4EUFA

Crystal structure of clostridium acetobutulicum trans-2-enoyl-coa reductase in complex with nad
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
389
structure length
387
Chain Sequence
GFIRDVHPYGCRREVLNQIDYCKKAIGFRGPKKVLIVGASSGFGLATRISVAFGGPEAHTIGVSYETGATDRRIGTAGWYNNIFFKEFAKKKGLVAKNFIEDAFSNETKDKVIKYIKDEFGKIDLFVYSLAAPRRKDTGNVYTSRIKTILGDFEGPTIDVERDEITLKKVSSASIEEIEETRKVMGGEDWQEWCEELLYEDCFSDKATTIAYSYIGSPRTYKIYREGTIGIAKKDLEDKAKLINEKLNRVIGGRAFVSVNKALVTKASAYIPTFPLYAAILYKVMKEKNIHENCIMQIERMFSEKIYSNEKIQFDDKGRLRMDDLELRKDVQDEVDRIWSNITPENFKELSDYKGYKKEFMNLNGFDLDGVDYSKDLDIELLRKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of trans-2-enoyl-CoA reductases from Clostridium acetobutylicum and Treponema denticola: insights into the substrate specificity and the catalytic mechanism
pubmed doi rcsb
source organism Clostridium acetobutylicum
molecule tags Oxidoreductase
molecule keywords Putative reductase CA_C0462
total genus 134
structure length 387
sequence length 389
ec nomenclature ec 1.3.1.44: Trans-2-enoyl-CoA reductase (NAD(+)).
pdb deposition date 2012-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07055 Eno-Rase_FAD_bd Enoyl reductase FAD binding domain
A PF12241 Enoyl_reductase Trans-2-enoyl-CoA reductase catalytic region
A PF12242 Eno-Rase_NADH_b NAD(P)H binding domain of trans-2-enoyl-CoA reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4eufA00
2O23A 1Y8QB 3JQ7A 4BNVA 3DBVO 5TLSA 3NGLA 1ZFNA 4NK4A 4BO0A 1YBMA 2HCTA 2Z1MA 3OJ0A 5CDUA 1NQAO 3CKYA 2DBVO 5HBRA 5CDGA 2PV7A 3NDJA 4CLDA 2B4TO 2ZYAA 1A9YA 3T7CA 3K9QO 3GZNA 4MIYA 1BG6A 1CWUA 4Y67A 2X9VA 3GVCA 3SVTA 5U4QA 3RVDA 1WPQA 4YAGA 4BUCA 1TVEA 3GOHA 3TZCA 3PHJA 3I4FA 5JBIA 4PCVA 5KNLA 1ZK0A 1LSJA 1ULSA 3JD1A 3D0OA 3WJAA 2JAPA 1BDMA 2YV2A 3P2YA 1Q0QA 4PRLA 4WJZA 1P0CA 4GX0A 4MINA 3KEOA 3P7MA 4TQGA 1MGOA 2D4AA 5THQA 3JQBA 4B7CA 5L53A 4FFPA 3UUWA 4AFNA 1E7RA 1R12A 3RCBA 4CLHA 3WR5A 3ZWMA 2OXIA 3GH3A 4Z9XA 1M66A 3U09A 3DONA 2X8LA 4PLHA 5FEUA 1T2FA 3HN7A 1PU2A 4W4TA 1PTJA 2EP5A 1GU7A 3WJ7A 5A02A 4Q9NA 2ET6A 2PZMA 1ZK3A 4BO3A 4CQMD 3WIEA 3V8BA 1PIWA 1EBFA 1BXGB 1I2CA 4KTVE 4ALKA 2RIRA 3OQBA 3QSGA 5JO9A 3KETA 4II3A 3PZRA 3GA0A 2RHRA 4JJIA 4M87A 4IZHA 3BXXA 4IMPA 3JD4A 1QYWA 4XRRA 1PGQA 2NVUB 3OHSX 3RC9A 2BGKA 1DJNA 3ON5A 1JWBB 2Y1EA 1YOVB 3ZWVA 3O4RA 3OICA 1GR0A 1IE3A 1YOVA 1U4OA 4W7IA 1T2CA 4ND1A 2Q49A 1GZ4A 3ZV6A 3KSZO 3ROPA 3H9UA 2HU2A 1J5PA 1W6UA 1ADFA 2J6IA 4J7XA 4DLLA 1T24A 2GZ2A 1R15A 4MVJD 1PZEA 1YVEI 1JVSA 2GRAA 4C4OA 4CUKA 2IZ1A 2AQ8A 2O3QA 3CIFA 5DF1A 4UULA 1CQIA 4TKMA 4BGVA 1ZUD1 3GGPA 1R4NB 3DZIA 4CR6A 2VYND 1PWXA 4CM8B 4GMFA 4WEQA 3NUGA 1Y1PA 2HRZA 1HSZA 1LJ8A 1B26A 4NG5A 4XYGA 3JQBC 1DFIA 5AYVA 3F6YA 2R00A 4XB1A 4WLEA 1NR7A 2GN4A 5JDCA 1J4AA 1FDSA 4GLOA 4XDZA 2GN8A 3KSUA 4WNIA 3S55A 1HE4A 4AJLA 3JQ8B 1GYRA 4JJFA 1DC3A 3SLKA 1YDWA 3O26A 4W9NC 4WE3A 5TT1A 1LQUA 2UYYA 1RM0A 2AQKA 3DEYX 4L76A 3X2EA 1GUZA 3RUAA 1MB4A 1ONPA 3ADOA 1WZEA 1HE2A 4IDAA 1PGNA 3HB4X 1P33A 3A28A 3DMTC 3BMQB 1E5LA 3WQRA 1U4SA 3HDQA 4II2A 4TROA 2O7QA 3QHAA 4MIOA 1KVSA 4RF5A 1PS9A 4YQZA 4EGFA 1NAHA 1GQYA 3JQFC 3LC2O 3IQDB 4P4NA 2ZB4A 3TFQA 2BGMA 3FPLA 4XJSA 3W4IA 3KYCA 4WCFC 2IDZA 4BNFA 4N5LA 1ENYA 4BMVA 1R37A 2V65A 2IZ0A 4YJDA 4FOOA 3PYXA 2X0JA 4L74A 2HKIA 2IEDA 5CHEA 4FC6A 1LRKA 5DCYA 2HSDA 3L6DA 2WDZA 4TSKA 3TRIA 2NLOA 2G76A 4IGEA 4JBIA 5F1KA 3EHEA 1EDOA 2NVWA 1NXQA 1E3WA 3PYMA 2HK9A 3K92A 4CMCA 4WCFB 2VWGA 3UN1A 3JQAB 1Z75A 5CDSA 2ZK7A 2WM3A 1VJTA 2NACA 5KOIA 2O3SA 1H0KA 2B4RO 1YB4A 3KOUA 4NDNE 1EE9A 4IJVA 5A9TA 1NQTA 4MVJA 2UAGA 4UVIA 4XQEA 3AY7A 1EK5A 3D7LA 4LCJA 3D4NA 1JTVA 3KTDA 3I9OA 4DQVA 4JX8A 4K26A 1C1XB 4BVAA 2BFMA 4JROA 3DTYA 4W9NA 4CM5A 2BLLA 2P5YA 3WBFA 5AXAA 4WNCA 5L7YA 4GSKA 4IIVA 3W4JA 3LU1A 3DC2A 4BO6A 2C5AA 3AFNA 3DAGA 3NYWA 1YJQA 4ZQBA 2CF5A 4I8XA 1OMOA 2DTXA 2XXBA 4YCAA 3OJEA 2YUTA 3LK7A 4IXTA 3VTZA 2ZB7A 3D4PA 3W1VA 4YEDA 1IY8A 3JYNA 3E1KA 1UZLA 2VUTA 1Y7TA 2Y93A 2Q2VA 3GNTA 4YJFB 5IDXA 1TT7A 1FDVA 1HYHA 3ULKA 2C7VA 4XQGA 1VL8A 1O6ZA 4E5MA 4CMIA 2VRBA 1ZZEA 3V5NA 3BTUA 1AXGA 1T1SA 3U49A 5A5FA 4Z6KA 3E82A 3SX2A 3QW2A 4ND4A 3RFTA 3PVZA 3KYDA 5CPFA 3ZGYA 2DFDA 3MJSA 1EVIA 1T2EA 1U2GA 3NJ8A 4BO1A 2P91A 4CL3A 3NAQA 4OAQA 4I9HA 3UCFA 4UUNA 1Q0HA 4UEKA 3BMOA 1XEAA 1LEHA 4CMKA 2A4KA 1PJSA 3PP8A 1VSVA 5G4KB 3MJEA 3OFSA 1GFSA 3ANMA 3GAZA 3ZHYA 2YZ7A 3C24A 1DIGA 4J0EA 4PZEA 4R9SA 2Q2WA 1UAYA 3IKVA 5HS4A 1NPYA 4CQMA 4BKPA 4EYEA 1F8FA 1YBAA 4ESOA 2IE0A 3WG9A 4YXFA 4ND2A 4JJGA 4DVJA 1Q7CA 3C8MA 5I7VA 3O03A 3VH4A 3WWZA 2VNAA 1XGKA 3ANNA 2FRDA 3B1JA 5GZ3A 3ZW9A 2NWQA 4FFOA 1XLTA 5DBIA 4CLRB 4U5QA 1W73A 1SMKA 2ZYDA 1Z7EA 2Y66A 1Z45A 4IDGA 4RDHA 2WSBA 5KVCA 3FI9A 1Y8RA 4KDEA 2AG5A 1NQOA 3NX4A 1PJQA 2WJPA 1IHXA 2PZLA 3L9XA 1JWAB 1MFZA 1DIHA 3RBVA 4TRRA 1DO8A 4FFLA 3RUFA 1EZ4A 4LSMA 5T8KA 4OJNA 3ZNQA 4HNGA 4QFCA 3SJUA 4WOKA 2PWZA 4OL9A 5G2OA 1JKJA 2C0CA 5ENDA 3IIEA 2NV6A 1WMAA 1SNYA 4D3SA 1X15A 2BFAA 2J3HA 4GQAA 3SC6A 3Q2KA 1E1MA 3F4BA 3NT4A 2WEKA 5JAMA 2DU8A 3GMSA 2J8ZA 2A35A 2QQ5A 1LQTA 4MJLA 3NJ4A 4PGFA 3RC2A 5HWSA 4NMHA 2PY6A 4PRKA 4GBJA 4TZKA 2NTJA 4MKRA 2C2YA 4ZHSA 4PLTA 