3A 1PQWA 1ISFA 1GY8A 5L3ZA 5JPIA 4L76A 3FNGA 4W9NA 1T2EA 3KEOA 5JAZA 1X14A 3WJ7A 4ND5A 1YB1A 1PJ2A 2WD7A 3EUWA 1WW8A 4GVLA 1LLQA 2GF2A 2OO5A 4D0RA 5A3JA 1RM3A 4N5NA 3ZGYA 1QV6A 1XELA 4ZN6A 4OXYA 1BW9A 3JQAB 2J3KA 1W73A 2J5KA 1M75A 4L0QA 3PHIA 1U28A 3GR6A 4N7RA 3TJRA 3M2PA 4I5DA 2FY8A 4E32A 2Y67A 3VPGA 1VI2A 3VZQA 4BNKA 1Z73A 2PLAA 4XA8A 1JAXA 5JDCA 5EN4A 3OJOA 5DULA 1VKNA 4I9NA 5B37A 1ONOA 1WLYA 3C1TA 4K1LA 4J9VA 2V6BA 2Q1TA 2NVBA 3OJEA 2PGDA 5F5NA 3UW3A 2XPCA 4FS3A 3VH2A 3A4VA 3CKYA 3PYMA 4R51A 3DMTC 5KVVA 3D5QA 2PTGA 4D42A 3HADA 5I8ZA 2EV9A 2BHLA 4FW8A 5B1YA 3Q2IA 2FWMX 1VSUA 2PH5A 2GN6A 4GH5A 3O8QA 4ZQEA 4PLGA 2ZKLA 3DBHA 3WGHA 2XF8A 3HB5X 3LYLA 4XRGA 1H6CA 4RVHA 4J9UE 3GQVA 2DBZA 3E5RA 2ZTLA 2JCVA 3DFZA 3IMFA 2CVZA 2CF5A 3RFXA 5FI5A 4WOJA 1AHIA 4YAIA 2GZ3A 4XDYA 4YBZA 3TL3A 2NUAA 2JCXA 7ADHA 2D2IA 1O89A 3E18A 3H9GA 3WGQA 3L6EA 1C1DB 2ZCVA 1ZNQO 4YT8A 1XQ6A 4Y8VA 3ZW8A 3NTQA 5JDCC 4TZTA 2Y99A 3WMXA 3WYEA 3GVPA 3JQDA 2AHRA 5IN5A 1HRDA 3ULKA 3B6ZA 2GCGA 3WLEA 2CZCA 3BMQB 4NH4A 3PJEA 9LDTA 4CM6A 1BWSA 5HS4A 3DZGA 5ENDA 4CLOA 3WOHA 1PJ4A 1F8GA 3C1AA 4HY3A 4JIGA 4FPXA 4GSLA 4J49A 4F6LA 3AUAA 1IE3A 1VL6A 4PG8A 5BSEA 2B69A 4ALKA 4YXFA 3ZWOA 4EJ0A 3WFJA 4XCVA 1DIGA 2C29D 2ZJ1A 3M2TA 3ZH2A 2O23A 1VLLA 3R6DA 3DTYA 4FC7A 5F1PA 2RH4A 3Q2KA 4RV9A 5L7YA 1S6YA 1NVTA 1ZSVA 3LF2A 4M86A 4IS2A 2BD0A 2GUGA 4UUNA 5F3RA 1U3VA 3ROKA 1TT5A 1VL8A 1Y9EA 3DMYA 3FTPA 4A03A 3JD1A 4DUPA 2AXQA 1M66A 3VPFA 1GTMA 4FB5A 1N7GA 3ZCXA 2X22A 4QT0A 2IXBA 3RBZA 4BQPA 4BNYA 2YDYA 1JVSA 3AY3A 3FBTA 3JTMA 4Q3CA 5A04A 1YOVA 3DO5A 4EEZA 3QHAA 3IAHA 4R9RA 3COSA 4AL4A 3B70A 1JDJA 3F5QA 2VNSA 3JQGB 4HWKA 2YHIB 4YQYA 5A4DA 4BL5A 1ZCJA 3NEPX 1NAIA 3SC4A 3U0BA 5EINA 3BIOA 1MG0A 4J43A 1BVUA 1PIWA 2OORA 3WGZA 3WTBA 5L95A 1GZ3A 5HRUA 2AQ8A 2V6FA 4DMMA 5KJ1A 5AXCA 5JMPA 4UEKA 1WZIA 4OHUA 1H2BA 3E82A 1ENOA 2WSBA 1B2LA 3DEYX 3PIIA 1XHLA 4IJKA 2E6UX 3PWKA 3ZWNA 4R3NA 5I7FA 1BTOA 3V1YA 2JD1A 4HFNA 4IINA 3TOZA 4DREA 4YAKA 2XOXA 2Y93A 1DIRA 3WX0A 1LU9A 4LRTB 2BRUA 3QA9A 2X0RA 3ZW9A 1G1AA 2ZTVA 4XGNA 3KRTA 1YO6A 2VZ8A 4YA6A 2HK8A 3LC1O 4TRNA 3LDHA 2C7VA 3BMNB 2D0IA 4XRRA 4DGSA 1GADO 2C5EA 1I2BA 1P74A 4ZJUA 5L40A 4OMUA 5I8WA 3CSDA 3QSGA 5AVOA 3RROA 4BNFA 4MVJP 2GN8A 3AI1A 3GN2A 4K6FA 2WYWA 1H9BA 5AXDA 5I9NA 2R2GA 5G0TA 5KNLA 1OBFO 3GDGA 4UULA 1BVRA 3DBRA 2W8ZA 4J7UA 3T4EA 1O6ZA 4KUGA 4CQMB 2XAAA 1BGVA 4UUPA 2E37A 4JX8A 4KUEA 1LSJA 3OA0A 3OHSX 4JP3A 2GN4A 3MTGA 1PL8A 3RKRA 4PGFA 3IP1A 5HTOA 1E7SA 3F4BA 4PZCA 5A9TA 5I9MA 3KVOA 2HK7A 1X7GA 1HSZA 3NGXA 4PRKA 4IIUA 2CVQA 3UHAA 3F46A 4GX1A 4EITA 4F3YA 5DBIA 4NDNE 3I9LA 3NJ8A 4Q3BA 4Z0TA 1X7HA 4PZDA 4NFHA 3EZLA 1ZEMA 1EVYA 2GDZA 3RUDA 1WDMA 3DR3A 2JHFA 3JQAD 1QORA 4L74A 4D45A 2UAGA 3EAGA 1IHYA 3RC2A 3ZWBA 4BV9A 1H6AA 1JKIA 1P77A 3H3JA 1PQPA 2PD3A 1ZZEA 4Z9YA 1PJBA 4MIOA 2Y05A 4R3WA 3I6QA 4OXNA 5AOVA 5I7EA 1YQGA 2BFAA 2NWQA 3TZKA 1D7OA 3VTZA 4NK5A 1YRLA 2HSDA 2Y1CA 4ZQGA 4AJEA 4EGFA 3JQBC 4LISA 4LSWA 1G0OA 2Q49A 4CQMA 4JK3A 3LT1A 4UVIA 3BYZA 2X8LA 4XR9A 1XSEA 4M89A 1LXCA 4O5OA 3RJ5A 5JMWA 1R12A 3VZPA 4GLLA 4I08A 1LRKA 4N5MA 5IDWA 1O9BA 3WGIA 1A27A 5ICSA 4U6SA 4J0EA 2RIRA 4UUMA 1YQXA 2X58A 2X1HA 1DBVO 3FWZA 4CQMD 3JQGA 4P4NA 2C20A 4FFNA 3BTOA 2YQ5A 4MVJA 3I52A 4BGVA 2ZB3A 4BKOA 4BS9A 3T7CA 4Y6RA 3L9WA 2BI8A 4IXTA 4NU6A 4CMHA 5L51A 2O7QA 3KZVA 1AXEA 1ZW1A 4D0SA 1H94A 4ROSA 1EDOA 1WPQA 4UVGA 4DLLA 2QRKA 1IPFA 2ZYAA 3JQFA 2QZZA 3CH6A 1IOLA 2FMUA 5A06A 4NJOA 3C7DB 2PGLA 1JW9B 1E0DA 3JYOA 1LLCA 1R37A 1HE3A 4MVJM 3L07A 4JJGA 3TFOA 1DC4A 3ZWAA 4YT4A 1P1FA 2WE8A 5AQ1A 3OETA 1KEWA 1ISMA 1DFHA 2JD0A 5A3VA 1N5DA 5EQDA 1MFPA 3QWBA 1V3TA 2JCYA 4WCFB 1E5LA 1OFGA 3EZYA 1DHTA 5JYEA 4IJVA 3W6UA 3GNQA 1EUZA 3WYCA 4KP7A 1ZJZA 3ETEA 4E3ZA 3SXPA 4MO2A 1KS9A 2BF7A 1CERA 2OFPA 1UP7A 3P5SA 2G5CA 1PX0A 3QWFA 4TVOA 1F17A 1PS8A 4FFPA 2NVWA 1D1SA 3UKOA 3RD5A 4DC1A 2FR8A 5JS6A 