4EULA

Crystal structure of enhanced green fluorescent protein to 1.35a resolution reveals alternative conformations for glu222
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
227
structure length
226
Chain Sequence
KGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein
publication title Crystal structure of enhanced green fluorescent protein to 1.35 a resolution reveals alternative conformations for glu222.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Fluorescent protein
total genus 66
structure length 226
sequence length 227
ec nomenclature
pdb deposition date 2012-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 4eulA00
4W6HA 2B3PA 1UISA 3BX9A 5BT0A 4EDSA 1EMLA 1H4UA 1GL4A 4PPKA 5HZOA 4H47A 3SSHA 4ORNA 2QRFA 3ZULA 3DQ9A 2DDCA 2A47A 2Q6PA 1XMZA 2V4EB 4KGEA 3WLCA 1HCJA 1B9CA 3PJ7A 4W7CA 4XOWA 3E5TA 4LJDA 2ZO6A 3CB9A 4NWSA 4GF6B 4DKNA 3OSQA 1Z1QA 1KYPA 1W7UA 3SVSA 3SG3A 1QYOA 3EVVA 1EMEA 1QY3A 2Z6ZA 3CFHA 3SSYA 4W6MA 2ZMUA 4DXQA 1JBYA 3H1RA 4W6DA 3DQ2A 3U8PA 2AWMA 4HE4A 2QZ0A 2HRSA 2VZXA 4IK4A 1YJFA 2QT2A 4KW8A 2DUHA 2HFCA 3NT3A 3SSTA 2VADA 1ZGOA 2WISA 2O24A 3CD1A 2RH7A 4W7FA 4Z4MA 1KYSA 2IB5A 5H89A 1Z1PA 4W7EA 2H5QA 3DQDA 3LS3A 3DPWA 2G6EA 5FVGA 2HQZA 5DPHA 3ADFA 1GGXA 3ST4A 3DQ3A 3LSAA 3EK7A 3GL4A 5DQBA 3SVOA 4DXOA 3SVEA 3KCTA 2OTBA 2H5RA 4IK5A 4Q7TA 2G6YA 4ANJA 2ZMWA 4XVPA 3DQNA 2PXSA 5H88A 3LVAA 3SG6A 1JC0A 5DTYA 4W74A 3DQ5A 4W77A 5EHUA 5DY6A 3SVNA 3CFFA 3U0NA 1G7KA 3EKHA 3SVDA 2H9WA 3LF4B 4W6NA 1RMPA 3DQMA 5HZTA 4W6RA 4JRBA 3CGLA 2FWQA 5HBDA 3AI4A 1EMFA 2QLEA 2Y0GA 5DRGA 4TZGA 5DRFA 1BFPA 2G16B 4W6PA 5DPGA 4W6UA 1Q4CA 1QYQA 2DUEA 4W76A 4JF9A 1ZGQA 2WURA 5HZSA 1C4FA 4W75A 3BXCA 1XAEA 2DUIA 3DQFA 4TZAA 4J88A 4KAGA 2OJKA 3DQ4A 