1H2HA 3H5AA 4CQLB 4YAEA 2RBEA 5A4DA 3PJGA 2PZJA 5TX7A 4IBOA 3UF0A 4A5OA 3GRPA 3ZWNA 4E5KA 4DBVO 1R4NA 3GN2A 3ZNNA 5T6BA 3CEAA 4EJ0A 5G0WA 4K1LA 3Q11A 3HE3A 1K6XA 5L40A 4A2CA 4BMSA 1M75A 3VH3A 1EFLA 2OOSA 4OOEA 2PTGA 1MC5A 1AN9A 2GO1A 4D45A 4F6CA 1KOLA 1IB6A 5AXBA 3RUHA 5IN5A 4NFSA 1QSGA 4B3HA 4BV9A 4XRGA 1ISGA 1H6DA 2NU9A 4BGUA 3DFUA 2H6EA 4AJHA 1LTHR 2J3IA 3DOJA 4RVUA 2X9NA 4R51A 3AM5A 3AOEA 2QHXA 8LDHA 2B35A 1VI2A 1I3MA 1K6JA 3KUXA 4HNHA 5TRTA 1PJTA 3GT0A 3AK4A 2JFGA 3I9JA 4IJWA 1GEEA 2HLPA 2X5OA 3OQ6A 1GCOA 3INTA 1PR3A 4R68A 1VPDA 1CEQA 3DOOA 3TL2A 2C2XA 1QMGA 3DDNA 1UJMA 1EEHA 1WZIA 3F3SA 3PTZA 4D3DA 3PLNA 5B4TA 2WMDA 3K2EA 5ADHA 3RJ5A 4IINA 4GX5A 4EUHA 4YRBA 3WNVA 4GKBA 4ALMA 1UXJA 3SJ7A 1IPFA 1RPNA 3I6QA 1JQBA 3I4CA 1HRDA 3Q9UA 2QW8A 3LT1A 1B15A 3HG7A 4F6LA 2DPGA 3NEPX 5EMHA 3H65A 1MV8A 1ZO8A 3E5RA 1R0SA 4NIMA 4DQUA 4CM7A 2CDCA 2YHIA 1F14A 1P44A 2PH3A 3PK0A 5EJ2A 2YY7A 4JNKA 3HDYA 4YAIA 3KO8A 3DL2A 1EFKA 1A7KA 4CM4A 1H9AA 1E6WA 2X0IA 3DAPA 1KC3A 5U9CA 3HHPA 5IZ4A 1U5AA 4OSOA 3LT4A 4CM6A 1ENZA 3JD0A 1E1LA 2CVQA 4UEJA 3ADPA 3EK2A 4WLNA 3S2EA 3RU9A 1YB5A 1KEUA 2NVUA 3C85A 4BIIA 3ENNA 3B6ZA 1VL6A 2YDXA 4PFJA 1P45A 1SB8A 4RLHA 3PQFA 4EITA 2I66A 4WASA 3EDMA 3S8MA 1GQQA 2P4HX 2ZATA 4XD2A 1E6UA 1BVUA 1BXGA 5H82A 4QTZA 3PHIA 4WEOA 3FHLA 3CUKA 3RU7A 4AJIA 3SC4A 5A06A 5KJ1A 3WGYA 3ICCA 1TI7A 4QEDA 1HETA 2WD7A 4IS3A 4UUOA 4E12A 1JW9B 4Q3CA 3EYWA 4DIFA 3JYLA 2CDAA 1I3LA 2R6JA 4Y98A 4FN4A 2WE8A 4YJGB 4A0SA 1NASA 1ONNA 4B79A 3PWZA 1LLQA 3OECA 5KIAA 2GUGA 1D1SA 3GFGA 4E2ZA 2HO5A 4YWJA 2JCVA 4ZRMA 1R16A 1RYEA 3Q2IA 4S1VA 3QJ5A 2Y1FA 3KYCB 1DPGA 4IUYA 1HDXA 4Y8VA 3Q6IA 1I24A 3UICA 4YJHB 2H5LA 5CG2A 4TRNA 2VHZA 1XQ1A 1NPDA 4LRTB 1CJCA 1C0LA 1ISFA 4W7HA 5JYDA 1Q7BA 4YTEA 1QXSA 1C1DB 1N7GA 2DPHA 3BMQA 3NV9A 5JY6A 4WLOA 1DC6A 1C0IA 4UVEA 1Y9AA 3PDJA 3KB6A 3GNQA 5DCWA 3V1YA 3CSDA 2VYVD 3QIVA 3B1FA 3FWNA 3D1LA 4G81A 2QRKA 4RVSA 3KZVA 4XGIA 5ER9A 4DUPA 5JO0A 4TKLA 1NWCA 1DEHA 3V2GA 4CL8A 4ZJUA 3OP4A 1V35A 1T4DA 3I9KA 4JGBA 2Y1GA 1NWHA 5JS6A 2GPTA 4U7WA 1GD1O 2Q2QA 2Z5LA 1C0KA 3ETDA 3EW7A 2W2KB 3PJDA 4OKIA 5K0ZA 5G4LA 3NRCA 4RF3A 4RF4A 1XHLA 2DKNA 2D3TA 2RH8A 4E2YA 3M2PA 4AG3A 5JDCC 3I5MA 4BB6A 2WD8A 2J5QA 3JYPA 1NVTA 4CV3A 3R6DA 3E18A 1RJWA 4WPGA 3ZN2A 2DUWA 3PYLA 1EVZA 3OQ1A 1BXZA 2X86A 3HNPA 4FDAA 2AQIA 2VZ0A 2NQTA 3WMWA 4L9RA 4O5OA 1NFFA 3PLRA 3FNEA 3GG2A 3D5QA 1KY4A 2DLDA 1SBYA 3PQDA 1H9BA 1YJ8A 4ZD6A 1DIBA 4Y6PA 5IDYA 2IEBA 5BQFA 3D4OA 4FW8A 1E1NA 4I9UA 4A03A 3CPSA 1TA4A 1HE5A 3L4BC 2UDPA 4CMAA 1UXGA 2HDHA 3QVOA 4FD3A 2C54A 1BHSA 1ENPA 3WX0A 2CFCA 1VRWA 1W8DA 4EZBA 1G1AA 4D46A 4AJOA 2H63A 2OL4A 4J4TA 4PVDA 4QQRA 4I5GA 4J1QA 1NM5A 4N18A 2QG4A 3GAFA 4ITUA 4I08A 4D41A 2V6BA 5I9MA 4RGBA 2RAFA 1YKFA 2E6UX 4L0QA 4DGSA 2C82A 3MWDB 2GNAA 1U3TA 1TT5B 1E0DA 1V3TA 1EUCA 1C0PA 4WLFA 3QY9A 3TQHA 2RHCA 4HV4A 1QORA 1QRRA 2OMEA 2Q4BA 3GVPA 4KP7A 2E37A 3FSRA 4PLVA 3W8FA 2V6MA 1I0ZA 1EDZA 2ZQZA 1OZAA 1H93A 2X0NA 4OQZA 4D43A 2GN9A 3OEWA 1AHIA 1RYDA 4JBGA 3OIFA 4K9DA 5EINA 5K6AA 2VRCA 3H5RA 3BAZA 3LT2A 3IP1A 1DXYA 2Z95A 5TT0A 1PWZA 3SEFA 2I99A 3VZRA 3AI3A 2Y0DA 4MKZA 4XDYA 3WFIA 2J5RA 4IDDA 1O95A 4RVFA 5GMOA 2H1SA 2YV1A 1Y81A 1HLDA 1ZSVA 3QVSA 5CP8A 4XB2A 3DBHA 4DTIA 2EF1A 4J91A 1G0NA 4DYVA 1DRUA 2X58A 3IDSA 1NR1A 4BNYA 1OAAA 5BSGA 3G49A 5AOVA 1NQ5A 3UOGA 5A03A 3H8VA 3BTSA 5DP1A 3DBLA 2VCYA 3KM0A 3K31A 2JFHA 3K30A 3NTRA 4NQZA 3AU8A 2YYYA 4RPHA 4F45A 3FTNA 3RC7A 3KEQA 1W4ZA 3RBXA 1G6KA 3DZHA 1YO6A 1DC5A 4H15A 2GGSA 3WGGA 4MVJE 1KC1A 2HMWA 4J9UE 4GX1A 3TOXA 1E7MA 3OH8A 3ZV3A 4XIYA 4RORA 4PN3A 3A1NA 1I2ZA 2IODA 3IAHA 3GGOA 1S7CA 4M1QA 1LC0A 5L4LA 1U5CA 1P1HA 5KTKA 1WDMA 1JKFA 3H9QA 5BSEA 3QVWA 2P9CA 4IXWA 1ZVMA 4KMSA 4IY1A 1PL6A 2Q3EA 1TEHA 1HEUA 3LT0A 1Q1NA 1SEPA 1NVMB 1BVRA 4P8RA 4E5PA 1K6IA 2CDBA 4TMFA 2GSDA 2VUUA 3I9NA 3WLFA 3MJVA 4CLOA 1YE3A 5EPOA 3M1AA 5FI5A 1Y9EA 3H3FA 4P4GA 4BO8A 5ITWA 2QYTA 4FFNA 4XA8A 1EQ2A 2ZTLA 2EXXA 3KXDA 4PG6A 4BQPA 3F5SA 5ITVA 1E3EA 1ZW1A 4AL4A 4QO7A 2OGUA 3L6OO 4KWHA 2I65A 5BNTA 3PJEA 4DMLA 5TC4A 1ADGA 4DREA 1MA0A 3ZNOA 4CPDA 3HADA 4M89A 1N9GB 1RWBA 3WLEA 3BIOA 1XELA 3NKLA 2QZ9A 5FYDA 4B4OA 3IKTA 5KJCA 1YXMA 1GYPA 3R3SA 1H6AA 1H94A 1PEDA 1WVGA 2PKRA 3IOYA 5JCJA 2UUPA 1JLLA 4MKXA 1FK8A 1UAGA 3OIDA 4FC7A 1XWFA 5COQA 1NHWA 2W90A 4YAJA 4HFRA 4YA6A 3V2HA 4K28A 4CM9A 5KJ6A 1MLDA 4RF2A 5IJZA 3RSHA 4BNIA 1QYXA 1VL0A 1SO8A 1LUAA 4GPD1 4XX0A 4E0BA 4P22A 4DXHA 1S6YA 1SZJG 3H9GA 2XXJA 1Z6ZA 2JFFA 5DBGA 5CPBA 1VC2A 1F06A 3R3JA 1DBVO 2D5AA 3MOIA 4FSHA 2IRWA 3N74A 1I10A 1AHHA 4DQXA 1BMDA 2UV8A 3C1OA 3RUCA 2NU6A 2QRLA 3WSVA 4XKJA 4GVXA 3M1LA 4OKNA 1J49A 1DRWA 1HWYA 3RWBA 3AY3A 1P31A 3TDKA 5BT9A 1NFQA 5I8WA 1KERA 2VZ9A 3H6KA 5DBFA 2WYUA 2O3TA 4ZVVA 4HUJA 4PVCA 4JXKA 3GPDG 2Q46A 3LC7O 3WMXA 3WYEA 4IM7A 1SEVA 5DDIP 2F1KA 3GVIA 7MDHA 1YL5A 2A92A 3VHRA 3E03A 1FMCA 1ZXLA 3A14A 4OOFA 1XU7A 2YFHA 4B7XA 3GQVA 3VH2A 4HADA 3FD8A 2JAHA 1PL8A 1EQUA 4NI5A 1P9LA 3WGZA 1HDYA 4YT4A 3DHEA 3NGXA 3AUSA 2TMDA 4GWKA 4UVGA 5IZCC 1KVTA 4CMGA 1KBZA 1PS0A 1B3BA 2GR9A 3UHAA 2OP1A 2AXQA 1B14A 3RFVA 4DIBA 3RUEA 2BELA 1E5QA 1QYDA 2CUKA 1BWSA 2P2SA 4N5MA 2BKAA 4RPJA 4OM8A 1U9JA 