4WJZA 3Q3CA 3RFVA 2PGJA 4G81A 2ZK7A 1J6UA 4HNHA 1Y5MA 4B4OA 1ZVMA 1R15A 3I4FA 4CMGA 1IPEA 3MEQA 4JGBA 5F21A 2X7HA 3L6DA 3TDKA 3RIHA 3P7MA 4IDBA 5TF4A 3LQFA 4YT5A 3DOOA 2PFGA 3RBXA 1J5PA 3JD4A 1T24A 4B79A 1PSDA 3IOYA 4D79A 4PLZA 2X4GA 3GHHA 4MVJI 3ETDA 4TKMA 4CM4B 1ZXBA 2D8AA 1NFFA 1G0NA 5BNTA 4JBGA 2I99A 2H1SA 1GR0A 2VRCD 2Z1MA 1E1LA 3L6OO 4J4TA 5A5EA 3RC7A 3LLVA 3DMTA 4D46A 1ZH8A 3AWDA 2UV8A 2FZWA 3U9LA 4I5EA 4AVYA 3DDNA 2NV6A 2EKQA 3KBOA 1SB8A 4DBVO 4WASA 4L4SA 4W82A 5C37A 4R69A 1I3NA 1T2DA 1ZFNA 2WYUA 5IN4A 4RLSA 4PCVA 2NM0A 2JAHA 3AUUA 2OGUA 2NU7A 4BNNA 1MX3A 3RC1A 1HZZA 3DZKA 4YRDA 2GERA 3KYDA 3G3EA 5L9AA 2QRJA 3DB2A 3BMOB 1HE5A 2Y1EA 4E5MA 4D3DA 5G0SA 5A1TA 5A5FA 1GPDG 3JQ9A 4YJFB 4S3MA 4CR6A 1C0LA 2G17A 1F06A 4C7JA 2QW8A 1R6DA 3VH4A 5KKAA 1YB5A 4RDIA 3ASUA 4DVJA 2HRBA 1TEHA 1UZLA 3LC7O 3HJAA 1R4MB 4XZ3A 1E1NA 2V6MA 5CG1A 1QKIA 1XCBA 5COQA 2VYNA 1MLDA 3MZ0A 5IXSA 1GUFA 3HE3A 1HE2A 1FJHA 3GG2A 3C1OA 4XIJA 4MDHA 4AFNA 1MUUA 2RH8A 4I9UA 4WPGA 5G0VA 1NR1A 3WGTA 2V7PA 4BMVA 4ZHSA 2A94A 2NVUB 1E92A 3WYBA 1NVMB 4OIMA 4MKRA 3QJ5A 4E33A 3GMSA 4C4OA 4WLUA 3AOEA 3NT2A 1UH5A 3FF4A 5TRTA 4OXKA 4CUKA 2DKNA 2YUTA 3BMCA 1XDWA 3I9OA 2VHZA 1PL7A 3F9IA 1E7WA 5T57A 3D3WA 3QVTA 1A4IA 1EQ2A 2WWRA 4EUFA 5ITVA 4E6PA 4CJXA 3U62A 3TF5A 2TMDA 3GAFA 4NK4A 1P3DA 2WTBA 5H83A 3PJGA 3E6AA 1CJCA 4Q3NA 1ZUD1 1X0XA 3EC7A 3ONEA 3BHJA 4DRYA 4FDAA 1Z82A 1LSOA 4BNHA 4GKBA 1B15A 1ARZA 3TOXA 4OAQA 4PFJA 4FGSA 3H65A 3LT0A 2NLOA 2B4QA 3V1UA 1PJCA 3HDHA 2EJWA 4D3SA 1B8UA 2W98A 4URFA 5G4KA 1RM0A 1ISIA 1P1RA 2P68A 3E8XA 1PJLA 2PV7A 2Y68A 3E9QA 3K2EA 3DHYA 5EERA 5HS6A 3X2EA 3UUWA 1K89A 4CLOB 1E1KA 3PQDA 1U5AA 3D4NA 3ZWCA 2A92A 2C59A 3W4IA 4ALJA 3NAQA 3STHA 1C0IA 3JD2A 4LRSB 3RU7A 4IDEA 3UH1A 4OQZA 1B7GO 2BGKA 4YJHB 2J3IA 3JQ8A 4EI2A 2QX7A 2YHUA 3ON5A 3ANLA 1HDYA 2B5WA 4JNKA 1KBZA 3EMKA 4FC6A 3ZWWA 1R4NB 3JQEA 4R41A 1Q0QA 4H7PA 1B8PA 1ZO8A 2X5JO 1B14A 3JQFC 2EERA 3MJSA 2DFVA 3JQ6A 4WE3A 3DOCA 2O4CA 2RHCA 3TZQA 1P1KA 4RO0A 4JCOA 5T8KC 3ROQA 1MC5A 3F5SA 4BO6A 3NYWA 3RCBA 4NU5A 5JCJA 1T25A 2AQKA 2D5AA 3GDOA 1R66A 5C7OO 4HX5A 3LSYA 5T5QA 5ER9A 1HSOA 4H16A 4R68A 3IUPA 2GLXA 2P2SA 2EP7A 3KV3O 4HNGA 4ZQBA 3WQQA 3ZHBA 1MXFA 2PD4A 5TT1A 2BMAA 2HMVA 2HMSA 3WIEA 1GZ4A 4FBGA 4YWJA 5CDUA 2HCTA 3HSKA 4CM8A 3ZHYA 2GSDA 2HMWA 5ILGA 1JVBA 4EUEA 2ZCUA 4Q39A 3RUEA 4PZEA 4R1UA 4M55A 4AJOA 1NQOA 3L4BA 3QP9A 1JLLA 3GF4A 2BELA 1GFSA 2D4AA 4MP6A 4BMNA 3RJ9A 3AUSA 3OIGA 3W8FA 2VHYA 3AOGA 4Q3AA 5CPBA 1C14A 3RQSA 4RPGA 1EMDA 4ITUA 2OP1A 4AJPA 1XR3A 3PVZA 3FNFA 2HUNA 2RCYA 3PHLA 4B4VA 4DMLA 5AYVA 4YCAA 1LI4A 4YYZA 4FR5A 4AJ1A 3NTOA 1JKJA 4WKGA 1QYXA 1UZMA 2CFCA 1RYEA 2X9NA 3L0DA 4WLEA 4BGIA 1SEVA 1P9LA 3INRA 3WIDA 3DXFA 3VTFA 2UUOA 1TT5B 4IXWA 3VKVA 3JV7A 2A35A 2CY0A 4Z0HO 1ISJA 3EY4A 3SVTA 3SLKA 1DRWA 2C54A 1EE2A 3K31A 2DTDA 2AA3A 1KERA 3BTSA 4RL6A 1DLJA 2IEDA 1MC4A 3W4JA 3QVXA 4ZICA 3W8EA 4LSMA 3WQRA 5EMHA 1ZMOA 2NTJA 4FJ2A 2O2SA 1KEPA 1I8TA 4M54A 2B83A 4DBZA 1XLTA 3WBBA 4P38A 1DC5A 4LMPA 1AGNA 3U49A 4A2CA 2IYPA 1ZEJA 4FOOA 4FFOA 4MP3A 2W2KB 1DIBA 4R5MA 3U5TA 2TMGA 4W6ZA 4W9NC 4BNTA 2BKAA 1HDOA 3JQCA 4BKPA 1TLTA 4TMFA 4J0FA 2HJSA 3GHYA 4P8RA 4W7IA 4C7KA 3H9EO 1D8AA 2Q1WA 5IAAA 1IULA 2GR9A 4J1QA 5JCXA 2DLDA 4ZRMA 2YFQA 4TRJA 5DP1A 5JY1A 2H5LA 4BO5A 1EUCA 3ZNNA 1JWAB 4NR0A 4XEHA 3DFUA 1HE4A 1Y8RB 1GDHA 2O3RA 3GC6A 1P45A 1G6KA 1YL5A 2EHDA 2VHWA 1U9JA 4RPLA 4Z3DA 2PZKA 3WJAA 3PZRA 4FOSA 4IDAA 5U4QA 2DU8A 1TVEA 1NM5A 2ZYDA 3F1LA 4XGKA 2C5AA 4CLRB 2WM3A 3QWAA 3PGJA 5I9LA 3NT4A 4PVDA 1YB4A 4BMSA 4K26A 4WLVA 3WGYA 4R1TA 3BMCB 2VT3A 5CEFA 2GZ1A 4B3JA 1U3UA 2BFMA 4KZPA 3O38A 1P1HA 4J4HA 1Y6JA 1E7QA 1E6UA 1U3WA 1FDUA 3FPCA 4INAA 1C3VA 2Y1DA 1W4ZA 4QO8A 2QYTA 2SCUA 4XDZA 2VWGA 5IFLA 1Q0HA 5TNXA 3H2SA 1P1IA 1CWUA 3B20A 1PQUA 3FPLA 2VZ0A 3F4LA 4FFMA 1B8VA 1V3UA 2DBVO 3WLFA 1GAEO 1HDCA 2QG4A 4GI2A 5TS3A 2X5OA 3FD8A 