5LK4A 3DQ6A 1RM9A 2Z6XA 4JEOA 2O29A 4R6DA 3GEXA 3SG4A 2GW3A 2FZUA 2HJOA 5DPJA 1RRXA 5DTXA 2HGDA 4JGEA 3VHTA 3K1KA 4Q9WA 2WSNA 3NF0A 2AWJA 3OSRA 1Q4EA 4W7AA 1S6ZA 4XGYA 1EMMA 4AS8A 3SVUA 3WLDA 2QLGB 3G9AA 2DUGA 4W6SA 5HGEA 1QXTA 5BTTB 3SSPA 3NEDA 3U0KA 3EVRA 3DQHA 3CFAA 3DQUA 3DQ7A 2Z1OA 5DU0A 2YDZA 2A53B 3W1DA 4W6JA 2EMNA 1XSSA 3NEZA 3DQEA 4H3MA 3V3DA 1YJ2A 1OXDA 4IK8A 3DQOA 2G6XA 2OTEA 4JFGA 5DQMA 5T3IA 3CBEA 3BXAA 2VVIA 4LJDC 1Q4AA 1XQMA 4W73A 3SG2A 1EMCA 4H3NA 3TMRA 3DQIA 3ST0A 2HQKA 4IK3A 3DPZA 2OKYA 1W7SA 4EULA 3TMTA 2DD7A 4LQUA 2WSOA 1MOVA 4PPLA 2GX2A 3LVDA 2H6VA 3O78A 5FVIA 4HVFA 2IE2A 3VK1A 2EMDA 3EK4A 3IP2A 4IK9A 4P1QA 4ZBLA 3RWTA 3ST2A 4B30A 3SSLA 5DPIA 2IOVA 4DXIA 4AR7A 4OHSA 2HCGA 3LA1A 4RYWA 1RMMA 3DPXA 3GB3A 3OGOA 4ZF4A 1F0BA 3AKOA 1ZUXA 4L1IA 2YE0A 5EB7A 3SVBA 4KPIA 3SG5A 2H5OA 2OKWA 4P76A 1ZGPA 4PFEA 1CV7A 3A8SA 2BTJA 2QLIA 3E5VA 2A54B 3VICA 2WIQA 3M24A 4JC2A 4ZIOA 4DXMA 1JC1A 3ZUJA 2YE1A 4W6GA 5AQBB 4Z4KA 5EXCI 2A50B 4Q7UA 2V4EA 3I19A 2P4MA 2DUFA 2AHAA 4W6LA 1GFLA 4KF5A 1KYRA 3MGFA 4L13A 4DXPA 1W7TA 1YHHA 2WHSA 5LTRA 4J8AA 5EJUA 3EKJA 2A46A 2EMOA 3SRYA 3IR8A 4B30B 3DQAA 1YHGA 2IB6A 1XA9A 3AI5A 4IZNA 1RMOA 4OQWA 4OGSA 4LW5A 2G3DB 5HZUA 2HPWA 4KW9A 1YZWA 2QLHA 4HQCA 1Q4BA 1F09A 1EMAA 3EK8A 4L12A 3PIBA 3WCKA 4HQ8A 3KCSA 3PJBA 2ARLA 1OXFA 5J2OA 2G5ZB 3E5WA 2QU1A 2DD9A 2ZO7A 2HGYA 4H48A 3DQJA 1OXEA 2A52B 3SSKA 1EMKA 3M22A 2Q57A 4EMQA 2YFPA 4ZFSA 2VVJA 5H87A 2G2SB 4R6BA 1EMBA 4GOBA 2Z6YA 1JBZA 3O77A 5DTZA 1MOUA 4DKMA 3ZUFA 3SSVA 3BXBA 3DQ8A 2ICRA 2OGRA 4LJBA 5FVFA 3SG7A 1Q4DA 5EB6A 4U2VA 2H5PA 2GX0A 4OJ0A 4RTCA 2O2BA 4GESB 2B3QA 5FHVA 3W1CA 4OY4A 4B5YA 3VHTB 4W6KA 2H8QA 1KP5A 1H6RA 3PJ5A 3UG0A 3U8AA 2A48A 3DQCA 3GJ2A 2C9IA 3U8CA 4W72A 4W69A 