3VKVA 2FZEA 4KUHA 4NFYA 4WCFA 3H2SA 1IYZA 2V6GA 4LK3A 2VRCD 1OBFO 2DTEA 4HXYA 3GHHA 3D3EA 5DNAA 4IS2A 3UKOA 4WCDA 1LSOA 1K2WA 2Y05A 3G17A 1YWGO 3K96A 3LC1O 2W98A 3NTOA 3PGXA 5I8ZA 4DWVA 3O8QB 4N5NA 1U3VA 4EUFA 4J43A 3U9LA 2YQ5A 2GCGA 4RPLA 4DLBA 3ONFA 1PR9A 5JE8A 4FS3A 5IF3A 3HZZA 3WGTA 4NJMA 5IDQA 5I9NA 4IZIA 2CD9A 5L45A 2ZTMA 3GY0A 4P4LA 3QWBA 4OYRA 4NJOA 1M2WA 1VKNA 5F1OA 1DLIA 3L9WA 2DUUA 2FHSA 3VKUA 5C3MA 2GF2A 6ADHA 5G0SA 4N7RA 5A04A 2Z1NA 2NU8A 3TJRA 4E33A 1NPTO 3ETEA 1H6CA 3PFWO 4MDHA 3EY4A 4JN6B 5AXCA 2C20A 4L4SA 2PGLA 1UDAA 3PHHA 3VTFA 5AXDA 1V9LA 3RC1A 2EW8A 2X5JO 4OQYA 1EUZA 3JQ9C 3P2OA 4L73A 3FN4A 1UP4A 3QV1A 1F17A 4G5HA 3ZZNA 3L4BA 3PPIA 4AJEA 5A1TA 2HMTA 2ZB3A 1BRMA 1NTOA 1GV1A 4NNJA 1DHRA 2D5CA 4PLCA 1NAIA 4MIEA 3G1TA 1ZJZA 3BMNB 4Y9DA 2C7GA 5IAAA 1ISJA 5B4VA 2VYNA 1LDEA 3OM9A 4G2NA 3QVXA 3FR7A 5B4UA 3TZQA 4TVOA 5LDGA 4WLUA 2BI7A 4D7AA 1F0YA 3E48A 4E2WA 4K6CA 4EW6A 2VHYA 2WTBA 4BO5A 1ULUA 1PZFA 2D8AA 3EVNA 2B4QA 5ES3A 2E48A 4CMJA 1GUYA 1LNQA 3AM3A 1DAPA 4PG5A 3ZU2A 2CY0A 4XYEA 1ISIA 3UH1A 4BGIA 5ICMA 5DCUA 4QECA 1U3UA 5BSHA 4GLLA 2VNSA 2DC1A 4MVJG 4L8VA 4KQWA 4BNJA 3VH1A 3WQSB 1B0AA 3ZU4A 1OC2A 2AHRA 2BH9A 3V1UA 4DMMA 2OUIA 3E9QA 5JMWA 5JDIC 4PLPA 3PDUA 1VSUA 2ZYGA 4LISA 5JCXA 2C59A 1ISHA 4W6ZA 1A4UA 3ANLA 3S1LA 4R69A 1QYVA 3CMMA 4JP3A 5BNFA 2ZCUA 2Q50A 1CYDA 1EBUA 5JW6A 3RJ9A 2GDZA 4M49A 3ZU3A 2GN6A 3PWSA 2D59A 4UUPA 1MXHA 3ZWCA 5L3ZA 1PL7A 4J4BA 4MVJH 2O7SA 1IHYA 3DHYA 1I8TA 5JY1A 3GPIA 3NT2A 3JD3A 5KKAA 4CR7A 2O4CA 4IPTA 3WB9A 1U8FO 5JAIA 4NH4A 3F46A 1OI7A 1YQGA 2I67A 2OO5A 1R66A 3FR8A 5LDHA 4RVHA 4ZQGA 3K6JA 4L75A 1HE3A 3RUDA 2J3KA 2JKVA 4EEXA 1HDRA 1TXGA 3MTJA 3TNLA 4EUEA 4YAKA 4J1NA 1PSDA 4PZCA 2X5KO 3INGA 1NNUA 4DC0A 4JCOA 1GEGA 3VZPA 2DVMA 1ZMOA 3UVEA 1CERA 5A9SA 1MC4A 1LC3A 5T8KC 3A9WA 4A73A 1D8AA 3WTBA 1HL3A 4ALNA 4YYZA 5C7OO 5L4SA 2HUNA 2CNBA 1X13A 5JFOA 2HAEA 3K73O 4BO4A 2P68A 1GY8A 2D0IA 9LDBA 3KYBA 3D3WB 2EG9A 5L7TA 5L7WA 2FPIA 3PEFA 3H9JA 3ASVA 2HK7A 4CMHA 4IQ8A 3I3OA 4DYDA 1B8VA 1BTOA 3GVHA 3GEDA 1YH3A 1R4MB 1L7DA 1XDWA 3BYZA 3GHYA 4GGOA 2AE1A 5ILOA 1UDBA 2Q1TA 2VYVA 1C3VA 4BB5A 2EJWA 3JQDA 4FBGA 5DP2A 1GUFA 1I01A 4B7UA 2ILTA 3ENKA 3ONDA 2X23A 2ZTVA 5EIOA 5HTOA 1A72A 4H7PA 4MOWA 1QLJA 1BSVA 3CZMA 2YFQA 4QT0A 4M8SA 3KSDO 4K6FA 4QSMA 1PZGA 1U7TA 1ID1A 2E4AA 3AI1A 3LYLA 2QRJA 4Z3KA 1CETA 2AA3A 1E77A 1NFRA 3EZYA 3DZKA 4ALLA 3P19A 4XGNA 2XF8A 2FSVA 2OORA 1JA9A 1GZ3A 1NP3A 3HSKA 1DAOA 3PJFA 2EKPA 3WS7A 3BTVA 4YBZA 1E7SA 3WYCA 4XQCA 3DZJA 5KCZA 4KWIA 3W6ZA 3OMLA 4DRYA 3VPHA 3GR6A 3OF2A 3ETGA 5T67A 3B70A 1GZ6A 5CDYA 2VHXA 3LLVA 4NBRA 4RV9A 2DBRA 2X1HA 4GVLA 1B8UA 1PJBA 3AM4A 4D3FA 1R4MA 2AMFA 2B83A 5L95A 3T7EA 3ASUA 1NBOA 2VOJA 3OA0A 3QWAA 1WXDA 1HSOA 1X7GA 2J3JA 3INRA 3HDJA 5TGDA 3LF1A 1PQPA 3JQAD 2HMVA 3PIDA 3R0IA 1B8PA 3UGKA 1T2DA 1LLUA 2Y67A 3DFZA 1CIVA 1QV6A 2AE2A 2O3JA 1DC4A 4C7KA 2EIHA 3DTTA 1PQUA 2G0TA 4YRAA 3JQCA 1HYEA 3L6EA 4I5EA 3FNHA 4CM3A 2VN8A 1HT0A 2UUOA 4RVGA 3WSWA 3MZ0A 3MTGA 4F3YA 2YHIB 5A9SB 5HM8A 4ZQHA 1WNTA 2B37A 4E6PA 5JAZA 3DQPA 4FB5A 1Z74A 3DBRB 1LDBA 4OXYA 2VWQA 1FJHA 5EESA 1OOEA 1NHGA 3TZKA 3U3XA 4FFMA 3DO5A 4Z0HO 3UXYA 3GK3A 5CAEA 1XSEA 4DPKA 4U8GA 1U2DA 5L4NA 3DB2A 1PGPA 4J2HA 3G3EA 3BMCA 1ZEMA 4E31A 4J2OA 2ZQYA 3FRJA 2DQ4A 1LDNA 2VWHA 3E9NA 4PLZA 4Z0TA 1YQDA 3U62A 4GAEA 1ZSYA 4ZU3A 3RIHA 3ZH2A 4BNMA 2O48X 1XA0A 4UAGA 1IULA 3W6UA 4J6FA 3DHNA 3KBOA 1I2BA 3ZHZA 1Q7GA 1WW8A 4BNLA 1D3AA 3K8ZA 2VQ3A 4J1TA 5DN9A 5TF4A 2VT3A 5I7EA 2GERA 1E3LA 4Z9YA 3H3JA 3QLJA 4AJ4A 1WDLA 4FIZA 4DPLA 1E6EA 4UVDA 4IQGA 1OFGA 3TOZA 1M76A 2SCUA 4E32A 3WICA 3WWYA 3WNQA 4RZIA 2G1UA 3BHIA 2X4GA 3MCVA 3G0OA 3RKRA 2B36A 1PGJA 2JD0A 5K6AC 4L4XA 4YVFA 2E49A 3G1UA 5KVQA 1PJ4A 1SB9A 1A71A 2BF7A 4JP2A 4RPKA 1G0OA 2YJZA 1DDOA 4DIOA 5GZ1A 1ZCJA 2RH4A 4CODB 2R2GA 2X22A 3N58A 3H9EO 3PI7A 2X9GA 3DMTA 1MG5A 3O8QA 3OIGA 2PD3A 3UCXA 4P38A 2FPGA 4WECA 2C5EA 3UCEA 4CMBA 2DAPA 5FWNA 1WP4A 3TF5A 1QP8A 1YS4A 4EJMA 1I32A 2VTDA 1GPDG 1KETA 3AUTA 6LDHA 4BV8A 1C14A 1UP7A 2VOEA 4AJ2A 2P9EA 5JSFA 3IJPA 4H16A 3BMNA 5EQFA 3WBBA 4TRMA 4RJTA 4YACA 2O4UX 3GEMA 1A27A 3IP3A 3CZRA 3WXBA 4Q3BA 5U1PA 1U7HA 1P1IA 1B7GO 8ADHA 2X0RA 1KEWA 3QP9A 3S2IA 4D44A 4DLAA 3COSA 2Q4EA 3Q1LA 1LLDA 1IZ9A 2PKQO 4FJ0A 4HFNA 5MDHA 3W8EA 4FJ1A 2EHDA 4KOAA 5IXYA 4NU5A 4UUMA 4R1TA 4RDIA 3VPFA 4B3IA 4E30A 1O0SA 2JHGA 1LX6A 3I83A 3TWOA 4WOJA 4H3VA 1BW9B 5G0UA 4Z0PA 4CLEA 4Z9FA 7ADHA 1DFGA 1HDGO 4B3JA 1MX3A 1M6WA 1PQWA 5BSFA 5CEFA 4RQTA 4IDBA 4J7CA 1UR5A 2PD4A 2FP4A 5EN4A 5H83A 4CV1A 3SXPA 3DBLB 2XOXA 3WGIA 1ZKMA 2HJRA 3AJRA 5A05A 3DR3A 2W2LD 4OGWA 5B12A 3EAGA 4FPXA 2HK8A 2OBYA 4GSLA 4Q3AA 3TSCA 3X2FA 4E21A 5JDIA 3VVBA 1P1RA 4LCEA 1LBEA 1PJ2A 1K3TA 3KV3O 4GI2A 3IL2A 2PGDA 3E6AA 3FBTA 3HQ4O 4CMEC 3RASA 2VTEA 3RI3A 4YB8A 1Y6JA 1HDCA 3ZDFA 1IZ0A 5H81A 2FSSA 1I36A 4R54A 1O9BA 1YONA 3L77A 3TZ6A 1JAXA 3P5SA 4PG8A 4FJ2A 1GQ2A 3C7AA 3RBZA 2WE7A 3JTMA 3ZV5A 2NU7A 3U4IA 3RAJA 1EUDA 3WIDA 5G4KA 4XR4A 1T2AA 3AFMA 3BZUA 3ICPA 3BMOB 3AOEC 1ISMA 4BKOA 4BNNA 2HMSA 4U6SA 4MPDA 3A06A 4G65A 1ML3A 5JAQA 3IS3A 4YDRA 3H5NA 1UH5A 3AOGA 2FZWA 1F12A 4Z3DA 2Q45A 3HFSA 2DT5A 1WMBA 3K2BA 2P5UA 