4IDGA 1KVTA 3PWZA 3I3OA 3E9NA 1Y81A 3TPCA 1QRRA 3SEFA 1DHRA 3I9JA 1JTVA 4BQRA 4TZKA 2VRCA 3PHHA 2J5QA 2O3QA 4XR4A 3OQBA 3LVFO 1I32A 1J4AA 2LDBA 3D7LA 4P4LA 5TSDA 4O63O 3JYLA 4OJNA 1WZEA 4NZ9A 1KC3A 3ANMA 2HO5A 2DQ4A 2UDPA 4B7XA 2JHGA 1WXDA 4MKZA 5F1KA 1E7MA 4FQ8A 2W2KA 4B8ZA 2ZQZA 4I5FA 3D1LA 4TQGA 5EIOA 1T2FA 1GV0A 3ABIA 2O4UX 3HWRA 1PGQA 2W2LA 4RF3A 4Q3DA 1UZNA 3OFSA 5TT0A 5IZ4A 3Q1LA 1U4OA 5KJFA 5COBA 2QYSA 3K73O 1YWGO 4AG3A 4L73A 4ND4A 1VSVA 2IEBA 1Y1PA 5MDHA 1PWZA 4NJMB 1DLIA 3RASA 3I23A 3VVCA 1PZHA 3BA1A 2W2LD 4II2A 4CM9A 5KOIA 4LK3A 2GO1A 1JAYA 3U4HA 1B3RA 1E77A 2OHXA 4TVBA 2F00A 1NXQA 1Y8QB 5C5IA 1KC1A 2V65A 2NQTA 1AN9A 1DXYA 1UP4A 3K2BA 4AJHA 4GMGA 3WR5A 3KHUA 2IZ1A 1LDEA 4I8XA 4HFMA 2P4HX 2R00C 4YT2A 3T4XA 1R0LA 2G1UA 4HKTA 1U7TA 5IDXA 2O3TA 3UAGA 4HV4A 3RWBA 1O5IA 5JC1A 4JBHA 3V2UA 4A27A 4CV0A 1Q1NA 2Q4BA 2Q3EA 3RU9A 1AE1A 4WNIA 2NTNA 4M49A 3LK7A 4PG7A 1A5ZA 3Q0EA 3PTZA 1Y5RA 1KYQA 2YV2A 4MKXA 3TNLA 5I7VA 3KUXA 2Q2VA 3V8BA 3LZ6A 3B1JA 3H6KA 5BSHA 3GVXA 2I65A 1OMOA 2A4KA 4R4JA 1UXHA 2PR2A 3WS7A 3LLSA 4J2OA 3C8MA 2WYVA 4XQGA 1EFLA 4X54A 5IDQA 5FFFA 5HWSA 5J23A 3GPIA 1V3VA 4PLFA 4CMKA 2DTEA 1DB3A 3CZRA 5AXAA 2DBRA 1W6UA 3F6YA 1MV8A 4ND1A 2YYYA 3CUKA 1XYGA 5GMOA 3M1AA 2EW8A 3NRCA 3U3XA 3KLPX 4LW8A 1LDYA 1WAMA 3AU9A 4G2NA 4BNIA 4R54A 3LC2O 1Q0LA 4YRAA 3K30A 1A4UA 4BNGA 1GPJA 1UAGA 1E3LA 1EFKA 4K28A 1IUKA 3KM0A 3FWNA 1C1XA 5A02A 3KYBA 5DOVA 3R1IA 4CL8A 1KOLA 5EPOA 2QZ9A 3MOIA 3IL2A 4OQYA 1K2WA 1K0UA 1UUFA 2C7GA 4CV2A 4JP2A 3OQ1A 4HP8A 4EJMA 1SAYA 4D7AA 4H3VA 3IKVA 1V35A 2WMDA 3AU8A 1A71A 1M2WA 5DCUA 4W99A 4JN6B 1EEHA 3OH8A 5GY7A 4DA9A 3OEWA 1ID1A 3EGOA 3K8ZA 5B4VA 3WMWA 4GX2A 3DAGA 4MIEA 3QRWA 4J90A 1LQUA 1E3SA 2WD8A 3HN2A 9LDBA 4NBRA 3MWDB 5ICMA 1PJSA 2HMUA 4DPLA 1FMCA 1KVQA 2Q1UA 2DFDA 3HDJA 4WK6A 1YE3A 3ZWPA 4YAEA 1NAHA 5JFOA 1BXGB 2I67A 4WEQA 1R4MA 2ZB7A 1BXZA 1RYDA 1NQTA 4TKLA 4XQ9A 6LDHA 1H5QA 3QLJA 1MP0A 2NTVA 3E48A 3CEAA 1ENZA 3ETGA 1YVEI 4MINA 1XU7A 1GUYA 1OC4A 4OKIA 3AY6A 4DIFA 4BGUA 4PG4A 1ZSYA 4DYDA 5G0UA 1Z75A 1YXMA 5CDSA 1HLDA 3RI3A 2O48X 4IDFA 3U4CA 3UFXA 3TL2A 4CMJA 3OSUA 1E5QA 1N7HA 1SC6A 4IGEA 2YV1A 4I9HA 1OOEA 3R3SA 3OIFA 4GX5A 3ZNOA 1GV1A 4U0JA 1HDGO 4PVCA 4RDHA 4IDDA 4Z6KA 4TRRA 4CM1A 2EW2A 3GNTA 3LT2A 2GZ2A 2WDZA 4Y9DA 4CODB 1E6EA 1PJ3A 4O0LA 5DP2A 3KO8A 4MVJE 1LLUA 2HKIA 4XWYA 1ZKMA 1OAAA 1V0JA 5L4SA 4BKRA 2YY7A 2VNAA 1RKXA 2ZTUA 5CDTA 1PEDA 1LDGA 3OJFA 5TJ9A 1E3JA 1WP4A 1A7AA 5DN9A 2BGMA 3V2GA 4W4TA 1E3WB 5ER6A 3OP4A 1OZAA 3DC2A 4QSMA 1SMKA 4ND2A 4Z9XA 2R00A 4FFLA 2R6JA 4QECA 3CZMA 2B4RO 1WMAA 4M87A 4E21A 1B26A 4D41A 3TQHA 2OZPA 1CEQA 2BI7A 5THQA 2QRLA 1QP8A 3GEGA 3AJRA 1YJ8A 3SBOA 1SZJG 1LC3A 4GL4A 3S2GA 1X13A 2OP0A 3EW7A 1HKUA 4BB5A 1EVJA 3I9MA 1ENYA 1JN0A 3I1JA 1T4DA 3ADOA 3IQDB 3WWZA 2DPHA 4KTTE 1HDZA 5KJ6A 4FSHA 3PJFA 1ZK0A 1RM5A 4GAEA 2JFHA 5T8KA 3PP8A 4FGWA 1YONA 2VUUA 1QYVA 1PGJA 2J3HA 1SCUA 5KKCA 3W6ZA 1ML3A 2IZZA 3ASVA 3RUHA 1X1TA 2C82A 4CM8B 2V6GA 2Z95A 1LTHR 4DPKA 4CM4A 4UVDA 1IL0A 3M1LA 1T1RA 2J3JA 4J91A 2EGGA 3JYPA 4NI5A 3TSCA 4QEDA 4XJTA 3GAZA 3H5AA 1YGYA 3GFGA 1KY4A 4HFJA 2PKQP 4IZIA 1IZ9A 4Q3EA 4YTEA 3H3FA 4P22A 5DBGA 3E1KA 4DL9A 5T6BA 1NPYA 2ZJ0A 1U7HA 4E5KA 3TZCA 1ULUA 4PIVA 3JQ7B 3PHGA 3AW9A 3HNPA 4L4XA 1DAOA 1CQIA 3BHMA 2OMEA 3V1TC 3VZRA 1A72A 4Y6SA 2OXIA 1Z6ZA 2ILTA 3S1LA 8ADHA 3OEYA 1CIVA 1ONPA 5JAQA 4E0BA 2NACA 2CSUA 3K92A 3UN1A 2IYOA 1R0KA 3HB4X 4WECA 1LA2A 5KJCA 3R0IA 3FRJA 2VQ3A 5BR7A 4H15A 3KYDB 1E6WA 3KSZO 1VRWA 4CLXA 1N9GB 2P5YA 3CIFA 4YJHA 1O8CA 2GRAA 3JQ8B 3ADPA 3JYNA 4L9RA 4Y6PA 1P44A 4QTZA 1JKFA 2NSDA 3K96A 4A73A 3E9MA 2AE1A 3FN4A 3NGLA 1NASA 5GZ6A 3EVNA 1UP6A 1J0XO 1Z7EA 5JDIC 3LF1A 1DDOA 5KWEA 4B4WA 4E5NA 3V5NA 1NFRA 3PEFA 4PLWA 1NQAO 3CPSA 2X0JA 4GLOA 1MFZA 1RPNA 1B3BA 1I33A 2FSSA 1FK8A 4E5PA 1NHWA 8LDHA 1LSSA 4EEXA 3KTDA 5JYDA 1E7RA 1F14A 1VKOA 3RUCA 3L9XA 1EBFA 5JLAA 5CDYA 3NT5A 1M6WA 1VJTA 3GUCA 3ITDA 5F1OA 2I5PO 3GH3A 3W1VA 2DPGA 4YACA 4BO8A 4L4RA 1O0SA 3Q9NA 1BG6A 1DFIA 1QMGA 4U5QA 3ZHZA 2HDHA 1UXJA 1P33A 4OO3A 4R9SA 3LT4A 2DVMA 3QIVA 4EJ6A 1ADFA 2HMTA 4KMSA 5IG2A 5K6AA 4TWRA 4PLTA 2VYVA 1SBYA 4R5HA