3U0MA 4W7DA 3DQKA 4XL5A 3P8UA 4XOVA 3ED8A 4KEXA 3S05A 4W6TA 4EDOA 2VVHA 3EVPA 4RYSA 3SVCA 4W6OA 4N3DA 4H3LA 4BDUA 3SS0A 2GW4B 3GJ1A 5HW9A 3P28A 2AWKA 3UFZA 4HQ9A 5BQLA 2WHUA 4KA9A 3SVRA 1Q73A 2WHTA 2AWLA 4W7RA 3H1OA 1EMGA 3ST3A 4KF4A 4KGFA 4UTSA 4ZINA 4W6AA 2JADA 2A56B 4W6FA 5F9GA 3RWAA 5LTPA 1HUYA 2PXWA 4IK1A 5EXBA 3EVUA 3DQLA 1QYFA 5EXUA 4W7XA 2FL1A 3NT9A 4W6BA 1YFPA 3SV5A 4LJCA 4ZF3A 2VAEA 5EBJA 4W6IA 2QLGA 4J89A 5BTTA 4ZF5A 4EN1A 2POXA 3LVCA 4Q7RA 3CD9A 3LF3A 4LQTA 3U0LA 2G3OA 4PPJA 1MYWA 4Q9XA 2DDDA 4W6CA 4KW4A 2C9JA 5KTGA 4I2YA 2V4EC 3DQ1A 4KF5C 1YHIA 3ZTFA 4ZB1A 5LTQA 2AH8A 4DXNA 5DTLA
chains in the Genus database with same CATH superfamily
4W6HA 2B3PA 1UISA 3BX9A 5BT0A 4EDSA 1EMLA 1H4UA 1GL4A 4PPKA 5HZOA 4H47A 3SSHA 4ORNA 2QRFA 3ZULA 3DQ9A 2DDCA 2A47A 2Q6PA 1XMZA 2V4EB 4KGEA 3WLCA 1HCJA 1B9CA 3PJ7A 4W7CA 4XOWA 3E5TA 4LJDA 2ZO6A 3CB9A 4NWSA 4GF6B 4DKNA 3OSQA 1Z1QA 1KYPA 1W7UA 3SVSA 3SG3A 1QYOA 3EVVA 1EMEA 1QY3A 2Z6ZA 3CFHA 3SSYA 4W6MA 2ZMUA 4DXQA 1JBYA 3H1RA 4W6DA 3DQ2A 3U8PA 2AWMA 4HE4A 2QZ0A 2HRSA 2VZXA 4IK4A 1YJFA 2QT2A 4KW8A 2DUHA 2HFCA 3NT3A 3SSTA 2VADA 1ZGOA 2WISA 2O24A 3CD1A 2RH7A 4W7FA 4Z4MA 1KYSA 2IB5A 5H89A 1Z1PA 4W7EA 2H5QA 3DQDA 3LS3A 3DPWA 2G6EA 5FVGA 2HQZA 5DPHA 3ADFA 1GGXA 3ST4A 3DQ3A 3LSAA 3EK7A 3GL4A 5DQBA 3SVOA 4DXOA 3SVEA 3KCTA 2OTBA 2H5RA 4IK5A 4Q7TA 2G6YA 4ANJA 2ZMWA 4XVPA 3DQNA 2PXSA 5H88A 3LVAA 3SG6A 1JC0A 5DTYA 4W74A 3DQ5A 4W77A 5EHUA 5DY6A 3SVNA 3CFFA 3U0NA 1G7KA 3EKHA 3SVDA 2H9WA 3LF4B 4W6NA 1RMPA 3DQMA 5HZTA 4W6RA 4JRBA 3CGLA 2FWQA 5HBDA 3AI4A 1EMFA 2QLEA 2Y0GA 5DRGA 4TZGA 5DRFA 1BFPA 2G16B 4W6PA 5DPGA 4W6UA 1Q4CA 1QYQA 2DUEA 4W76A 4JF9A 1ZGQA 2WURA 5HZSA 1C4FA 4W75A 3BXCA 1XAEA 2DUIA 3DQFA 4TZAA 4J88A 4KAGA 2OJKA 3DQ4A 