1K89A 3NTQA 3VAZA 1VJ1A 3GF4A 3O9ZA 4BQRA 2A94A 4ID9A 1I5RA 2NUAA 4MVJP 3F4LA 4N54A 4NBTA 4FGWA 2I76A 4TVBA 1P1FA 1HTBA 1H6BA 3DOCA 2Q1SA 4R5HA 3TPCA 2OP0A 1I3KA 5TIIA 3HN2A 4CLXA 2X7HA 4XGKA 5B37A 2HMUA 1N5DA 1WLYA 1LDMA 2JD1A 1K0UA 1VM6A 2BI8A 3R1IA 4M55A 3UAGA 4MP8A 4YJFA 4GWGA 4J4HA 3WOHA 3GRKA 3PIIA 1DIRA 3H2ZA 1O94A 3U4CA 4UREA 4HX5A 4R1UA 3JV7A 1ADBA 9LDTA 4C7JA 2TMGA 5DT9A 4XZ3A 4BOYA 4Q3DA 1XYGA 3H7AA 3NDIA 4BNGA 1BDBA 2Q1UA 3BMCB 4FQ8A 3UW3A 3I9LA 3QWFA 4BO7A 2I6TA 4A26A 2Y0CA 4OXNA 1GADO 4BNZA 1ENOA 1JKIA 2A9FA 3HJAA 4TZTA 2V7PA 1I33A 1M67A 5G0TA 2FPPA 1Z82A 2O2SA 2NM0A 2ZCVA 4ROSA 3BHJA 1JVBA 3DBRA 5IZCA 4MVJI 1T25A 4YT5A 4E4YA 3GFBA 1UZNA 1N8KA 2FN7A 3KLPX 4URFA 2FR1A 4OHUA 2UVDA 1TLTA 3C3XA 3BA1A 3ITKA 4O1MA 3TN7A 4PLGA 5TJHA 3V1TC 1YBVA 1KYQA 3VC7A 4R3NA 4IIUA 2AEFA 2VHVA 2YDYA 4R4JA 4BL5A 2I5PO 4EI2A 1P3DA 2JL1A 3MEQA 2B69A 2LDBA 2YHUA 3ROKA 5KJFA 3ZWXA 4BS9A 1E3WB 1MUUA 1LXCA 1XR3A 1Q2XA 3JQGB 1LDGA 3F5QA 4MVJF 3ROMA 1ORRA 4MVJM 3GUCA 2IYPA 3DBHB 5DOZA 3C7CB 1N2SA 5GZ6A 2EGHA 3GDFA 4LSWA 3O38A 3ZWPA 1I30A 3AW9A 5ILGA 3GC6A 3JQEA 4ND3A 4BKRA 3ONEA 2W8ZA 5L9AA 1KVUA 1E7YA 4LVCA 1KS9A 4RCVA 4LN1A 2PR2A 4XIJA 4E13A 1A4IA 1Y5RA 4IGFA 4GH5A 3GDGA 1PGOA 2OHXA 4BGEA 1SOVA 4M86A 1T26A 3U4HA 5HA5A 3PHLA 1B16A 4PLYA 3WGOA 3MJCA 4B4WA 3GNSA 5JC8A 4R41A 2FMUA 1MFPA 2WYWA 3DZFA 1TT5A 5TQVA 1DSSG 2NADA 3D5TA 3JQ8A 1O89A 2VUSA 4PLWA 4AJ1A 4QUKA 4J7UA 4O59O 1ZNQO 4KTTE 4DA9A 4YJGA 1PJCA 1QYCA 1VE9A 2PA3A 4RQUA 3F1LA 3DXFA 2NTNA 4R01A 1N7HA 4AJNA 3E5MA 1WAMA 4S3MA 1XIVA 2RCYA 1QV7A 3VDQA 2EWMA 2PLAA 4OMUA 1N1GA 5GY7A 1HDZA 1P74A 3HWRA 4WK6A 3V2UA 3WFJA 5KJEA 1SOWA 1GV0A 2PNFA 2ZTUA 2O50A 5C37A 1UDCA 4PLFA 4AICA 5C7IO 4IDEA 1T4BA 3EZLA 5KWEA 3KHUA 1B2LA 3ZW8A 2Y99A 2D2IA 3DAFA 3H4VA 3JQ6A 4A10A 2CVZA 3CE6A 1A5ZA 4PG4A 4J90A 2GZ1A 1J0XO 1ZSNA 3D3WA 1VJ0A 1KY5A 1J6UA 3I6IA 4FCCA 5TJ9A 2BRUA 3PGJA 3AU9A 1ZH8A 4B8ZA 4D42A 3I1JA 1KVQA 5DOVA 1KEVA 3FCOA 4KUEA 1LRLA 3WTCA 3RKUA 2HRBA 3L07A 1GTMA 2PK3A 3EGOA 1LLCA 5COBA 4J49A 3QQPA 3PXXA 4JQCA 1P77A 1GPJA 1SC6A 4ZQEA 3WQQA 2P9GA 4X54A 5F1PA 1TB4A 5HS6A 4XEHA 2EEZA 4TRJA 3CINA 4A27A 1DIAA 1SCUA 5I7FA 2FR8A 1FF9A 4ZGWA 5KVSA 4CUZA 5THKA 1E1KA 1SPXA 1EMDA 2BGLA 2ZB8A 2D1YA 2OZPA 2QX7A 4A7PA 4BO2A 2WWRA 4CV2A 3JCZA 3RD5A 3LVFO 3Q3CA 1EK6A 1GAEO 2XPCA 3JSAA 1UXKA 3DZGA 4TWRA 1LSSA 4LRSB 1IOLA 3STHA 3FBGA 1DOHA 2H9IA 3L0DA 4BO9A 3ZWYA 4DC1A 3EVTA 3OETA 2Y1CA 4XJTA 5JNLA 4KUGA 4JLWA 3GGGA 1I3NA 1GDHA 4OSPA 2NSDA 1LI4A 1MG0A 4W82A 4XYLA 3B20A 5JCJD 3LF2A 1K5HA 1EVYA 2BFOA 2B0JA 2G5CA 3CXRA 2CMDA 3MWEB 3C1AA 1U8XX 3E9MA 3EC7A 4HBGA 4MP6A 5LCXA 1YB1A 4E5NA 3VDRA 3M2TA 1LU9A 3RROA 4CM9D 1D7OA 2CZCA 5A9RA 1NX6A 3LZ6A 3U5TA 3BHMA 3ITDA 1ONOA 4NFHA 2YW9A 3FNGA 3JQ7B 3TZHA 4ZRNA 3VVCA 4UEOA 4OXKA 4OO3A 3MOGA 4ZN6A 2ZJ0A 5F3RA 3VOSA 2WD7B 4RZHA 4F46A 4NK5A 5CDTA 5CEEA 1UP6A 4W99A 3I9MA 3GVXA 4ONEA 2CF6A 2DFVA 2HJSA 4BNWA 1LDYA 1WWKA 4CQLA 1ZK4A 2I3GA 1AXEA 3FF4A 4HFMA 4AJPA 2Y1OA 4CR8A 3AWDA 4CMEA 1P1JA 3IMFA 1X7HA 2G17A 4YT2A 1X14A 5G0VA 3JQGA 4O63O 3TFOA 2GYYA 2LDXA 5FI3A 1DJQA 3AUAA 3DMYA 1LA2A 1XCBA 2AG8A 4IDFA 4R1NA 2EV9A 2XAAA 4HY3A 3N7UA 3TL3A 1P1KA 2JD2A 4PG7A 4KZPA 4JBHA 5F5NA 1LRJA 4XR9A 4AJKA 1YQXA 4XYBA 1MP0A 4MP3A 4IJKA 5ICSA 2X6TA 2QIOA 3JYQA 4YJHA 4NBUA 2ZKLA 4BMNA 2QZZA 2DBQA 3GMDA 3GN1A 3JD2A 3MJTA 4BNUA 4OH1A 1JN0A 4NJMB 4D0RA 3QE3A 3Q9NA 5JC1A 1VKOA 4R5MA 4CLRA 3OEYA 3ZCXA 5CFZA 1KIFA 3U0BA 1IPEA 1DB3A 3WYBA 1Z7BA 3GEGA 1ZXBA 1A9ZA 5FF9A 1PZHA 3HDHA 3IC5A 4GGPA 1YL6A 1IUKA 1NVGA 3F1KA 5I7SA 3MJ4A 1BXKA 1KEPA 3VZQA 2FR0A 1DHTA 4RPGA 4WKGA 3F47A 4IMRA 2AW5A 4IQ0A 5T64A 2Y1DA 1E3IA 5DULA 2PFGA 3ZU5A 5A5EA 1PJ3A 1UUFA 1PX0A 3GDOA 2W2LA 1CQJA 4R3WA 4YPOA 3F9IA 4I9NA 2PH5A 3OJFA 3LDHA 1CRWG 5IDWA 2PD6A 2JCXA 1XG5A 1B3RA 2DBZA 4NPCA 4Y6SA 2Y0EA 3VZSA 4DBZA 5L51A 4CUJA 4NBVA 1LSUA 1YL7A 2EKQA 4QX6A 4Q39A 3Q0EA 1GYQA 4QFDA 4BNHA 4Y6RA 4U6QA 4EEZA 1ZK2A 1QR6A 2IYOA 5IFLA 3CH6A 1JAYA 1JU9A 2O2YA 2GLXA 3HUDA 1ARZA 4GL4A 2JHFA 4LVUA 4CM4B 5T5QA 2ZJ1A 4KDFA 2EGGA 4J16A 1UXHA 4L4RA 1CDOA 1H2BA 2Y68A 5B1YA 2VHWA 5JXWA 3C7DB 1JDJA 1HXHA 5JMPA 4ZICA 1V3UA 3OA2A 5TS3A 4EJ6A 1GCUA 5MGBA 3G79A 1ZEJA 4QXMA 5JYEA 4HWKA 5T57A 1KVRA 3LSYA 4XWYA 4YQYA 3KVOA 4FR5A 4RO0A 4XYMA 5ENVA 3S2FA 1YGYA 1HLPA 3PWKA 1L7EA 4BKQA 5C7LO 4PIVA 3U4DA 5BNIA 1HZJA 4WGGA 2PGJA 4RLSA 3EMKA 3I23A 3NDRA 4B4UA 1R0LA 1E3JA 3WGHA 2GZ3A 5IXSA 1ZJYA 5LC1A 4YR9A 2FY8A 4FFRA 1H5QA 1BGVA 4GMGA 3PRJA 4ND5A 1X1EA 2BD0A 4U0JA 3PZBA 4B8WA 5C5IA 1O5IA 2I9PA 5A3JA 1AGNA 1VLLA 2VT2A 2EKLA 1A7AA 2F00A 1BW9A 1DFHA 4I5FA 2JCYA 4D79A 4UVHA 3ORFA 1YDEA 4BNTA 4I5DA 2C07A 1YRLA 3JQAA 5K9ZA 1QLHA 5EQDA 3DZBA 4HFJA 1D1TA 2EP7A 1V0JA 1U3WA 4E3ZA 3OBBA 1Q0LA 4DPMA 3OJOA 3FNFA 4RVDA 1N9GA 2P4QA 5HRUA 5BR7A 1QKIA 3ZI0A 5KVVA 5EL0A 1SAYA 2ZIZA 3D64A 1XKQA 1ZIDA 4IDCA 3RFXA 2GASA 4KQXA 1N92A 4AJJA 2J5KA 2O3RA 3B1KA 1OC4A 1HZZA 3FTPA 3PQEA 3ZWWA 4HKTA 5CEJA 5COAA 4B4VA 3HFGA 4CQMB 2PKQP 4JIGA 1X1TA 4E5YA 5J23A 1M6HA 2R00C 2NTVA 1XU9A 4CLOB 2CSUA 2B5WA 3ROQA 3GZ4A 5AVOA 1Y5MA 5AQ1A 1HDOA 1HYGA 2BMAA 5FFFA 4ZQFA 4YRDA 1DLJA 4J0FA 3K5PA 5TNXA 4EDFA 2AEJA 2BFPA 3JQFA 