chains in the Genus database with same CATH superfamily
1GQYA 1N92A 2H54A 3IB3A 4MWZA 5E9WA 5I9BA 4ZYVA 4S1NA 3I73A 4EB6A 3DKKA 3F7MA 3UUEA 4B44A 3EXFA 4EDFA 2H7XA 3IMKA 2VSNA 4OJYA 4NAHA 1HNZB 1D4FA 1MQ9A 1Q1ZA 2REXB 4IZOA 5CIYA 2GJSA 1HO3A 2R65A 3NM6B 4H7EA 4QAJA 4N5LA 4NE9A 4ZPJA 3RTDA 3FIUA 1QP0A 3BAZA 4UD2A 1PFGA 2FJPA 3PLRA 4MV7A 5SZHB 5JISA 1QKJA 5TLSA 1G9SA 4HI0E 4BJ3A 1R8JA 2WFMA 1KI8A 2PRYA 2ZQYA 4Q4AA 4O4LA 2JF0A 4OV6B 4LX0A 3TRJA 5FWYA 5M5BA 4HYYA 1RZRD 2ZB4A 1YFKA 1IYZA 4F2HA 4XIGS 1QWOA 3FKSD 4KBGA 1RC8A 2HIHA 1B74A 2Y0CA 3CEJA 4X3OA 4XYBA 5KYXB 3UV6A 2VH5R 1HWYA 1GCIA 2WG1A 4CEIB 4IDHA 4IIJF 3BQMB 4E5YA 1XZIA 3UICA 3K72B 5ALJA 3V97A 4C5BA 4MRMA 2VH2A 2O7RA 1OH8A 1A82A 1QV7A 3QKSB 1Z4MA 5LBIA 2OR3A 1ZD9A 2V0CA 4Z2AA 3WICA 5JZSA 3GCWA 2VLIA 3FKSA 1SHTX 5H82A 3EDMA 2P35A 4W1QA 2WTNA 3L01A 4IJUA 1ORVA 2HK9A 5A5VA 3DMDA 2PAFA 5HA5A 2PL9A 1GA4A 4Y7CA 1U7UA 3W78A 3FR7A 2NUPB 1FXSA 1Z33A 3QTTA 4DZRA 1ZUHA 1N1EA 1LTKA 2WEKA 3MT0A 4LAFA 2QTHA 1NU8A 1V1MA 2OENG 4QTYA 2J3QA 1UDAA 3UF0A 1XRJA 1XMXA 5FUVA 5I4CA 1GDDA 1BHQ1 3PQ5A 3VDXA 1HNNA 1CR2A 1N2ZA 2QTLA 3COZA 3OIDA 4NPCA 5HOEA 1MAHA 5AHOA 3I4LA 3ZZMA 3AUTA 3S2SA 4XGIA 4QASA 3GVHA 4ND3A 1CQPA 1PLJA 1KFCB 2BSAA 3DMGA 4YGYA 3NUQA 4UMVA 3AESB 3T9BA 5KC9A 1OZHA 1RACA 2ECPA 2ERXA 5JH7B 4H0CA 2A9FA 1AF7A 1Z5UA 1VFNA 2HJVA 1DC3A 4BFZA 3DXXA 4QFBA 2CDAA 5KHAA 2PIDA 3FPAA 3N7UA 5AW5A 1PT5A 2QU7A 4KQGA 4DR6B 4YAJA 4UM9B 1WHSA 4ARAA 1V6CA 4JI2B 1GM5A 1DXHA 3IODA 4GLFA 3K9QO 1QBGA 3RWOA 4LE2A 2A1TS 2NSHA 2POCA 3QW2A 4UEJA 1MJHA 1ADBA 4MDYA 3D4PA 2R87A 4AP6A 2VZ9A 3LRXA 3LX4A 3MD9A 5C5DA 2UU9B 3BE6A 1BSVA 1U5CA 4DRXB 4ZGWA 4RENA 4OFZA 3RBAA 2VRBA 4IUCS 1KK3A 3CN7A 5GM2A 3RHSA 1FUKA 4DLAA 1PU2A 3KR0A 2JFFA 4WKOA 1PGNA 4YP7A 1NBOA 3T7TA 1R4NA 1EFPA 2GKSA 4PANA 3WIUA 1ISSA 2LZ0A 1NATA 3PC7A 2OMKA 1K27A 2IZ0A 2L69A 3W5UA 4UMDA 1DBWA 1XZKA 2PL3A 2R1UA 4WLNA 5BYBA 4DFDA 1XZLA 2NQ8A 4PINA 4G01B 3DPSA 4A10A 4MRMB 3GRAA 4EVSA 1JDSA 3OURA 4PV7A 4WOCA 2GXQA 4ONEA 1H1LA 3I30X 4X8OA 2VOJA 3PBKA 1KVSA 5TV2A 3F3SA 3I2HA 2XUKA 3D4OA 2EIHA 4RVUA 1PF7E 5AJHA 3RHFA 5G0WA 3VX4A 4QYWA 4A1FA 3ENZA 3R24A 1W0KA 4YASA 3O4IA 5DNAA 5JAPA 2WVHA 5JQGF 1AB5A 1KEVA 2O8DB 1OPRA 1ZUIA 2B9EA 5JNLA 4U02A 2CLCX 3P4XA 1NY5A 2YH2A 4UNQA 4EMUA 1ZRHA 3GZNB 3DOEA 3IUBA 3QF4B 5CFQA 5IF9A 3EOBI 2JVIA 4GD3Q 2BFEA 3AZQA 5K6AC 5KTPA 1JPJA 1D3AA 4A26A 5SY9A 5CGQB 1GD1O 1MQAA 5HKOA 3GZ4A 4NRDA 4BLQA 5F76A 1FSSA 4GIBA 1DSSG 1Z63A 1UBSB 5SYAA 3V4VB 3F7NA 2ZOSA 2HA4A 4D8YA 3Q9UA 3C2QA 3ZIDA 3PGA1 4PC6A 4D97A 5AOAA 1RKUA 5KQGA 5K0TA 1GU7A 4FLEA 2FPPA 3DHEA 3VAAA 3FLEA 4J0DA 1N2JA 4PCUA 4R98A 1L7AA 4QO7A 4CUZA 5IVKA 4Z9BA 5IMSA 4JKOA 4F1JA 2XWPA 5F51A 2HA6A 4DVGA 4I19A 1TXGA 4XCXA 5JMTA 5AMXA 3JWEA 3RIEA 3UHFA 3CX3A 3DFMA 4LZJA 4N5DA 3SC6A 4C0XA 2JKVA 5K5EA 4RXTA 1Y7TA 1P9RA 3D8TA 4HRAA 3Q5DA 2MT9A 3CMMA 3ENWA 4HDRA 2WQ7A 2W4QA 1EQUA 3I8OA 3P27A 4LWOA 5DF1A 2Z1DA 4JQOA 3GMDA 1EBUA 3T3NA 2GA9A 4HLUA 5CXSA 1ZGBA 3RKSA 5LC1A 1C3JA 1K6IA 4UU7A 4BMYA 1C0KA 1HYHA 1DC6A 3VI4B 4ENRA 3GLIA 2GJ8A 5G4LA 3H4VA 4JDUA 1SH7A 1IDN1 1D6NA 1TEXA 3DVAA 4NMLA 4IGFA 4X45A 5E2IA 3NQ41 5IULC 1H0RA 3I6IA 3BWVA 3JWPA 2EGHA 3GGSA 3PC6A 5KQPA 3T0FA 2UXDB 1H22A 3ZU3A 4ZQCB 2JAPA 1QH0A 2BISA 3BXFA 3PI7A 2O52A 4JLWA 5HP4A 1FVFA 1VE9A 1M34A 2QUZA 3HHPA 1KNXA 1ZR2A 4FOTA 4ML3A 4B2YA 3KTAB 1NQ5A 4D43A 2X42A 1KIFA 5HIIA 5T64A 4JVOA 4ZC1A 3HCDA 1XHEA 4JCCA 3G1UA 3K2IA 3SXJA 3HQ4O 5LJIA 3NVAA 2F1JA 2KQUA 4I4IA 3WGUA 3DYVA 3FNRA 5H9VA 4A8JB 5AXBA 4BRWA 1IHPA 3DZFA 2HJHA 4NXNB 1NLFA 2ZJ2A 5B36A 3IEXA 5JVDB 3MSCA 3G0DA 3A4TA 4PHTA 4I9FA 4C4AA 