5LK4A 3DQ6A 1RM9A 2Z6XA 4JEOA 2O29A 4R6DA 3GEXA 3SG4A 2GW3A 2FZUA 2HJOA 5DPJA 1RRXA 5DTXA 2HGDA 4JGEA 3VHTA 3K1KA 4Q9WA 2WSNA 3NF0A 2AWJA 3OSRA 1Q4EA 4W7AA 1S6ZA 4XGYA 1EMMA 4AS8A 3SVUA 3WLDA 2QLGB 3G9AA 2DUGA 4W6SA 5HGEA 1QXTA 5BTTB 3SSPA 3NEDA 3U0KA 3EVRA 3DQHA 3CFAA 3DQUA 3DQ7A 2Z1OA 5DU0A 2YDZA 2A53B 3W1DA 4W6JA 2EMNA 1XSSA 3NEZA 3DQEA 4H3MA 3V3DA 1YJ2A 1OXDA 4IK8A 3DQOA 2G6XA 2OTEA 4JFGA 5DQMA 5T3IA 3CBEA 3BXAA 2VVIA 4LJDC 1Q4AA 1XQMA 4W73A 3SG2A 1EMCA 4H3NA 3TMRA 3DQIA 3ST0A 2HQKA 4IK3A 3DPZA 2OKYA 1W7SA 4EULA 3TMTA 2DD7A 4LQUA 2WSOA 1MOVA 4PPLA 2GX2A 3LVDA 2H6VA 3O78A 5FVIA 4HVFA 2IE2A 3VK1A 2EMDA 3EK4A 3IP2A 4IK9A 4P1QA 4ZBLA 3RWTA 3ST2A 4B30A 3SSLA 5DPIA 2IOVA 4DXIA 4AR7A 4OHSA 2HCGA 3LA1A 4RYWA 1RMMA 3DPXA 3GB3A 3OGOA 4ZF4A 1F0BA 3AKOA 1ZUXA 4L1IA 2YE0A 5EB7A 3SVBA 4KPIA 3SG5A 2H5OA 2OKWA 4P76A 1ZGPA 4PFEA 1CV7A 3A8SA 2BTJA 2QLIA 3E5VA 2A54B 3VICA 2WIQA 3M24A 4JC2A 4ZIOA 4DXMA 1JC1A 3ZUJA 2YE1A 4W6GA 5AQBB 4Z4KA 5EXCI 2A50B 4Q7UA 2V4EA 3I19A 2P4MA 2DUFA 2AHAA 4W6LA 1GFLA 4KF5A 1KYRA 3MGFA 4L13A 4DXPA 1W7TA 1YHHA 2WHSA 5LTRA 4J8AA 5EJUA 3EKJA 2A46A 2EMOA 3SRYA 3IR8A 4B30B 3DQAA 1YHGA 2IB6A 1XA9A 3AI5A 4IZNA 1RMOA 4OQWA 4OGSA 4LW5A 2G3DB 5HZUA 2HPWA 4KW9A 1YZWA 2QLHA 4HQCA 1Q4BA 1F09A 1EMAA 3EK8A 4L12A 3PIBA 3WCKA 4HQ8A 3KCSA 3PJBA 2ARLA 1OXFA 5J2OA 2G5ZB 3E5WA 2QU1A 2DD9A 2ZO7A 2HGYA 4H48A 3DQJA 1OXEA 2A52B 3SSKA 1EMKA 3M22A 2Q57A 4EMQA 2YFPA 4ZFSA 2VVJA 5H87A 2G2SB 4R6BA 1EMBA 4GOBA 2Z6YA 1JBZA 3O77A 5DTZA 1MOUA 4DKMA 3ZUFA 3SSVA 3BXBA 3DQ8A 2ICRA 2OGRA 4LJBA 5FVFA 3SG7A 1Q4DA 5EB6A 4U2VA 2H5PA 2GX0A 4OJ0A 4RTCA 2O2BA 4GESB 2B3QA 5FHVA 3W1CA 4OY4A 4B5YA 3VHTB 4W6KA 2H8QA 1KP5A 1H6RA 3PJ5A 3UG0A 3U8AA 2A48A 3DQCA 3GJ2A 2C9IA 3U8CA 4W72A 4W69A 