4CJXA 4U0KA 1U28A 1R0KA 2B5VA 2I3AA 1X7DA 2FOIA 3KYDB 2EW2A 4WUVA 3VPGA 3EUWA 3I52A 2VWPA 3JQ9A 4WLVA 3QWHA 2V6FA 1FDWA 3IUSA 3LLSA 4BNXA 4BHTA 1PS8A 2Q99A 4CMIB 3PHGA 4FGSA 3PFFA 2AQHA 4YT8A 5A3VA 3ZHBA 5I9LA 2POQX 5CG1A 1Y8RB 4GX2A 1FDUA 2EERA 3W4KA 3WGQA 4QO8A 1DRVA 4R16A 1ZMTA 4NR0A 2FWMX 2Q1WA 5EERA 4E2XA 4Q3EA 2C29D 1EE2A 1R6DA 1RM3A 2IXAA 3CTMA 4FOSA 3FPCA 1RM4A 4PZDA 3AY6A 1E7WA 5JPIA 4LGVA 3E8XA 3NT5A 4ILKA 3ST7A 3FWZA 4IJUA 5TSDA 3OSUA 1EVJA 2IXBA 5F21A 2VZ8A 3A4VA 3QVTA 1ADCA 1MXFA 3LQFA 4JK3A 3GLQA 1D4FA 2YV3A 1C1XA 4ALJA 1O8CA 4OIMA 3CMCO 4M54A 1T1RA 4HP8A 4NZ9A 1AE1A 4NHEA 3RQSA 4ALIA 4DL9A 5IN4A 2HQ1A 1FDTA 1L1FA 1QG6A 3GG9A 3IJRA 2OBNA 3VPSA 2DM6A 3QRWA 1F8GA 1ZBQA 3W8DA 3QWIA 3SBOA 3T4XA 2CVOA 1PJLA 3HB5X 4NU6A 4XCVA 3T4EA 3WDSA 2G82A 5KKCA 2W2KA 4J3FA 3C1TA 4J1SA 4D0SA 4MO2A 4NBWA 4ZA2A 4EBFA 2QYSA 1E7QA 4LMRA 3ZNPA 4BKUA 3ZHXA 3RUIA 1W0CA 1CF2O 4O6VA 3KRTA 5JLAA 3UFXA 1UXIA 3ZWOA 4INAA 2AEMA 4GKVA 3VPXA 3SLGA 1XQ6A 1V3VA 4LMPA 4LW8A 3L4SO 3KLMX 4J9VA 4I1IA 4XQ9A 3JYOA 1NYTA 3ZV4A 4R9RA 4BNKA 1C1DA 1E3SA 2OFPA 3BTOA 4AVYA 2NQ8A 2PZKA 1X0XA 3DWFA 3IUPA 4CV0A 3ZWBA 1X0VA 2EJVA 4O0LA 1P0FA 1U1IA 1WDKA 2O3UA 1V8BA 3GZNB 4RL6A 5DZSA 2W4QA 2WYVA 1V6AA 4Q3NA 3M6IA 1N1EA 5ER6A 1RKXA 1Z73A 2NNLD 3GUYA 3ABIA 2GD1O 3OJLA 5F5LA 2IZZA 2JJYA 1Y8QA 3AI2A 1AUPA 3S2GA 2BHLA 1RM5A 1IL0A 5IG2A 1ZK1A 2DTDA 1GL3A 1UZMA 3AUUA 3QA9A 4R1SA 3ZWAA 4CM8A 1E92A 1FXSA 2YQ4A 1HF3A 1HKUA 2E82A 2NVBA 4CM1A
chains in the Genus database with same CATH superfamily
2X76A 2FN4A 2O23A 4FYHA 3JQ7A 4BNVA 1X2EA 3ZC3A 3NW9A 3ENVA 2AD5A 1JEAA 3NGLA 2DGDA 4QQKA 2GKSA 2JIMA 1ACMA 3EIHA 3DOEA 3OJ0A 4P7BA 1X80A 2DBVO 5EZSA 4LC1A 4QHTA 2PV7A 1MABB 4ARBA 2YZMA 3L7NA 4IFBA 2QW1A 1FUUA 3CTPA 4CLDA 4DNQA 2ZXEA 4R2KA 5JS7A 1A9YA 3T15A 2G5GX 2PMCA 2QVCA 3ADKA 3QMVA 4IX9A 4IOLA 4AZ0B 2P67A 4DCCA 4KOEC 2A8YA 3HWWA 10MHA 3GVCA 3L92A 2PJZA 1YU6A 2PUTA 2XB8A 1E5TA 3QBVA 3GOHA 1NLFA 2BEVB 2WIGA 3TZCA 2PL5A 3I9FA 5JBIA 3LWBA 4FB4A 1BDHA 4Y9RA 3OLXA 2VZLA 2FFHA 1ZOLA 1LSJA 1ULSA 3A0RB 1A1VA 3VFDA 4XWAA 5HE8A 4M83A 1XVTA 4QASA 4O3MA 1BDMA 4N7BA 3ZS8A 3RVMA 1GGNA 4PBRA 4CEHB 1M6NA 4HNAA 4H2DA 4G86A 5IT5A 3P7MA 5H9WA 3KUDA 1POWA 2D4AA 3EPHA 3RTGA 5ELLA 3KSBC 3OKCA 3E35A 3JQBA 3E9CA 4C5CA 5BWOA 4DNOA 1M7HA 4PHCA 2VJDA 3LGSA 4R2IA 1CS0A 4EQ6A 1GKKA 4FONA 2FUKA 3NIDB 3ZWMA 3B3AA 2A0FA 2GT1A 4Y6LA 4KHPB 2X2EA 3NASA 4H6PA 5FFNA 5FEUA 1OYOA 3MYYA 4TT3A 4UBJA 2JLUA 1T36B 1B41A 5DV9A 2QNIA 4ZREA 2EP5A 3WJ7A 2PZMA 3HY4A 1ZK3A 1OX6A 2V6JA 1QDLB 1P9NA 3NM5A 4UCFA 4MI3A 3WIEA 1SUIA 3OWXA 4ALKA 1BXGB 2UXCB 1P2GA 2OKCA 1IN1A 2P9QA 2IOFK 1VJRA 4HPJB 1Q83A 4UPDA 1O5TA 4BMDA 1JWLA 3NS7A 1ELOA 4RK6A 1I6LA 3JASB 1VCHA 3KNZA 1TPZA 4II3A 3W79A 3PZRA 3DWEX 2JBAB 2JLXA 4MAFA 5HE9A 3BXXA 4DLSA 3JD4A 4EPWA 5A0FA 1JQ5A 2OGTA 3EDCA 4RH3A 2GETA 2BGKA 3RC9A 2CFOA 1DJNA 1U2RA 3VYRB 4DCTA 5HUQA 1YOVB 3CZ9A 2ST1A 1JECA 1MEOA 2NT4A 2ZG6A 1JHMA 3ENZA 1F8XA 4YRTA 4F0JA 3N0WA 3EQZA 1GR0A 1HRKA 1YOVA 3G59A 3HR8A 2C1XA 4Q9IA 3T7KA 3ZV6A 4V2IA 4Z4FA 3A11A 1O6GA 8AT1A 4RQBA 3TR5A 1Q5PA 2HU2A 2NO0A 4XLTA 2JFZA 1KAEA 1Y82A 2XADA 1P60A 1AV7A 1JDBC 3E84A 1L5GB 1E94E 2GZ2A 1G55A 2IHUA 1WV1A 1PZEA 1E1DA 1JVSA 3C3EA 3M4JA 3K8QA 3MA0A 2P62A 3QKWA 2O3QA 2BBOA 4URVR 5T4BA 5DF1A 2Z57A 3RLIA 2HQSA 1CE8A 3GJSA 3MAAC 1CBUA 2IU6A 1CQIA 3IH5A 4RZUA 4TKMA 1TL7C 3GGPA 5IJAA 1Z4MA 2YVQA 5CA0A 1XPOA 1KZ9A 1PWXA 2BP7A 1CY2A 1I13A 2O2HA 2VYND 2RB5A 3QEOA 4PONA 4FFDA 1PKEA 4H7DA 3IGFA 5FOTA 1B26A 1XX6A 1FEZA 1DFIA 5AYVA 4XB1A 1DX9A 4G1UC 5MFPA 3NBYC 2BCGY 2C99A 4EJ0A 4JB0A 1S96A 4DYHA 3QEMB 1DWQA 2AC4A 1M7GA 2GUWA 4B6GA 5B36A 3G2MA 3OCCA 4WNIA 3S55A 1A9SA 1ZICA 3CISA 1Z62A 3KPWA 1GYRA 1U7XA 4HMQA 5H68A 3HKEA 1XZHA 1ZESA 3MBIA 4FGZA 4P86A 4AT1A 5FFMA 4A9AA 4WE3A 2LIPA 4XQ0A 4AM8A 2UYYA 1URPA 2BZ1A 3BA6A 3OZVA 3O8DA 1TO1E 1N2BA 1VJGA 2ZW9A 2BH2A 2VP5A 2QD1A 1HE2A 2BZ0A 2DHQA 5E2BA 3ZBPA 1P33A 1N9ZA 2NUBA 3A28A 1YB6A 3NCTA 3NP9A 4HLCA 4R1LA 1OB2A 3BMQB 3HKBA 1V1RB 1CUFA 1P4RA 5B1IA 4B6RA 4NYJQ 3LH5A 3W06A 3KQKA 1RYHA 1S8NA 1PS9A 4U9UA 2JS7A 4GU5A 1GQYA 1UPUA 2HBZA 2QUIA 1GCAA 3FGPA 3IQDB 1U8CB 3JQFC 4TSRA 5AHWA 5E9WA 1IRIA 3V1MA 4DJJA 3RQIA 4M9ZA 4BXOA 5EEHA 4JI4B 4B3RB 2XCQA 3FPSA 3NTVA 3KYCA 4WCFC 1T9KA 4BNFA 4N5LA 3L7IA 2CNLA 1TF7A 2K5UA 2GPBA 1QTRA 3UFXB 4AULA 3DG9A 3CLTC 4URZR 4FOOA 4HH0A 1KK2A 3CBQA 3B1YA 3K9LA 4B1FA 1ECJA 3GJXC 5T4FA 3C41J 1T10A 2BYTA 2IEDA 3ADDA 4FC6A 2JGLA 3LQ4A 1LRKA 3T9BA 3X43A 2HSDA 3MILA 2WDZA 1P0QA 1G66A 1OAKA 3Q6MA 2NLOA 3R8XA 3TRIA 5BVHA 1XRRA 3UJAA 5AVRA 3JAMA 2GPAA 1EDOA 2NVWA 1JI3A 1Y4ZA 4FDTA 2R7MA 4PFKA 2IVFA 4I1OA 4N03A 3TRHA 3P9ZA 3R7WA 2II6A 2QMZA 2JBHA 1Z75A 2ZK7A 2V0NA 2HGSA 3CLTD 1G7RA 1XZDA 2O3SA 4KITB 2AFHA 1H0KA 2VPYA 4ZCPA 1NNI1 4GPTA 1ZN2A 1MB0A 1W0JD 3PQ4A 1EE9A 3PI6A 4H1WA 2I1VB 4IJVA 2FWNA 4HDQB 1HT2E 2R9VA 4Q02A 2UAGA 2H2AA 4UVIA 3O8CA 4GR4A 1E6LA 4EB6A 1EFHA 3F4KA 4LCJA 4EX6A 3U16A 3VA7A 2PWAA 3D4NA 2H57A 1JTVA 3KTDA 4RWEA 3H5IA 4DQVA 1BJTA 5DMHA 5EHNA 2V7WA 5B1DA 1Y1SA 2BFMA 3P5BA 4FKBA 4W9NA 5M29A 2BLLA 2DQYA 3AHCA 2FGJA 2H1VA 3UMJA 5EP1A 4DNPA 5IRCD 1FFSA 1AKRA 4JDPA 1ZXXA 1GPNA 