5L6LB 3BGIA 4JR0A 4Q7KA 4RH3A 5FUYA 4DMHA 4ZGGA 2GWRA 4KIWA 1YDHA 3FI9A 3UVEA 1CETA 3TSWA 1QTIA 3S28A 1AHPA 3BL6A 4F7WA 3QY9A 3PUZA 4ENQA 4GNRA 5EG5A 4W1SA 4C22A 4D98A 5A03A 2OBYA 2GK3A 1C7FA 1T0UA 2XYVA 1TW2A 5EIAA 2DY1A 1SK8A 1K6EA 3EZXA 4X1IB 1IM5A 1HEUA 3CB4A 1O2DA 3UMJA 3LO5A 1HL3A 1XN4A 1D1PA 5LUBA 4HNTA 5ISMA 1W34A 4F60A 3TIFA 2ONJA 4LDNA 3VKUA 4BV8A 4CKBA 2Y1FA 3NV7A 4MB6A 4AF7A 4QUHA 3W06A 2E49A 3VHLB 3KXPA 2DBQA 3KYIB 4MOWA 2PYDA 1A9RA 2ATXA 2QF7A 2D7CA 1I7DA 5AK5A 1CUWA 1XNHA 4ITRC 5HF5A 2ID7A 3DTTA 3BZWA 4NVRA 4S1OA 5LQSA 3FHTA 4RFSA 2GD1O 2J4FA 1VIVA 3EWSA 4AO6A 2WWVD 4EECA 5AI9A 2VF2A 1JG1A 3V4RA 4KU4A 1P4JA 3C5HA 3G9QA 1XJWA 3MOGA 2OORC 3IPCA 3P2JA 4YDSA 1SU7A 4EZBA 4DUGA 2EXXA 1G64A 3EXHA 4ZIRB 5H4GA 4G23A 4R31A 3QMMA 4R2JA 5DT9A 3LPDA 2JJQA 1U8AA 2G0TA 3PDUA 3B6KA 4GMFA 4GGOA 1SUIA 2F1KA 4O2AA 3LVBA 4RAQA 4FMCF 3CZPA 2TS1A 5ENVA 2XB2A 1GCUA 1E1RA 2OGZA 5EE5B 4CQLB 4Z4QA 5A9SA 4D8TA 1CUZA 3K3PA 5B57C 3HDTA 3IGFA 4UEWA 5E7QA 4QA9A 5AI0A 3FYHA 4CKEA 1XLWA 3BMOA 1MAAA 3LUBA 4QFDA 4RXMA 4WFIA 3IPXA 2LV8A 5CLJA 4HN2A 5L53A 4WKPA 1MJFA 3LM8A 5HJ2A 5EXEA 4BFLA 1RYMA 2POQX 2R5FA 3GEEA 1O95A 3O73A 3Q11A 4OIFA 4ZU3A 1XDUA 2EL9A 1YNOA 2XADA 4ND7A 3QMPA 3N28A 5DHFA 2H7VA 2R44A 3VPCA 3W05A 3WWOA 2BTEA 3OAAD 3PQ8A 5JCOA 3HY3A 1EA5A 3PPWA 1G18A 3L4SO 1LJUA 4PG5A 2C1XA 2XWJI 3TSAA 4AMBA 1JDBB 1D0SA 1WIWA 1T26A 2CXTA 3SQXA 1CRLA 2VWPA 3GFSA 4KQXA 2OZKA 1RAAA 2IBTA 2VWHA 4AZ0B 2AOTB 1T0HB 3I39X 3BJZA 1JLKA 2DJIA 3AQ4A 4G0QA 4HWOA 1C7IA 1DJQA 5LZ2A 2ZRPA 1K08A 3VTAA 4BVHA 1H93A 1M9NA 3C7KA 5BNIA 3KEQA 1BMQA 4G4SO 1U4NA 2AHOA 5WRFA 5HZKA 1NUSA 5KIAA 2PZLA 3N2KB 1BDBA 4R16A 4RF4A 3IOMA 2ZRJA 5BVGA 3QE0A 2Z58A 3FZNA 3FH0A 2C77A 4D6PA 4QE3A 4V3CA 2PJRA 2MINA 2XQJA 3QPVA 3JU3A 1ULZA 4N9WA 3EXIB 2YJGA 1HDEA 3MTJA 3G49A 3VDRA 5G02A 2WJYA 3BPSA 3CKKA 4E11A 2Q27A 2VPIA 3GY0A 5FWNA 2YOGA 1WW3A 4JEMA 1G291 2I1LA 5LFAA 3UYKA 2W48A 3H9QA 2PQMA 4MVJF 1YCDA 4AULA 4XFJA 2P91A 1LPPA 5I9SA 4D9IA 2YICA 3H2YA 4OKNA 1T9AA 4GPAA 3X2FA 4ZYTA 5K0NA 4UU0A 4ERNA 1WBDA 4FFVA 4EKDA 1BHJA 2G83A 2XTMA 1W29A 3LD9A 4NBWA 2VPTA 1JEOA 2R7KA 5BN3B 5K01A 2O3UA 4BNJA 3BB1A 3KKPA 4K6HA 3WB0A 4IJWA 1GU1A 1RXEA 2I4MA 3VYUB 4NEGA 1RXSA 2D6FA 3NO4A 5JAHA 2HL6A 1WDLA 1OX4B 2GEVA 1EGQA 2Q21A 4CNBA 4FGUA 3REFA 3ISVA 2JG3A 5L3RA 1H2ZA 2Q8NA 4UM5A 1LPOA 5I3CA 2QS9A 3NHLA 4RF5A 2NADA 3ECSA 2H06A 2PA3A 4YVFA 5JD3A 2W2NA 4DR1B 5EP2A 5IAEA 1X7ZA 2NUBA 3DO6A 2WVJA 1TKBA 4Q9AA 5AI5A 2ZRCA 4DUZB 1CUJA 3KQYA 1Q50A 1WDWB 4ARCA 3P4UA 4TKVB 2XF2A 3NXKA 4KJZA 1N9GA 4NBUA 5LDGA 1UJBA 2VCYA 4E2YA 2VJYA 3I6MA 2J41A 4TWAA 3LPAA 5L45A 1IHDA 1JPUA 1NUPA 2QD2A 1G3RA 6REQA 2WJAA 4UQPA 3IQFA 2YY5A 4GL2A 4N5HX 4JAVC 4DB4A 1J25A 4IOJA 5BYKA 4J0HA 4L8WB 1II8A 2AS0A 5CT9A 4IXMA 2C9BA 4CG2A 5HKBA 4N54A 3SS9X 4JLKA 3K09A 1SUBA 1SEPA 3GFVA 1E1CA 1ZW6A 2Q50A 5DHUA 2EX1A 2PMWB 4W5QA 3K6SB 16PKA 2PA0A 4TTIA 5JUWA 4U4AA 3GXOA 1LQTA 4FYPA 4JI8B 3DBHB 3LLCA 2C4WA 2DWPA 3KC2A 3SM9A 2Q2QA 3U56A 4GKVA 3G2PA 3JTEA 3DV0A 2RGAA 4LXTA 1KI6A 2FG5A 3DQPA 1J8YF 1YK0A 4A5OA 4J4BA 3PLNA 2QYHA 1NJ2A 2JFYA 2XOEA 3HA7A 4AJ4A 3BDIA 5JCPA 1N0UA 4YB8A 5B7PA 1PR4A 1TGYA 2AG5A 3BC1A 3D0OA 3C4QA 5EL0A 3ROXA 4QQKA 4ZJYA 4HH4A 4YI5A 3UH0A 4E4YA 3GJ6A 1Z6XA 2JA1A 2E4AA 2J46A 5DXAA 4K6CA 3EDCA 3PYLA 3BFKA 3K9CA 1AKNA 2Q28A 2YQZA 4MQ6A 5GPBA 5A7HA 5JI3E 3KALA 2OHOA 2QE6A 4LTMA 1DQPA 2AOTA 4I14A 2QMEA 4U2DA 4B6PA 1XCGB 5CM8B 4I4TB 3VU9A 3ZU2A 4LHXA 4B84A 4BKMA 1F1JA 2X0IA 2C5BA 2O7VA 3G2OA 4BFYA 1SC4A 2IV3A 4EUKA 5JJCA 1Y3FE 2W6QA 2YNMC 4CM5A 1NBHA 1T6XA 1AKTA 2WHPB 2VQEB 1SGWA 1ODLA 3O8OB 4FYXA 3PUHA 4RVCA 4TV8F 4YQZA 2B94A 2HBRA 3AJDA 3RT1A 3TD9A 4YJGB 1P60A 2J30A 4Y1EA 1OFUX 1K66A 2NPFA 5KZMB 4X66B 4OBEA 1GL7A 1E1MA 1YZGA 3ORFA 3IV7A 2XH8A 2BMDA 2Q3HA 4PAQA 1FNNA 4YALA 4JC0A 3QFCA 4YHBA 4OXQA 4KR9A 5GJWC 4ALMA 2H1OA 3GPLA 1XXLA 2Z8XA 3KD3A 