3U0MA 4W7DA 3DQKA 4XL5A 3P8UA 4XOVA 3ED8A 4KEXA 3S05A 4W6TA 4EDOA 2VVHA 3EVPA 4RYSA 3SVCA 4W6OA 4N3DA 4H3LA 4BDUA 3SS0A 2GW4B 3GJ1A 5HW9A 3P28A 2AWKA 3UFZA 4HQ9A 5BQLA 2WHUA 4KA9A 3SVRA 1Q73A 2WHTA 2AWLA 4W7RA 3H1OA 1EMGA 3ST3A 4KF4A 4KGFA 4UTSA 4ZINA 4W6AA 2JADA 2A56B 4W6FA 5F9GA 3RWAA 5LTPA 1HUYA 2PXWA 4IK1A 5EXBA 3EVUA 3DQLA 1QYFA 5EXUA 4W7XA 2FL1A 3NT9A 4W6BA 1YFPA 3SV5A 4LJCA 4ZF3A 2VAEA 5EBJA 4W6IA 2QLGA 4J89A 5BTTA 4ZF5A 4EN1A 2POXA 3LVCA 4Q7RA 3CD9A 3LF3A 4LQTA 3U0LA 2G3OA 4PPJA 1MYWA 4Q9XA 2DDDA 4W6CA 4KW4A 2C9JA 5KTGA 4I2YA 2V4EC 3DQ1A 4KF5C 1YHIA 3ZTFA 4ZB1A 5LTQA 2AH8A 4DXNA 5DTLA
chains in the Genus database with same CATH topology
4W6HA 2B3PA 1UISA 3BX9A 5BT0A 4EDSA 1EMLA 1H4UA 1GL4A 4PPKA 5HZOA 4H47A 3SSHA 4ORNA 2QRFA 3ZULA 3DQ9A 2DDCA 2A47A 2Q6PA 1XMZA 2V4EB 4KGEA 3WLCA 1HCJA 1B9CA 3PJ7A 4W7CA 4XOWA 3E5TA 4LJDA 2ZO6A 3CB9A 4NWSA 4GF6B 4DKNA 3OSQA 1Z1QA 1KYPA 1W7UA 3SVSA 3SG3A 1QYOA 3EVVA 1EMEA 1QY3A 2Z6ZA 3CFHA 3SSYA 4W6MA 2ZMUA 4DXQA 1JBYA 3H1RA 4W6DA 3DQ2A 3U8PA 2AWMA 4HE4A 2QZ0A 2HRSA 2VZXA 4IK4A 1YJFA 2QT2A 4KW8A 2DUHA 2HFCA 3NT3A 3SSTA 2VADA 1ZGOA 2WISA 2O24A 3CD1A 2RH7A 4W7FA 4Z4MA 1KYSA 2IB5A 5H89A 1Z1PA 4W7EA 2H5QA 3DQDA 3LS3A 3DPWA 2G6EA 5FVGA 2HQZA 5DPHA 3ADFA 1GGXA 3ST4A 3DQ3A 3LSAA 3EK7A 3GL4A 5DQBA 3SVOA 4DXOA 3SVEA 3KCTA 2OTBA 2H5RA 4IK5A 4Q7TA 2G6YA 4ANJA 2ZMWA 4XVPA 3DQNA 2PXSA 5H88A 3LVAA 3SG6A 1JC0A 5DTYA 4W74A 3DQ5A 4W77A 5EHUA 5DY6A 3SVNA 3CFFA 3U0NA 1G7KA 3EKHA 3SVDA 2H9WA 3LF4B 4W6NA 1RMPA 3DQMA 5HZTA 4W6RA 4JRBA 3CGLA 2FWQA 5HBDA 3AI4A 1EMFA 2QLEA 2Y0GA 5DRGA 4TZGA 5DRFA 1BFPA 2G16B 4W6PA 5DPGA 4W6UA 1Q4CA 1QYQA 2DUEA 4W76A 4JF9A 1ZGQA 2WURA 5HZSA 1C4FA 4W75A 3BXCA 1XAEA 2DUIA 3DQFA 4TZAA 4J88A 4KAGA 2OJKA 3DQ4A 