2BM8A 5I5GA 3CZ5A 1E4OA 3W4JA 3IHKA 5ES4B 3L79A 4H4CA 3UB3A 3GPBA 4D80A 1NXOA 4BE9A 1NBIA 1Z0AA 1W5EA 2EL9A 1KE2A 1E79A 5LZ4A 3DAGA 1XAGA 3K32A 4NS1A 3X44A 5CHYA 4YCAA 1Y7IA 2ASVA 1P8AA 5JAPA 4RSRA 5DNDA 3BFKA 4IXTA 2LRHA 5KYTA 3BKXA 5FHQA 4TVKA 3V6MA 3E5NA 2ZYRA 3UK2A 4BFCA 1Q1ZA 2C92A 2VATA 1Y7TA 4KGVA 2Z3WA 4GLBA 1B23P 4N3NA 4IUCS 4YJFB 1EG7A 1HY3A 2JFPA 4WFKA 1FDVA 5K8LA 1XROA 4N47A 3WRWA 1RCTE 2GI4A 1U7PA 2GBCA 1ZZEA 2VRBA 5CBKA 1A9RA 1AM4D 5JJCA 3L8HA 1DL5A 3BTUA 4MYDA 2ODAA 1AXGA 2PANA 3JPYA 3KWFA 3BS4A 4JLDA 4CKEB 4ZJZA 5LYJB 1T1EA 2AZ4A 4JLKA 2OC9A 3U49A 3FFBA 4C87A 4Z6KA 1U0RA 1HEIA 3SX2A 4E7OA 1X38A 2JW5A 4Y7CA 2B78A 3SVZA 2NMVA 4OJMX 1M2OB 2V7EA 5CPFA 4DQKA 2QLFA 2ZIUB 2DFDA 2Q7XA 4PW0A 4BVEA 5KS2A 3I45A 3NJ8A 1Z47A 3TZBA 3RYIB 1V37A 1YAJA 3BXEA 3NAQA 4HQNA 1KDOA 1TCAA 4TLEA 4BLSA 3RTBA 4B6SA 1II8B 1Q0HA 4UUNA 4RDXA 2XGSA 3MMSA 3WMGA 4DW8A 1I0IA 2PRSA 2FWPA 4CMKA 2UYHA 2VNKA 4NARA 2GTPA 3MS7A 5L3SA 2PBLA 1JLLB 4QREA 4WADA 5G4KB 5LB2A 2VCEA 3VU0A 4EB0A 5A62A 5M04A 1VIVA 4QD3A 4I4TB 4XB6B 4J0EA 4DIDA 3W5VA 2Q2WA 3IKVA 2XQIA 3TG8A 5IU6A 3CR3C 4CQMA 1VGRA 2VDNB 2ZI4A 2XDAA 3ZE0B 3ZKAA 2GAAA 2ZCJA 2JVJA 2LBPA 1M2OA 4FHCA 2FX2A 4JJGA 5FWYB 3S29A 4DVJA 1TFUA 3VH4A 1OT3A 2VDQB 5AW1A 4B0PA 4LJ4A 5CLLA 3B1JA 1I7DA 2FW1A 4KBYA 4LRXA 4JENA 4HCJA 4X20A 3CA8A 4K9OA 2CNOA 2V0GA 4MJ3A 3EWIA 3KVYA 3MWKA 3V4ZA 1E4EA 4DR6B 4YDSA 4HRXA 5AW2A 2VDUE 4G6ZA 1J9GA 4QPDA 4YP5A 4MCJA 1WY7A 4MV4A 4DQ0A 1GL7A 4CEJB 3BK7A 1MIOB 2OZVA 1MJGA 3KZXA 4CVNA 5C80A 1AK1A 1CK4A 1PJQA 1V5IA 3QKUA 1GAWA 1IHXA 4AMBA 3TLGB 5C4MA 2P1DA 4ZK6A 2ZSKA 5JANA 1TVMA 1ESZA 3DE3X 1MFZA 3A6ZA 1DIHA 3L9XA 3EOBI 4K6HA 2W0SA 4FFLA 3RBVA 4BFUA 1EZ4A 3VYSB 5T8KA 4H35A 4OFWA 1KI4A 1DAMA 1FUEA 3SJUA 3EY9A 3FVQA 3VR5D 2PWZA 2V59A 1Q16A 2HT6A 2OFOA 5KDDA 2C0CA 1WMAA 1RBYA 2YHAA 4UTPA 2NV2B 1Q50A 3SC6A 5GJCA 3SYRA 2IV3A 4G67A 3W2TA 1E1MA 1Z5GA 3F4BA 3W9SA 3PE3A 1GHTA 3EAQA 3NT4A 1TDJA 5JAMA 4LX0A 2J8ZA 4HXEB 1QUEA 2P6UA 4MJLA 3PNVA 2I54A 4PGFA 1RLUA 5CCDA 5HWSA 5LKAA 4GBJA 3S1SA 2KM1A 2QTZA 3RF7A 4C4XA 5FR1A 3AVTA 2HJWA 4PLTA 1AGPA 3KKLA 3C6XA 4CQLB 4MMYB 4YAEA 4EA7A 1LK7A 5A4DA 1GRQA 1HDEA 1M9NA 1T8TA 2PZJA 3I05A 4J75A 4A5OA 3GRPA 4MYSA 4O4IF 4JP1A 2EFJA 1KY3A 4E5KA 1UWVA 4DBVO 3NHLA 1BWRA 4UMFA 1XRJA 4XWTA 3ZNNA 2PR7A 5GAJA 1UFKA 2A1IA 4MARA 4LCBA 4KN6A 2W6QA 3OCZA 5EUQB 1I5OA 4E5SA 2VXBA 3IQIX 3NWPA 2PX3A 1JR3E 4QPZA 1OX4B 1K6XA 3LYAA 4UHEA 5BRJA 1EK0A 1RQGA 3NLLA 1GGMA 3G68A 3RVSA 2DF8A 3IQEA 3D8NA 1HG0A 4HN9A 5K20A 4B9EA 2DUMA 2PTGA 1Y6FA 1AN9A 1TADA 2ES4A 2P9FA 3MCAA 4N7JA 4P36A 2PT7A 4JJKA 5AK5A 1RR6A 4ZEXA 1O0CA 4D45A 1F0KA 3AESB 3RTEA 3TEMA 1U28C 4YIHA 5AXBA 1N0WA 2YC4C 3U26A 4J7AA 3A7EA 5CFNA 1DQNA 1H6DA 1ODSA 3HH8A 1M1YE 5JWHA 1AKYA 4YP6A 3SC2A 4BXOB 3OC0A 4LJ9A 1IM5A 2CEKA 4ZT2A 2GKOA 1V16B 4AJHA 4BASA 1KQ3A 9MHTA 3DOJA 4JP5A 4NX2A 2X9NA 3M3HA 3N0XA 2QHXA 2WABA 1HM5A 2C1EA 1L7NA 3MLEA 3FNBA 3M1YA 4ZVSA 2AOUB 2BUBA 1XD9A 1K6JA 3HKDA 2YW2A 4IXNA 3CGWA 2PSSA 1XZAA 1TCVA 3AK4A 4POAA 4CFYA 1L4HA 2P77A 2VK8A 1S2NA 2Q21A 2VQDA 1T9AA 3CUVA 3QPCA 3HWX1 3B5EA 4N12A 1G20B 3B3GA 2PSFA 4ZU1X 3TJMA 1DTEA 1CEQA 2F4NA 2UXBB 1W35A 2AG6A 3HFJA 3HUFA 2OCLA 1J99A 4P7GA 1E99A 3U39A 2C2XA 3DVSX 4I1VA 2BIFA 2RGCA 3DDNA 2XYHA 3TLCA 4PHFA 4RD4A 2DR0A 4D6PA 1Q7RA 1JJAA 5IHXA 4D3DA 1RNLA 1VKHA 2IUEA 3TRDA 5A4FS 3MUNA 3RJ5A 5ADHA 1HMPA 5EIHA 1W5FA 3WNVA 1UXJA 1AXRA 1QO7A 2UZ1A 2GEKA 1JQBA 1JG6A 3FB4A 2ETXA 3DF7A 3I6QA 1RXIA 1TRKA 4EHJA 3VX3A 4Z4GA 1JDZA 3Q9UA 2QW8A 3LT1A 1B15A 4WN3A 3LSTA 1FB5A 5EMHA 3H65A 4BWYA 2CDRA 4EJSC 1DCFA 1FUKA 3DGEC 4LI0A 4AY4A 5EZ5A 3WWOA 4QG7A 2REOA 2Z2XA 3AR4A 3FZYA 4NIMA 4DQUA 3HP4A 4Q1DA 1C3OB 2HFKA 5LLTA 4RHEA 5JWRA 3KE9A 3KQPA 3WAGA 4JNKA 3WIUA 2M9MA 3KO8A 2GXSA 5EXTA 1IXZA 3ZJ5A 1DKMA 1PE0A 1PRYA 1E6WA 3QPBA 3CBGA 2HXYA 3PEUA 4HUQB 2KE5A 4LA4A 1F48A 1FPQA 4XLZA 4MQ5A 1PR6A 2P6MA 3PFHA 3SSOA 5U9CA 3HHPA 4KGXA 2O54A 1Q74A 1T9CA 2BMWA 4CM6A 2GPJA 2NW6A 4TUYB 3T94A 2FR8C 2OV4A 3EK2A 3CEHA 5A0TA 1W9MA 2EFDB 2IHTA 3OZDA 3S2EA 3OVMA 1YB5A 3GBSA 5HKLA 3U7JA 1G291 4MYCA 1VL6A 2YDXA 5K8VA 1FSSA 4O4JF 3PQ8A 4EOGA 1TK3A 1SQFA 4WASA 3WLTA 1KMMA 1DUSA 1F1JA 1GQQA 4CCAA 1NZDA 1HO3A 1E6UA 2QVXX 2VK2A 2PH7A 4FE3A 1BXGA 3BBPA 5ICGA 1DRJA 2JGDB 2WIBA 1JG3A 1NURA 3CUKA 3FHLA 5KSZA 3DBIA 5I9IA 5LQMA 5A06A 3WGYA 4DE5A 3MFYA 1TI7A 4QEDA 4QLBA 2WD7A 2VYFA 3E0QA 4E12A 5JJKA 3KHTA 2KW5A 3OT5A 1X1CA 3O21A 3TUJC 4FN4A 3OZXA 1JQDA 2PEYA 1L7BA 1AGRA 1ZW6A 3IDFA 2I22A 2YN0A 4UOZA 2EBHX 2BM0A 3PWZA 2JIRA 1T5OA 5AI5A 4E4RA 4HB4A 3GFGA 4HUTA 3SS9X 3M49A 3THWB 3AJAA 2HO5A 2QM0A 1AH2A 4L2IB 2P90A 2W2QA 1ZQ9A 4I4LA 4BJ3A 2VIIA 4C88A 3QJ5A 2NUPA 1DPGA 4XVHA 1VFPA 3UICA 4YJHB 3KTFA 4HNAB 2JA1A 3WIBA 1T8UA 1XQ1A 3L49A 5ALXA 1ISFA 1FYDA 4W7HA 1BZYA 1QIHA 2O9JA 1QXSA 3OFJA 4YTEA 3HYLA 4HTFA 1VLMA 2WSIA 4JUAA 4NECA 4ENPA 4WLOA 1DC6A 1D2CA 4OX9Y 4OQPA 1KRWA 1C0IA 3U2QA 1NI5A 1XK6A 1PQYA 1Y9AA 1NBAA 1UJCA 3LA8A 2GHQA 3WGJA 2HPAA 1QFZA 2BEUB 2IZ6A 2MSLA 3GJ4A 4UCQA 1QO0D 2PMFA 1L4YA 3CSDA 2EX0A 4RJKA 1QP0A 3GQBA 3W3ZB 1YJCA 3D1LA 4G81A 2QRKA 5ER9A 3KZVA 1TKBA 1L1QA 1TEXA 1N2HA 1W44A 3U9SA 1A96A 4AD8A 1IBKB 