2DWQA 2WOOA 1KMIY 2YRFA 4M0KA 1KJIA 3CJRA 1AQYA 3P2MA 5LU9A 1H66A 4ER7A 3O26A 1H2YA 2IODA 2W2XA 4PWYA 5IJZA 1VDMA 1IY0A 1TQ2A 4OJMX 5ALWA 1XTJA 4AYWA 4DEVA 4DAOA 5CAEA 2XA2A 4KVGA 2B9VA 3GRZA 2VXOA 3ANNA 3G23A 3TMAA 4BFTA 4CFSA 2QJWA 4HDKA 4J94A 2J1LA 1L5WA 1OXSC 5K03A 3WNDA 2JH3A 3H1GA 3ICOA 4N82A 4NKRA 3RRFA 2OCLA 4CYMA 2YV4A 1KI3A 1QCYA 1YDWA 4YP9A 1V47A 5A4KA 3GA0A 3EOAI 1JVNA 2QUAA 4L9SA 1M6VA 3C8HA 3FX2A 5FQNA 4MQEA 2FOIA 4C07A 2VDOB 4IJ5A 4D02A 1Z13A 2OFWA 3KXLA 3OJ0A 3A6JA 1RJDA 4DJJA 1FF9A 1TZMA 2FUG1 4J7CA 3T7KA 3QFRA 4PSVA 4H4DA 4X97A 3K4PA 4PYOA 5K0JA 3B1FA 3SXUA 4UUQA 2I2XB 1VGQA 2JGEA 5ARDA 4Y67A 4Q9NA 1NRJB 2Z98A 2HH9A 2CCJA 2KHZA 4RNDB 4ME6A 3HYLA 1J49A 5HXAA 3JZDA 5DM2A 2IYZA 3UFXB 1CS4C 1T6YA 3B12A 2CF6A 3A32A 4TM7A 4UE2A 3SYLA 3TLZA 3UK0A 5LYYA 2CUKA 4N3GA 5TQVA 5JS8A 3T5MA 2B35A 1Y9AA 5TMBA 2HA5A 3QWIA 2VAPA 1TJYA 4DANA 4B48A 3THXA 2QQ5A 5DTJA 1UT8A 2IFTA 3CWQA 4F45A 4KR7A 3HSYA 2R6ZA 4U7TB 2DHCA 2RGDA 3OPMA 3MBKA 5AHKA 1XEAA 1P91A 1W5AA 1FCJA 2FHSA 1XPJA 2FP4A 2VDUE 4DYHA 1Z7GA 5JCJD 2AH5A 3K09C 2J0SA 1H2EA 5B1IA 3RVDA 4BNZA 1YRBA 5HYVA 1HXHA 3B48A 3DOHA 4OP1A 4Y2SA 1W5FA 4C06A 2IYQA 2BIFA 2VN8A 1L7PA 2YWGA 4GQIA 3IP3A 1S2DA 1EDZA 3CX6A 1C3XA 1U1FA 2QGZA 1KAOA 4FJ0A 4B73A 3NXSA 4ZZ3A 4QRIA 1GRNA 1GCOA 3KJIA 4RTRA 2HT6A 1LEHA 3CA8A 4HJXA 3N2LA 3ZDXB 5BW8A 2Y71A 2CVOA 3V4OA 3FFXA 2UYHA 2B0JA 4JQYA 5FV7A 1VQ1A 1FIUA 1M2HA 1YBMA 3ISJA 3GEHA 2I80A 3AYZB 4FXOA 1OGYA 1OV6A 1SIBE 1V8ZA 2PH3A 3BZUA 5G4KB 5BRAA 4RMGA 2V3CC 1JR4A 1P4SA 3HYSA 3CQ9A 2ZRIA 3KKKA 4AMYA 1OBHA 4X7BA 3I9KA 4JL8A 1RHRA 1N3BA 1B73A 1S5PA 1KR5A 2YWJA 1FYFA 3F9CA 3O95A 1L8XA 4Y18A 4U9UA 4ZQIA 5EP4A 5LA6B 5LUAA 1GQFA 1VKHA 1OA1A 1NMEA 2YDXA 4AWAA 4AZ3A 1CVLA 1U8EA 4I5GA 1LQ2A 4M6WA 3NHJA 2DQSA 4JVSB 4N5IX 4CMEC 4R8KA 3RQIA 2FMKA 3N75A 1WB4A 2NU7B 2EYUA 4BCDA 3VPHA 3QQPA 4CQLA 3SOPA 2C07A 2AMFA 3D6NB 5T67A 1WXXA 4E5VA 1P2GA 1SWVA 3N2IA 2QY6A 1DO0A 1QIEA 4K40A 4MW5A 2DC1A 2JGJA 3A7DA 4LVNA 5DHRA 1HYGA 1LSUA 2X19A 3Q7RA 4X20B 5EPUA 1OD6A 2Y1WA 1SQ6A 1W8DA 2R96A 4O25A 2YHSA 3O8LA 3KS9A 1V6AA 3FDZA 1E2FA 1G8AA 1JJVA 1KQPA 2ZAGA 3H84A 4TVKA 3ZBQA 4KV9A 4EY7A 5KSYA 1C29B 2PM8A 4NENB 4AZSA 4F5EA 4KTVE 1RXCA 3GLIE 1LJLA 3DBRB 4G9BA 4YRBA 2EF1A 3MCUA 1WV1A 3AUJB 3BTVA 4HDSB 4JU9A 1MV5A 4PR3A 1M76A 1O57A 2HLDA 3F47A 1VYUA 3KYCA 3PK0A 4ZOLA 1KZHA 4CF5A 4DR2B 5HBRA 2CT8A 2Z6UA 2EU8A 2G8NA 3A1EA 4ZCMA 1LNQA 5TMDA 3VDNB 1T8SA 2V7WA 1RXYA 4KSYA 2YYAA 1QG4A 3LAWA 5CP8A 3HZHA 4QDKA 3JS5A 2FPMA 5EMKA 3MTQA 3NETA 1H1LB 2VKTA 1HYEA 3DZDA 4LK2A 4HX9A 5A9SB 5D6NA 1KVRA 3NHPA 1LNZA 1T4BA 2JRLA 4QXPA 3R7SA 2VEDA 2WWXA 1PK7A 2VJMB 5IDVA 4O2AB 3U37A 3HS3A 1WOYA 4A0RA 3ZCVA 1M8GA 4KQWA 2AYZA 3I1IA 4JP1A 4ZIRA 4PRLA 3KE8A 5I9LA 4Y2GA 1THZA 4H2DA 4OHCA 5JXWA 1Y6RA 2RBGA 2GASA 1M7BA 1Q19A 4RNCA 5DGCA 1DAPA 1QX4A 1S1MA 4PM4A 4MYHA 4LXXA 1EUQA 1F7UA 3AESA 3C3AA 4MP8A 3GGOA 4PYRA 4BUJA 4DWWA 1O54A 2I3GA 1R0BA 4NBKA 3NIBA 4FZRA 2PGIA 4ZEXA 3ST7A 4DLSA 4Z53A 3LPCA 4YMUA 3I0MA 2J6CA 5U4XA 5CNIA 2BFDB 1T9GR 2IEZA 5GAJA 1JLSA 1WX1A 4E1BA 2DLCX 4ZKEA 1LB1B 1QAQA 2CZQA 2YHIA 5AW7A 3I34X 4I1UA 5EVCA 1WY7A 3PITA 1M74A 1VA5A 1ZL2A 4Y2TA 3WIVA 1C7JA 1U0JA 4HO1X 1ILWA 1YOVB 5GQSA 2IEGA 2RFLA 3IEMA 3N6VA 1CDEA 4TV8B 1WM1A 3FUTA 3O8CA 1QB7A 4NCJA 1KO4A 3UGTA 5KQLA 3VC7A 2PUAA 3A37A 3DMPA 5LDHA 2I03A 3KU4A 1BRTA 1CVRA 1G60A 4HWGA 1U8UA 1A1VA 2C8KA 4IQ8A 3UCFA 4AKSA 4LFBB 2D3TA 1QYIA 3EGWA 1WMDA 1N1GA 5EIEA 3G17A 4JEHA 4OI0A 1W5BA 1W75A 3V42A 4PYLA 1ULSA 4RJJA 3SHFA 1NI4B 1Z7BA 2YJZA 3LDGA 4V0ME 3AFOA 3IDFA 3DUFB 2QNBA 2AT1A 1GTZA 1TJ3A 1B6SA 2Y92A 3BUSA 4GXNA 4LDQA 3CF2A 3K9NA 5JJ5A 4ZHQB 2P4QA 1A9ZA 4L15A 4J0CA 4L27A 4WLOA 4N0DA 1JQKA 3W3AH 5ALHA 4RQTA 2X0FA 4BLRA 4C1NA 5AM3A 3TLBA 2Y66A 2B8TA 3UAZA 3EYWA 4HNSA 2IWHA 1ND6A 1I7QB 2AKEA 3V7YA 2MSWA 2AV6A 1VCHA 5JJKA 2RONA 4FYKA 3IA2A 3TIXB 3COJA 