5LK4A 3DQ6A 1RM9A 2Z6XA 4JEOA 2O29A 4R6DA 3GEXA 3SG4A 2GW3A 2FZUA 2HJOA 5DPJA 1RRXA 5DTXA 2HGDA 4JGEA 3VHTA 3K1KA 4Q9WA 2WSNA 3NF0A 2AWJA 3OSRA 1Q4EA 4W7AA 1S6ZA 4XGYA 1EMMA 4AS8A 3SVUA 3WLDA 2QLGB 3G9AA 2DUGA 4W6SA 5HGEA 1QXTA 5BTTB 3SSPA 3NEDA 3U0KA 3EVRA 3DQHA 3CFAA 3DQUA 3DQ7A 2Z1OA 5DU0A 2YDZA 2A53B 3W1DA 4W6JA 2EMNA 1XSSA 3NEZA 3DQEA 4H3MA 3V3DA 1YJ2A 1OXDA 4IK8A 3DQOA 2G6XA 2OTEA 4JFGA 5DQMA 5T3IA 3CBEA 3BXAA 2VVIA 4LJDC 1Q4AA 1XQMA 4W73A 3SG2A 1EMCA 4H3NA 3TMRA 3DQIA 3ST0A 2HQKA 4IK3A 3DPZA 2OKYA 1W7SA 4EULA 3TMTA 2DD7A 4LQUA 2WSOA 1MOVA 4PPLA 2GX2A 3LVDA 2H6VA 3O78A 5FVIA 4HVFA 2IE2A 3VK1A 2EMDA 3EK4A 3IP2A 4IK9A 4P1QA 4ZBLA 3RWTA 3ST2A 4B30A 3SSLA 5DPIA 2IOVA 4DXIA 4AR7A 4OHSA 2HCGA 3LA1A 4RYWA 1RMMA 3DPXA 3GB3A 3OGOA 4ZF4A 1F0BA 3AKOA 1ZUXA 4L1IA 2YE0A 5EB7A 3SVBA 4KPIA 3SG5A 2H5OA 2OKWA 4P76A 1ZGPA 4PFEA 1CV7A 3A8SA 2BTJA 2QLIA 3E5VA 2A54B 3VICA 2WIQA 3M24A 4JC2A 4ZIOA 4DXMA 1JC1A 3ZUJA 2YE1A 4W6GA 5AQBB 4Z4KA 5EXCI 2A50B 4Q7UA 2V4EA 3I19A 2P4MA 2DUFA 2AHAA 4W6LA 1GFLA 4KF5A 1KYRA 3MGFA 4L13A 4DXPA 1W7TA 1YHHA 2WHSA 5LTRA 4J8AA 5EJUA 3EKJA 2A46A 2EMOA 3SRYA 3IR8A 4B30B 3DQAA 1YHGA 2IB6A 1XA9A 3AI5A 4IZNA 1RMOA 4OQWA 4OGSA 4LW5A 2G3DB 5HZUA 2HPWA 4KW9A 1YZWA 2QLHA 4HQCA 1Q4BA 1F09A 1EMAA 3EK8A 4L12A 3PIBA 3WCKA 4HQ8A 3KCSA 3PJBA 2ARLA 1OXFA 5J2OA 2G5ZB 3E5WA 2QU1A 2DD9A 2ZO7A 2HGYA 4H48A 3DQJA 1OXEA 2A52B 3SSKA 1EMKA 3M22A 2Q57A 4EMQA 2YFPA 4ZFSA 2VVJA 5H87A 2G2SB 4R6BA 1EMBA 4GOBA 2Z6YA 1JBZA 3O77A 5DTZA 1MOUA 4DKMA 3ZUFA 3SSVA 3BXBA 3DQ8A 2ICRA 2OGRA 4LJBA 5FVFA 3SG7A 1Q4DA 5EB6A 4U2VA 2H5PA 2GX0A 4OJ0A 4RTCA 2O2BA 4GESB 2B3QA 5FHVA 3W1CA 4OY4A 4B5YA 3VHTB 4W6KA 2H8QA 1KP5A 1H6RA 3PJ5A 3UG0A 3U8AA 2A48A 3DQCA 3GJ2A 2C9IA 3U8CA 4W72A 4W69A 