3TNYA 4M22A 4Z4EA 4A16A 1U1EA 4JQYA 4LZLA 4FHZA 4CL8A 4ZJUA 4HNVA 1CY7A 3JALA 4F2DA 4ZXFA 1DQRA 4LXIA 1XMQB 3O8OA 1L4NA 1XF9A 3KQLA 3SXJA 3RJTA 1RHMA 4XUEA 1FU7A 3UA3A 4RS3A 1LB1B 3S6JA 1OTHA 4HN2A 4IDOA 1G8YA 5TMEA 2Z5LA 4B80A 1C0KA 4X62B 1ZMXA 2FP3A 1Z5UA 2XXAA 3NVMB 1K97A 1ZUWA 3TCKA 1CXZA 5E4FA 1LPNA 3DF9A 5HF8A 4TKVB 1EFAA 2NP7A 4RF3A 1XC7A 2RARA 4RF4A 4C7BA 2RH8A 4HEHA 4TYYA 4BZPA 4E2YA 3M2PA 3O4GA 2GCIA 4AG3A 1ZQ1A 4AP9A 4MGEA 1IB0A 5JDCC 3WLNA 1ZH6A 3GV0A 1JAIA 3I5MA 1SXIA 4FVTA 3MB8A 2CHGA 2WD8A 3ZWDA 3NUZA 1E2GA 1YI0A 1MH9A 1Z2NX 1RJWA 2FPXA 1H65A 1UDXA 1N2OA 3HS3A 3TSWA 4MV9A 4PAMA 4BQEA 4V3BA 4EM6A 3PYLA 3BIJA 2IJGX 5K8IA 4FDAA 1KJ9A 3HNPA 3PNLA 3VM6A 2H4FA 2DZDA 2GA9A 3FUUA 2AVNA 4AWXA 3JWEA 4HLUC 2X6QA 1KY4A 3NWBA 4D9NA 3CF0A 2BGRA 1G64A 1SBYA 3F7TA 4WA7A 1X1DA 5DGXA 2G88A 1I80A 2Z30A 3ZJ4A 5C51B 2VHJA 4UW9A 4ZD6A 4CETA 3ROZA 4UC0A 1PHPA 3D4OA 2RG1A 1A4XA 1QYRA 4R81A 4CDGA 2PKWA 1N32B 3UMBA 4S12A 4UM9B 5E3JA 1JZTA 3EFOB 4FFBB 1ILWA 4RAOA 2B8NA 1KAGA 4BZQA 4FD3A 2Z6QA 1BHSA 1BN7A 5ED4A 1G9XA 1Z8DA 3BEDA 4COKA 3PXBA 2QS9A 1Q3HA 5AJWA 1HI9A 1W52X 2X15A 4DQLA 4MWGA 1LX7A 1XRSB 2CFCA 2HA4A 4OB8A 4P0TA 5I51A 4I6JA 1NC3A 1W87A 4G2TA 2QLLA 3O8BA 5GIOE 4OXQA 2MSKA 1SUFA 4P3KA 4ZCQA 4PVDA 4X85A 3K1JA 1Y3HA 2DKFA 4QQRA 3EIEA 4HBZA 1C4OA 1DUVG 1NM5A 4J1QA 1DUIA 2QG4A 1Z37A 3E1GA 3S7TA 3BF8A 4HJXA 1S2GA 2YC2C 2E4XA 3UV7A 1QP7A 1R00A 4JC8A 2AC7A 4OLAA 5TEVA 1X9GA 1A2QA 3VUEA 4HYQA 4XIIA 2E6UX 4CBVA 2NXNA 1Y1LA 3GJ5A 3B85A 1RLMA 1YIAA 2IOQA 3COYA 2B21A 1K7EB 4KXVA 4WNAA 1E0DA 2FG5A 1P8JA 2L82A 4HVLA 1IVNA 1EA5A 3WMRA 4PIPA 2F67A 2GEFA 4Q4DA 3O8RA 2QPLA 4RY9A 3WHIA 2BGIA 4GVPA 2CEAA 3V7FA 4HV4A 3PNKA 4LXTA 4QOJA 2I4MA 3NRJA 4CN9A 2CJWB 2CZQA 2QVLA 3IPRA 3MJDA 2H0RA 2OMEA 4P5PA 4ESVA 3IJEB 4YYEA 2ZJ7A 4OHFA 2F9LA 4LVNA 3KEFA 5E2IA 3U40A 1EFVA 1H85A 3JZFA 3EZFA 1L7VC 4XDHA 3H2GA 5M2QA 1OZAA 1TJNA 1E2QA 3BSFA 2XEDA 3LQRA 4P4UA 4JBGA 4D43A 1JSRA 2RAVA 1H2ZA 1X8JA 2ZUUA 3OIFA 4LOKA 4MW2A 3PS9A 4QBTA 3VC1A 2I6SA 1DXYA 3NTXA 5C8VA 1PWZA 821PA 3GLFE 1L5QA 3SEFA 2I99A 1PDOA 3AI3A 1J09A 4UXHA 3PNQA 4OP3A 4QE3A 4XDYA 4IDDA 3IV6A 4KMMA 1FXWA 2F3TA 3OQIA 1Y81A 3OT1B 3CU5A 3WL3A 1USIA 2RBGA 1U90A 4EA6A 4DTIA 3V7YA 1EWRA 4W5NA 2C4KA 3PICA 6PFKA 4DV6B 4EGSA 2AXEA 4IKEA 5DGCA 4CDNA 5CCEA 3BTSA 3OX4A 4LYGA 4PTYA 1NNSA 1JHYA 2VCYA 3GD5A 3ROEA 1NN0A 2WR8A 1UANA 1Z5OA 4C30A 4CKWB 2UVQA 3K30A 2ZTSA 2EG5A 3NTRA 4E07A 1J25A 1M1UA 5A5VA 1A76A 3V34A 3AG6A 3HC7A 4QBIA 4F45A 2PGOA 3FPGA 4L28A 3KEQA 5BQPA 2V1UA 3DZHA 1OX5A 3VR0A 4R2JA 2JVIA 2BM1A 1YR3A 2FSGA 3TX2A 3TLYA 1NJSA 4GX1A 4QYWA 3OH8A 3OX2A 4XIYA 3IIJA 4ABTA 3EPRA 4HMPA 1V9SA 2IODA 3IAHA 2E1RA 1S7CA 4JASB 1CT9A 2XCUA 3MD9A 2A86A 5L4LA 4I1PA 1U5CA 4AIIA 4EYGA 2R6AA 3ZUGA 1WDMA 2EW1A 4DLYA 4KMSA 2P9CA 4H77A 3ZIDA 3KJZA 5HTKA 4IG4A 2A1TS 2Q3EA 1HEUA 3KX2A 3EWSA 4BQNA 3LT0A 1OLSB 3ZEAA 1Q1NA 5I4CA 2AN1A 1ZAYA 2EDCA 4PZLA 1M34A 1H4SA 5BXQC 4A8JC 2GSDA 2VUUA 2ZT8A 3I9NA 5I7WA 4X8OA 1YE3A 3QKTA 5EPOA 4RY2A 3AF5A 2HI0A 3H3FA 1RPJA 5ITWA 1JLSA 1H22A 1CY1A 1WSAA 4P7KA 1G5FA 3JZAA 4M88A 1O1YA 2ZRFA 3R20A 4FFNA 3NHZA 5I7AA 2ZS7A 3O1JC 4RD0A 4BQPA 1SKYB 4TL7A 1E0AA 1GAJA 4J1TC 3I6ZA 3ED1A 5E6RB 1MIHA 3A9TA 1FOEB 1QH1A 4U9IS 4Q66C 3H2JA 4HDMA 3DEKA 1ECPA 4HSGA 3B6IA 3DLPX 3LMKA 1EUYA 4R7GA 4DMLA 5TC4A 4EY3A 4D9MA 3LC0A 1MA0A 1NULA 3NTUA 2Q7DA 1E2MA 4Q1CA 4M89A 2AUMA 5ERGB 1N9GB 4FI3C 4GOJA 4ZEOA 1XELA 3ZBUA 1ACLA 1K4YA 2P3OA 2PX6A 2P2ZA 1BS1A 3NKLA 4GXRA 4H1HA 1MW8X 3OIVA 5F98A 1E2NA 1E2LA 1LNZA 1Z6XA 1GGJA 2NQ2C 3L01A 4MB6A 1U99A 1GSIA 1H6AA 1UZUA 3ESCA 1QU2A 5F51A 2PKRA 1BKYA 1IHOA 4KPYA 5SICE 3KYJB 3IB6A 4QOFA 3RTDA 4DCNA 2FXVA 1XWFA 3RUIA 3T1VA 2ZKIA 3KFVA 5CVCA 2W90A 3HCCA 4YAJA 4YA6A 2HLDD 4Z1MA 4CKCB 3CX3A 1U6IA 4RF2A 3GCXA 1SOAA 5D1HA 3DL7A 4EDHA 1QYXA 2ZBRA 1LUAA 3FMOB 4P6VF 5GJWC 1APBA 3GMIA 1CFZA 5F12A 4NU0A 2XA9A 1ECBA 4GFDA 5DBGA 4J2TA 4NYIQ 3DTNA 1Q92A 5LQSA 5JMOA 3R3JA 2D5AA 4QUJA 1WR8A 2ZAIA 3UT0A 4A8HA 1CB0A 2IRWA 2PBFA 3BCSA 3CJRA 1I10A 3N74A 4OBBA 1PNVA 4GOMD 1BMDA 3ODPA 2VJAA 2UV8A 4LXXA 5IT0A 2D6FA 5DNYB 3C1OA 4M60A 3RUCA 4DY4A 4I3GA 3T1TA 2OV3A 1F2TA 2QRLA 3KQMA 1EJ2A 1ETUA 3AX6A 1JQ3A 2QKYA 4L4ZA 1Y7HA 2Q9UA 4OKNA 3AR6A 5FUVA 2JANA 4MB0A 4LTNA 1XTZA 2FP4B 1SVMA 3LL4A 4WINA 5EE0A 3TMKA 4DXDA 4UTNA 1LBSA 4JCCA 2QX8A 3B60A 5CT8A 2V8OA 1NQVA 2W2VA 1NFQA 2YJ3A 4E1BA 2WQ7A 3MW8A 2YXLA 4HGRA 2GZAA 4ZVQA 2QPTA 5KOHB 3H6KA 3REGA 3WMEA 5AFSA 5E7QA 3DOIA 1XZIA 3WYEA 4E4TA 5KAPA 2F1KA 2HNKA 4IFIA 2WJ4A 3T0GA 2A7QA 7MDHA 1MGPA 3VHRA 2ID4A 2XITA 4HVAA 4RIHA 4P82A 2OCXA 1X19A 3D2LA 4Q7EA 4H3KB 4B46A 5JOQA 5DX1A 1FTQA 2IHBA 2P9JA 3QVVA 5I47A 1HDYA 3DHEA 5AK6A 1RTKA 4YMHA 3TBFA 5BQOA 4ER6A 2GFHA 1KVTA 3KOXA 4CMGA 1L5WA 1B3BA 3WZ2A 4OLHA 4QDKA 4ZFNA 2J4CA 2XUDA 2A3RA 5CURA 1ZRNA 4DIBA 2PUAA 1VIAA 1JHUA 1FP6A 1QYDA 4I8DA 2IYAA 2H1LA 3QH4A 3GB9A 4JJ6A 5FUBA 4BBJA 5EJ4A 1RKUA 4QTTB 5AJUA 4KPGA 1XL1A 5TVGA 3R7FA 3A1TA 2O0LA 4MQMA 5EE1A 1V5FA 1Y98A 1JG7A 4WCFA 3KWJA 3UKDA 2VRCD 3C6QA 2GBLC 2DTEA 3IAS6 1JXMA 2CXXA 3VTKA 3O82A 5DNAA 5ITSA 1G42A 1K2WA 3G17A 5J2TA 1YWGO 1RHKA 3NTOA 1BVYF 1TF2A 2H31A 3H0CA 4DA4A 5IBCA 