2WWTA 1YZHA 3PWSA 2BFWA 1CNEA 2DPMA 4XWOA 2WYIA 4AYXA 3S27A 4OXIA 4YK7A 4BLOA 1YL7A 4CMIB 1KO7A 2O0KA 2GK7A 3PGXA 1ZCAA 2A0XA 1ODKA 1UXIA 1I6WA 3Q8LA 4MUAA 3DBLA 2CNDA 1E7YA 1M2VB 3EK2A 5THKA 4OYRA 1NVUQ 3TQSA 4C3OB 1UOEA 1T8RA 2IP1A 4RHFA 3BM5A 3KB6A 1JIQA 5CFNA 3GZNA 4KQ2A 1S2IA 2GPAA 3AV0B 2A9JA 2FMTA 1YCHA 2ZULA 2ZVJA 2G8LA 1DIAA 2MTBA 2Q6KA 2VYFA 4QPCA 4E4TA 4HRVA 3DE4X 1F4LA 3TKAA 3MLEA 5J4KA 2BEWB 5AM0A 5FB3A 4V0RA 1F4PA 1T2AA 1RAFA 3GRPA 4GC5A 3ROZA 3ZDCA 1LVUA 2VH1A 3S7TA 4M88A 1RAIA 2ACKA 3GU3A 1M6HA 4UPVA 1SB9A 2H1CA 1ECPA 2BFPA 3DLCA 4J07A 5KYUA 2ZIUB 2C99A 3CUSA 3DWIA 4JLMA 4KK4A 3FCSB 1UM8A 4RPHA 1SXGA 4ZAVA 3W4KA 5HUHA 2UYCA 5DNCA 4OBBA 2IDZA 5FYQA 5TARA 2Q5QA 5KQSA 3NHSA 5HM8A 2NIPA 3GA7A 2DT5A 1TQDA 1UDXA 2GB4A 2WG0A 4NMHA 3V8EA 4NICA 3LQ2A 3BCRA 1OZGA 2C7BA 1CR4A 1YJQA 2VT7A 3EDQA 2LVBA 4DY6A 1LDNA 1LKZA 3BKWA 3OEEA 4JSRA 4MIYA 3SWWA 3GGGA 1E62A 4RXUA 5AK4A 4UEOA 2B8NA 2BTOA 2V4ZA 2JLAA 2X1LA 3GN1A 2XHEA 3G6WA 4MCAA 3RVBA 1N6PA 4ZD6A 1X8LA 3QF4A 1R8YA 2BFDA 3CUUA 3R0JA 3CE6A 3HB7A 1VRCA 4DN6A 2M1ZA 2D1FA 1N3IA 3O9MA 4OFWA 2CEAA 1PKEA 1SKYB 1NUHA 3QKIA 4KREA 2QE7A 2GM5A 4EDHA 3OEED 1Q6ZA 5JMOA 4B34A 1JX6A 3F67A 1WR8A 3DNPA 4DXHA 5KTTA 1CPYA 3QPDA 5BSFA 5LPNA 3L4BC 3NLLA 1O97C 2J9FB 3R9IA 2EZ9A 5HCUA 4G1VA 3FPEA 5EVJA 4C6HA 3KKOA 1MN6A 3K16A 3LHIA 1N33B 3ZJ4A 1V26A 4DQVA 3KQVA 2QE7D 5EYPA 1EPUA 1X9IA 4A6EA 5HJ7A 4IPTA 3H7IA 4MUIA 3QX9A 1TM3E 5LA6F 2MYTA 1PWEA 1XL1A 4NLLA 1W5SA 4G5GA 2A9VA 1S3GA 2H52A 3DVSX 4LFAB 1K8ZB 4EHNA 2BJHA 4QVGA 2RI0A 4W9NA 1X14A 1P5ZB 4QPDA 3WJ7A 4RHCA 1R6TA 1QOQB 2Z4TA 1EYZA 4BX9A 2V7QD 4KN5A 4E14A 1AV7A 4L95C 5A3JA 3YASA 1QV6A 1XELA 1EFHA 3IAFA 3L0IB 2VJQA 3A27A 1C3EA 3IBGA 5AHXA 3UWSA 1BW9A 2FDXA 4GOOD 3UAYA 4EQ6A 1E9CA 4L0QA 1U28A 1XZEA 5FL7D 4I5DA 4XB6B 3K2QA 2ACWA 2NAPA 3VPGA 4KYIB 4D8WA 3KSRA 3UAWA 1QE0A 2IPMA 5DTIA 3PQ7A 1S2LA 4WAUA 3DT9A 3KVRA 3E7FA 1G8MA 3OJOA 3IVGA 1SHLA 4YRKA 1KRWA 4ILEA 3HKDA 4K1LA 4ZEOA 1G55A 3D6TB 1PVVA 2V6BA 2Q1TA 4J9VA 4Q4HA 5BW4A 2J0QA 2SBTA 2O8CA 2XPCA 1J2TA 2WUWE 4J2TA 4CRWB 1KJQA 2QVXX 2GYUA 5JH7F 1FPQA 3WIBA 4W6QA 4TMYA 1H3EA 4TTRA 2RHTA 1H5NA 3G0IA 4KQ6A 1Z18A 2PTGA 2B8JA 2JBHA 4WZAE 1AO3A 4AZ3B 4FW8A 5HIJA 1W87A 2V0GA 4Y6OA 1VSUA 1KJZA 2PH5A 3N53A 3UOAB 3GP8A 1ZOPA 1UC9A 3DBHA 3J81k 3PEUA 4OQLA 3HB5X 3LYLA 4DCVA 1HK7A 4J9UE 1UIRA 3E5RA 2ZI5A 1WULS 3HDGA 3RFXA 4INJA 3WLAA 2I8AA 4BGDA 1UQTA 2NZXA 3U81A 4C4XA 4P1ZA 2P9BA 4P92A 2GZ3A 1YR8A 1ZITA 4LQDA 1YK1A 2NUAA 1JHPA 2O8VA 4PAWA 1XPOA 3ND6A 5BSUA 1JH8A 4RK4A 4DZTA 1X7XB 3IDZA 2EDCA 2ZBEA 3RS8A 3AUFA 3O3MB 1G8KA 3WGQA 4FONA 4YT8A 1ZNQO 5EE9A 1Q7EA 5JSKA 1XQ6A 4Q9IA 1NBMA 1I0IA 1Z37A 3OY2A 1ZMXA 3E81A 4INZA 2NXEA 3TEMA 1Z0AA 1IHOA 1ZMBA 4FBLA 1X77A 2CZCA 3BMQB 3F8WA 4NH4A 2PRIA 2P6OA 3PJEA 3CSSA 4QQ8A 9LDTA 1G7SA 4B43A 3CYFA 4OLJA 1W30A 2V5UA 1BWSA 5J2TA 3DZGA 1D2AA 3KPYA 4GI7A 2XYGA 3DL7A 4AG6A 4QBKA 2CB9A 1NW5A 4ZPXA 5BOSA 5BSEA 2WNHA 5GONA 1QU2A 4NECA 5BQOA 3THXB 5KS2A 5AVKA 3ESDA 4Q9KA 5IEJA 4EJ0A 4HS9A 4DLYA 2H1IA 4MUBA 2WD9A 3DQQA 1DIGA 4QQNA 3ZW7A 3ZZ0A 3M2TA 1E0AA 3JSXA 3ZH2A 1WA5A 1V5FA 1T9DA 1VLLA 1WKBA 2O23A 4FC7A 4JA0A 1ITZA 1KAEA 2FGKA 4GLBA 4YMVA 3STWA 2I3BA 3RK1A 1HOTA 3ESYA 4Y9RA 5L7YA 1NP6A 3WBJA 4N0MA 3DD1A 5EQTA 1JG7A 4M76B 3SIRA 5KYWB 4UUNA 5F3RA 1Y9JA 1U3VA 3IOBA 2GD0A 1NUAA 2ENUA 4KFTA 3JWJA 1UJ4A 1ZUNA 1PFUA 2WAOA 4W63A 5LMUB 5B1DA 2FEXA 2BCGY 1W94A 2AXQA 1YB2A 2IU3A 4UPEA 3THYB 3H19A 1QGDA 1WHTA 3L1KA 3I2FA 3SD7A 2C3MA 3U44B 1GTMA 1N7GA 2Q8PA 4HZUB 2X22A 1E2KA 2IXBA 1J7KA 2JLBA 3RBZA 4BQPA 2XZPA 2ZVQX 1JVSA 5A3RA 3G8DA 2X2EA 4Q3CA 4BASA 3DO5A 3QHAA 4AL4A 3WXMA 5BPHA 2E89A 2VCHA 1EXWA 1MMFB 2Q6VA 3O90A 2ANBA 3DJFA 4RHTA 3GH1A 2R7NA 4CIXA 3T7IA 3ZR4B 1P75A 3JQGB 4YQYA 5G1NA 2G07A 5E6RB 1NAIA 1R6VA 5EINA 3CSUA 1MG0A 1T0IA 2ICAA 4P83A 2X7XA 4XUEA 3W79A 4D80A 3JAKB 3PKZA 2RGGA 5L95A 5HRUA 