3U0MA 4W7DA 3DQKA 4XL5A 3P8UA 4XOVA 3ED8A 4KEXA 3S05A 4W6TA 4EDOA 2VVHA 3EVPA 4RYSA 3SVCA 4W6OA 4N3DA 4H3LA 4BDUA 3SS0A 2GW4B 3GJ1A 5HW9A 3P28A 2AWKA 3UFZA 4HQ9A 5BQLA 2WHUA 4KA9A 3SVRA 1Q73A 2WHTA 2AWLA 4W7RA 3H1OA 1EMGA 3ST3A 4KF4A 4KGFA 4UTSA 4ZINA 4W6AA 2JADA 2A56B 4W6FA 5F9GA 3RWAA 5LTPA 1HUYA 2PXWA 4IK1A 5EXBA 3EVUA 3DQLA 1QYFA 5EXUA 4W7XA 2FL1A 3NT9A 4W6BA 1YFPA 3SV5A 4LJCA 4ZF3A 2VAEA 5EBJA 4W6IA 2QLGA 4J89A 5BTTA 4ZF5A 4EN1A 2POXA 3LVCA 4Q7RA 3CD9A 3LF3A 4LQTA 3U0LA 2G3OA 4PPJA 1MYWA 4Q9XA 2DDDA 4W6CA 4KW4A 2C9JA 5KTGA 4I2YA 2V4EC 3DQ1A 4KF5C 1YHIA 3ZTFA 4ZB1A 5LTQA 2AH8A 4DXNA 5DTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W6H A;  2B3P A;  1UIS A;  3BX9 A;  5BT0 A;  4EDS A;  1EML A;  1H4U A;  1GL4 A;  4PPK A;  5HZO A;  4H47 A;  3SSH A;  4ORN A;  2QRF A;  3ZUL A;  3DQ9 A;  2DDC A;  2A47 A;  2Q6P A;  1XMZ A;  2V4E B;  4KGE A;  3WLC A;  1HCJ A;  1B9C A;  3PJ7 A;  4W7C A;  4XOW A;  3E5T A;  4LJD A;  2ZO6 A;  3CB9 A;  4NWS A;  4GF6 B;  4DKN A;  3OSQ A;  1Z1Q A;  1KYP A;  1W7U A;  3SVS A;  3SG3 A;  1QYO A;  3EVV A;  1EME A;  1QY3 A;  2Z6Z A;  3CFH A;  3SSY A;  4W6M A;  2ZMU A;  4DXQ A;  1JBY A;  3H1R A;  4W6D A;  3DQ2 A;  3U8P A;  2AWM A;  4HE4 A;  2QZ0 A;  2HRS A;  2VZX A;  4IK4 A;  1YJF A;  2QT2 A;  4KW8 A;  2DUH A;  2HFC A;  3NT3 A;  3SST A;  2VAD A;  1ZGO A;  2WIS A;  2O24 A;  3CD1 A;  2RH7 A;  4W7F A;  4Z4M A;  1KYS A;  2IB5 A;  5H89 A;  1Z1P A;  4W7E A;  2H5Q A;  3DQD A;  3LS3 A;  3DPW A;  2G6E A;  5FVG A;  2HQZ A;  5DPH A;  3ADF A;  1GGX A;  3ST4 A;  3DQ3 A;  3LSA A;  3EK7 A;  3GL4 A;  5DQB A;  3SVO A;  4DXO A;  3SVE A;  3KCT A;  2OTB A;  2H5R A;  4IK5 A;  4Q7T A;  2G6Y A;  4ANJ A;  2ZMW A;  4XVP A;  3DQN A;  2PXS A;  5H88 A;  3LVA