1NX9A 4F71A 5CYGA 4XCQA 3AL0C 1C9NA 1YA4A 1E5XA 2ZRDA 4EUFA 4KK4A 3HB1A 2YV5A 3TQFA 1G9SA 1PYGA 4MYRA 4H4EA 3GLFB 4HRVA 2QN3A 2XNDD 1WQ4A 4NJMA 4YV0A 5IDQA 5I9NA 2XRZA 2PTHA 1P6QA 2XKJE 4FTWA 4YXWA 4E46A 3ADCA 1H0SA 3RO7A 4CDRA 1P6UA 3TW0A 1N77A 3TXYA 1AHPA 3IP7A 1G20E 3S2ZA 1M2WA 1XVVA 1XALA 5F1OA 3T3PB 3LP8A 3W6PA 3P71T 2DUUA 1L8LA 1OVMA 1R8QA 4LF9B 2QTCA 2FHSA 1JR4A 4BN0A 5LLDA 1JKMA 1K75A 1J7KA 4IGAA 2GF2A 2IPAB 3ZDRA 4RTOA 5G0SA 4AZ3A 1D0VA 1ACJA 3T06B 4E33A 1E58A 1JEOA 1TVCA 4NAUA 1J8FA 2IYUA 3ENQA 2HA0A 3EY4A 3ZGXA 2EIXA 3CVUA 2C20A 1E63A 2B2NA 4GKJB 4DILA 4GR5A 1UDAA 1VCNA 4L6AA 2QY6A 3RC1A 1U3GA 3BD7A 1QX4A 4OQYA 5BV1A 1BS9A 3JQ9C 2CK3D 2CFRA 4MVWA 3I1IA 1ZIYA 4G5HA 4OUKX 5AH0A 3ZZNA 3PPIA 3MS2A 4AJEA 1IAVA 1KNXA 1W1UA 2A14A 1XQ9A 3LPDA 3PX3A 3LV8A 4LC9A 1NTOA 4UZEA 1EE1A 5LBTA 1KSGA 4X6LA 1DHRA 2CUTA 2OT3B 5ANRB 3DEHA 5A7GA 1NAIA 1WPRA 2IUSA 1SCUB 3NP7A 4M0LA 1ZJZA 1OTXA 1PG2A 1WMEA 1X7YB 1ISJA 4OHPA 5B4VA 4NCBA 3LZCA 1LDEA 4G2NA 3VYTB 3QVXA 2C9DA 3MIIA 2JEYA 4W8OA 3ESAA 1FMLA 2BI7A 4JELA 3ASZA 4E2WA 5K3OA 2JASA 3QSYA 1V2HE 4HNQA 4HWTA 5AJYA 4CU2A 3OX3A 4EW6A 5DIFA 1OCEA 3G9TA 1SVLA 2IYLD 3PENA 3EVNA 2B4QA 3PGVA 5ES3A 1HH4A 4BJ6A 3K20A 2JFVA 4LF8B 1GUYA 2QD5A 4MX8A 3AM3A 4WAUA 4YAWA 4NXMB 1K3UB 4XYEA 5IXJA 1ISIA 3HCPA 1DV2A 4UTZA 1UBEA 1W0KD 5D7BA 2QAGB 4UU8A 1RFGE 2VNSA 1SURA 4GLLA 2DC1A 4L5BA 4Q9AA 4AAYA 5FTWA 4BNJA 3LX8A 3VH1A 1GGFA 3K5WA 5JJBA 3L8CA 5ISMA 1B0AA 5FQOA 1OC2A 2BH9A 3OLQA 5CYPA 4DMMA 2OESA 2PRZA 5JDIC 5IM5A 4IWXA 1CJUC 4MKHA 3RRYA 4LISA 1QOZA 4YV7A 1V5EA 3OPNA 2FRDC 3DKRA 3IDOA 2J7PD 2N42A 4KLAA 2A5YB 4D4KA 5J47A 5GONA 3CMMA 1OWOA 3R7DA 4QBGB 2ZCUA 3BDVA 1XDZA 4KAXA 3O9MA 5ESDA 1CYDA 3OOSA 3QTTA 2DUJA 5CB6A 5AM0A 3OZTA 4ASUA 3P0IA 4ILEA 1JIKA 3HU1A 4XIFA 5HVNA 2Q6VA 4UU0A 4EMUA 3RRNA 1PL7A 3LY7A 2G6TA 4J4BA 3WADA 2EDAA 2O7SA 3NHJA 3K8OE 1EM8A 5JY1A 2IYTA 3Q7TA 3V1NA 2Q5CA 1TM5E 3JD3A 3NT2A 5KI6A 3IHWA 3VGJA 1IJKA 3GCDA 1Y4SA 3MTDA 1A2BA 2FLVA 2GRJA 4FUTA 4CR7A 2QT9A 3DW3X 4KV7A 4EHBA 1U8FO 2YXBA 1V48A 3FYHA 5BUSA 1YQGA 3SZRA 1OYVA 1Z0SA 5LDHA 3TGPA 2VJMA 1CZRA 2W9XA 4YCSA 3IUQA 2KQUA 2JKVA 4UM8B 5EQJB 1QTNA 1TXGA 3S1AB 3TNLA 3FSEA 3SX4A 3AHFA 2AB0A 1PSDA 4JSYA 5JSQA 1TRHA 2R4UA 4BUJA 2WWYA 1NNUA 1SCIA 1IK6A 4DC0A 3FLMA 1WD7A 1ZWKA 2NPFA 4HGOA 1JBKA 1IOWA 3BF7A 1NNEA 4FYJA 4JLSA 2HBRA 4HYTA 3VV2A 1EIWA 3A3OA 3OTWA 3PCRB 3DFIA 2H2GA 4N0QA 1MC4A 5T8KC 4LQCA 5JEDA 1R18A 4NOKA 4ALNA 1CZNA 2FUCA 2H59A 3A4NA 2HUNA 3G8DA 4HDKB 1Y33E 1Z88A 4QUDA 4WVFA 4PQFA 4WOPA 2C57A 3B38A 4BO4A 5AD1A 2BL4A 2JI8A 1GY8A 2C8VA 2GD2A 3DEFA 3NIGB 3KYBA 4DKXA 1JT9A 4DDTA 1TNDA 3T9DA 3GCWA 4ZPJA 3KPUA 2Q6OA 5L7WA 1SIWA 1FIUA 3E3OA 4WXEA 1X39A 2WILA 3BERA 2Z6UA 1UK9A 2CNKA 4LAFA 3DZCA 4C05A 1HOXA 4L3WA 4GC5A 3RVJA 1IQRA 1MPTA 3DXZA 4C5AA 1CZOA 1KO5A 3RK0A 3SYKA 2FMKA 3DDWA 4KNWA 1BA2A 2WUVA 3B52X 3A6GA 3Q0IA 1EPUA 1WUJS 2VP4A 4XOIA 1U0NA 5CFOA 1I4LD 3HDVA 1FX1A 4QQ8A 1CKEA 4XFDA 4FDUA 1QQ5A 1D2MA 1CZKA 2C4HA 3GWZA 1UDBA 2O2ZA 1C3VA 4D4IA 1J0BA 1NUPA 3OSZA 3VDNB 1G18A 5ALQA 1KFEB 1KPHA 3ZHTA 2XSZA 2J9FA 3NBAA 2OQIA 4DN6A 1DG3A 1XHFA 3ENKA 4H7PA 1CJBA 1QLJA 2OO7A 5EJGA 1O08A 4ZAFA 3CZMA 2QN8A 4QT0A 1FSFA 1YJBA 2GFIA 3L7LA 3LKDA 2C2WA 4B35A 1N0IA 3LUFA 1U7TA 1WB6A 2QNRA 3GGSA 1ZRSA 3NVAA 3B89A 1P0MA 3DPUA 3O7WA 3SFVA 1E77A 2RJOA 2WHRA 2EAUA 3WL8A 1CUZA 1X7XA 3ZZTA 7REQB 4ALLA 2AJ8A 5EMKA 1Z8HA 4ERNA 5K0EA 4H27A 2XJ9A 4WZBB 5C1OA 3LDUA 2GZHA 2LCQA 4QYXA 2EKPA 4KRXA 3WS7A 5GV8A 6CHYA 4S2EA 3OMWA 1U0HC 1V1MA 4YBZA 1NBWB 4TLMB 3T4UA 3ACBA 1GOTA 3HYTA 4PM4A 3FYUA 4I19A 1D0IA 3SR3A 1YS1X 3F6CA 1JHXA 4KWIA 4P98A 5CU7A 4AECA 3DFKA 4H7HA 3R6GA 1GIAA 1A5BB 3U3RA 3FWKA 5D3QA 1Z4LA 1KZHA 3W6ZA 1WZCA 3OF2A 4MTCA 4WK4B 3ETGA 2CNWA 1GZ6A 1SXJE 1X8LA 4I4TF 3VRHA 4CQJA 4O3FA 4UBKA 2DBRA 3KL2A 4GVLA 4DNXA 1B8UA 3EHDA 1VMKA 3OJWA 1P5ZB 1R4MA 3GJ3A 2RFLA 4D3FA 5LR6A 2RBKA 2B83A 3A8TA 3KLNA 4TL8A 4JUFA 5FWAA 1NBOA 1MT0A 1JL3A 2VOJA 3OA0A 3PUZA 3AYZB 4K9QA 4NJEA 4P2GA 4QEZA 3TLAA 3HRIA 2J3JA 3P9IA 4IIJA 1BHJA 1P29A 3SD7A 5LOVB 2RMKA 5TGDA 1UT8A 4OHKA 1G19A 4DMUB 2VJOA 4RV5A 2HMVA 4DIKA 3DFZA 1YQEA 4Q16A 1KDZA 2ZUEA 2E2WA 1QV6A 1WEHA 2EZTA 2NTYC 2OE2A 2ZWPA 1DC4A 2XCTB 3OFNA 4N5HX 5FDFA 2EIHA 3DTTA 1JF8A 1PQUA 1Y7PA 3JQCA 3LUPA 1OQAA 2JCSA 4X1KA 1O4WA 4D8WA 4HDOB 3CY6A 1UOOA 4I5EA 1U81A 4KAJA 3K70B 1IEVA 3WLRA 4L08A 2N1MA 3V2IA 4UDNA 4HVCA 2UUOA 2R86A 2LKDA 4AMGA 3U7HB 3MF4A 1IUNA 1E1RD 1ZNYA 1FNNA 2HREA 2XHZA 1AK2A 3MTGA 2P6NA 4IKPA 4N01A 4O02B 4ZQHA 4F3YA 1SUAA 4IDNA 4EGQA 1RMYA 2PS0A 2QUJA 3FFAA 5FPKA 3DBRB 3UK1A 3H8JA 4RTPA 4DNFA 4QUIA 3WNBA 1OA0A 1B0UA 4ZEMA 1NHGA 4PNPA 3TZKA 3EC1A 1X7YA 4ZK2A 3DO5A 4TMZA 1F8UA 1I7LA 4R9VA 3GK3A 2GA8A 3TB4A 3UXYA 1BWPA 3L0BA 2H4XA 2AOXA 2W37A 4HF7A 2XDQB 5L4NA 2UVPB 1P1BA 1PGPA 2X2OA 3D4LA 3G3EA 4YHHB 2GF0A 1QZZA 3A26A 3HJFA 2CYBA 5JU6A 5K6AC 3KJFA 3FRHA 4L9AA 3I8OA 1LDNA 2E4VA 1K88A 3E9NA 3FPAA 1YQDA 3A2LA 1HG1A 2IW3A 3MRVA 4PLZA 1ZSYA 1TAHA 3FCYA 4TT3D 5A4IS 3D3QA 1HURA 1ODCA 1E1QD 2R79A 2BFBB 2VJKA 3GFTA 3R0XA 3LPNA 4UAGA 2QLBA 1JXAA 3OZ7A 1XMVA 1BC5A 3KBOA 4PWZA 1UM9B 1WW8A 3EG5A 4O4IB 4X97A 4B2LA 2QEQA 3K8ZA 2P27A