4M1YA 3BBLA 5AXCA 2A1UB 4UEKA 4S12A 3NWOA 3ZHRA 2WSBA 3VR5H 1NSTA 4BVJA 4EB3A 3NBXX 2IS4A 4U9IS 5I7FA 4OI1A 2FSUA 1U2RA 3RC8A 1BTOA 3V1YA 2JD1A 1P9NA 4M1ZA 4K7JA 2CFOA 5GV7A 4YAKA 4GKJB 2XOXA 2OHFA 3WX0A 1QZZA 5ES4B 1CUCA 3EWNA 4NULA 1Q0TA 2A5YB 4D6XA 2BRUA 3LUFA 2XNDD 3BD9A 3BD8A 5DLDA 2JBWA 3TAHA 3FETA 3PTAA 6CHYA 3KRTA 4FQ5A 3I37X 2VZ8A 3RAEC 3DMNA 1J24A 4K6KA 4W8GA 3LC1O 4P35A 1EFVB 4TRNA 4QAQA 2RHLA 3R0VA 4LTNA 3JARB 4RABA 3N6RA 4W5JA 5DI3A 3STVA 3T41A 3WK5A 4DGSA 4LS3A 1I2BA 1P74A 1CXZA 2ATIA 3M4YA 3ZD7A 2E6KA 3KUDA 3CSDA 1RLIA 3IIJA 1BJRE 1Y3CE 3MVEA 2I6XA 5AVOA 5KSOA 1KZ9A 3UMYA 1HNXB 3AI1A 3OTOB 2UUAB 5AXDA 5ICFA 2R6GA 1JT2A 3B6MA 2BI4A 3OG9A 3T3DA 2BL4A 5G0TA 3USCS 5KNLA 3ZIUA 1IUOA 1OBFO 2AZTA 1Q1BA 4X1OA 3O82A 4KR2A 1ZNZA 2I87A 1RKQA 3P97A 4E03A 1VDZA 1QOPB 2RC6A 3O4GA 1ZCFA 4US1R 3T4EA 2MMCA 1O6ZA 3OUTA 4CQMB 1XVIA 2XAAA 3INYA 1BGVA 4D4IA 2CHFA 4DNOA 2IH5A 3BORA 1LSJA 2FUKA 1PO7A 4JOQA 1C9MA 3GYBA 4XWTA 4D0LB 4ZMBA 5IC5A 3RKRA 1CUBA 1E2LA 1NYQA 2GN4A 4Y6GB 2QJOA 4CI9A 2OZLA 4PGFA 4OHBA 3IP1A 4P98A 5D7BA 3B8EA 5HTOA 4K81B 3C4JA 1KNQA 1PHPA 1RI3A 3FLMA 4CVNA 3NGXA 1D03A 4PRKA 3B5IA 3L0ZA 2CYAA 2GJ4A 4E7PA 4ZYZA 5HSGA 3F46A 4GX1A 4DSNA 4EITA 2GBCA 2F9MA 5DBIA 2D13A 5FPKA 5KKNB 1PV2A 2Z4SA 4Z0TA 2HHAA 3DKRA 4EG0A 3B9RA 2GM4A 1FVXA 2AN9A 1ZEMA 3NBYC 1SHZA 1WDMA 1Z35A 3SKXA 2JHFA 3EEIA 3U3ZA 1BE8A 3NC4A 4LYFA 3TJZA 1KI6B 2UAGA 4L08A 1IHYA 4NJEA 4OUDB 3PICA 4PX2A 3WO1A 3ZWBA 1P77A 4P34A 1CUVA 1W35A 5EMLA 1ZZEA 4YAWA 3ACBA 4E15A 4LYDA 2JIRA 4OXNA 4UMFA 4CQJA 1YQGA 4G0XA 4OX9Y 3Q10A 4W5WA 4RJLA 4RX1A 4Z54A 3SC2A 5KNCD 2QRUA 2XXAA 5BOSB 1YRLA 3AHCA 5K6RA 4KZKA 4LYYA 4FLFA 4KH0A 5IBRA 2VZLA 2AIRA 1TZJA 5JQGB 1G0OA 2Q49A 4W5HA 2XY4A 1VMKA 1L5HB 2H8GA 4ZU1X 3P45A 2TYSB 3G5AA 3IE0A 3O8BA 4OB8A 1ORIA 4XR9A 1C30B 4HQRA 4M89A 1LBSA 1JFRA 4D9FA 2IHUA 3BEDA 3RE1A 4EL5A 1F6BA 1O9BA 1FS6A 1QIJA 2JFXA 3OVMA 4CV1A 5ICSA 2DGDA 5DM0A 5AKXA 4EY8A 2IXGA 1EVLA 1C9KA 1BZYA 2EFJA 5L3SA 1FX1A 1SBHA 2C20A 1N0IA 4FFNA 4XWWA 1WJGA 1K3FA 5T7BA 1L5FA 2CJWA 2ZIVB 3I52A 4WZBA 3M6AA 3CWCA 1KKUA 3A6FA 3LBHA 4Y6RA 3DDHA 2GD6A 4GC9A 2YJ3A 2C83A 2EYQA 2Y8EA 4CMHA 2IXTA 2O7QA 2WKQA 1QFMA 1IBLB 4UBMA 3T3OA 1EDOA 1YCGA 2OECA 2WBLC 4I9GA 5HK8A 2ZYAA 1I4OA 3JQFA 1TK2A 3UJAA 1T29A 3U31A 3O1HB 2TMKA 2ISCA 4GS5A 4C2TA 5CCBA 2I34A 2ZWVA 1TOAA 1LLCA 2FPUA 1ODTC 2V7GA 1DKPA 1UZUA 3W34A 2MR6A 1LWOA 2FQ1A 1KFJB 2WE8A 3OETA 4N3BA 4CIVA 2VSFA 3T12A 2JD0A 3LXUX 4WOPA 5AVTA 3LECA 1YU6A 4UKDA 4AP5A 1UOOA 1MFPA 3QWBA 5H5JA 4WCFB 1OFGA 3WGMA 1DCTA 2O8CB 2W0MA 1P2DA 1C50A 4C0HA 1SVKA 1E5XA 2LW7A 3HRIA 1ZJZA 4FSXA 1X7YA 4RC9A 3WYCA 2JARA 1L3IA 3OE5A 4E3ZA 5EJIA 1SQGA 1PTJC 2EAUA 4WFJA 5HK9A 4EPVA 3IBFA 4KWEA 1CERA 1P7VA 1E2HA 1UP7A 4TVOA 1RKVA 4B33A 3WMGA 1PS8A 4MI1A 5IAJA 3UKOA 1D1SA 5JS6A 2FR8A 3DL0A 1M5TA 5G41A 5I8WA 4JUCA 3HXOA 2PGJA 3G5UA 2BEUB 2ZK7A 4G81A 4B4OA 1FW8A 1R15A 1FTWA 3MEQA 2IIBA 3BILA 2OB1A 3QNMA 5F21A 3ZJVA 1Q1GA 1FLVA 1RE0A 2W22A 1M72A 3KTFA 3U4MA 3C3DA 1TJ5A 4LV8B 2WWYA 5HQTA 1E2JA 1G20E 1Q84A 1S8NA 3AHDA 2XZTA 3F96A 3KB1A 2YMQA 2OCXA 1J5PA 4ZREA 3RAPR 4B79A 1PSDA 1JXAA 4S1PA 2XT9A 4ZOCA 1HPLA 4ZKDA 5CB8A 2FCRA 3GHHA 2EZ8A 2HWXA 3DYIA 4MVJI 3ETDA 4AT1A 1ZXBA 2D8AA 4FS8A 3GD5A 3PPVA 2R751 5KDLA 5BNTA 2I99A 1EAMA 1E0SA 2XQGA 5BN1A 3BXEA 4XLLA 1RHQA 3L6OO 4WXMA 3QU2A 3O1JC 4R0VA 5EP1A 2VAWA 3H04A 4LG1A 4YFYA 3NYRA 1ZH8A 1TUBA 1SURA 2UV8A 4D46A 4CNQA 3U9LA 2RG1A 5FHRA 3MBIA 4AVYA 4OATA 2O1XA 1D6JA 2EKQA 4XAQA 5SZKB 8ATCA 3ILYA 1ADYA 3B89A 4KRGA 3FVWA 1I1HA 4E5SA 1E63A 2V54A 1O6GA 4R69A 2H1HA 4KR0A 4ZO4A 5JG7A 2F4VB 4GM4A 3TM4A 2Y2UA 3GUHA 3PNLA 3WADA 1Z4LA 5HJEA 1GAWA 3OI7A 4RLSA 4RSHA 3MQ2A 5FA8A 1MEEA 3UM9A 2R68A 3HR4A 2ZS9A 4OGFA 3T9DA 4BFWA 4RTKA 3D2AA 4NP6A 3GA5A 5JNWA 4G07A 1MX3A 4MUJA 3V8PA 1W4RA 2W9XA 4BNNA 4W1PA 4YRDA 1OFTA 1P7ZA 5GADl 1PVDA 3D8NA 5I5EA 5L9AA