A;  3SG6 A;  1JC0 A;  5DTY A;  4W74 A;  3DQ5 A;  4W77 A;  5EHU A;  5DY6 A;  3SVN A;  3CFF A;  3U0N A;  1G7K A;  3EKH A;  3SVD A;  2H9W A;  3LF4 B;  4W6N A;  1RMP A;  3DQM A;  5HZT A;  4W6R A;  4JRB A;  3CGL A;  2FWQ A;  5HBD A;  3AI4 A;  1EMF A;  2QLE A;  2Y0G A;  5DRG A;  4TZG A;  5DRF A;  1BFP A;  2G16 B;  4W6P A;  5DPG A;  4W6U A;  1Q4C A;  1QYQ A;  2DUE A;  4W76 A;  4JF9 A;  1ZGQ A;  2WUR A;  5HZS A;  1C4F A;  4W75 A;  3BXC A;  1XAE A;  2DUI A;  3DQF A;  4TZA A;  4J88 A;  4KAG A;  2OJK A;  3DQ4 A;  5LK4 A;  3DQ6 A;  1RM9 A;  2Z6X A;  4JEO A;  2O29 A;  4R6D A;  3GEX A;  3SG4 A;  2GW3 A;  2FZU A;  2HJO A;  5DPJ A;  1RRX A;  5DTX A;  2HGD A;  4JGE A;  3VHT A;  3K1K A;  4Q9W A;  2WSN A;  3NF0 A;  2AWJ A;  3OSR A;  1Q4E A;  4W7A A;  1S6Z A;  4XGY A;  1EMM A;  4AS8 A;  3SVU A;  3WLD A;  2QLG B;  3G9A A;  2DUG A;  4W6S A;  5HGE A;  1QXT A;  5BTT B;  3SSP A;  3NED A;  3U0K A;  3EVR A;  3DQH A;  3CFA A;  3DQU A;  3DQ7 A;  2Z1O A;  5DU0 A;  2YDZ A;  2A53 B;  3W1D A;  4W6J A;  2EMN A;  1XSS A;  3NEZ A;  3DQE A;  4H3M A;  3V3D A;  1YJ2 A;  1OXD A;  4IK8 A;  3DQO A;  2G6X A;  2OTE A;  4JFG A;  5DQM A;  5T3I A;  3CBE A;  3BXA A;  2VVI A;  4LJD C;  1Q4A A;  1XQM A;  4W73 A;  3SG2 A;  1EMC A;  4H3N A;  3TMR A;  3DQI A;  3ST0 A;  2HQK A;  4IK3 A;  3DPZ A;  2OKY A;  1W7S A;  4EUL A;  3TMT A;  2DD7 A;  4LQU A;  2WSO A;  1MOV A;  4PPL A;  2GX2 A;  3LVD A;  2H6V A;  3O78 A;  5FVI A;  4HVF A;  2IE2 A;  3VK1 A;  2EMD A;  3EK4 A;  3IP2 A;  4IK9 A;  4P1Q A;  4ZBL A;  3RWT A;  3ST2 A;  4B30 A;  3SSL A;  5DPI A;  2IOV A;  4DXI A;  4AR7 A;  4OHS A;  2HCG A;  3LA1 A;  4RYW A;  1RMM A;  3DPX A;  3GB3 A;  3OGO A;  4ZF4 A;  1F0B A;  3AKO A;  1ZUX A;  4L1I A;  2YE0 A;  5EB7 A;  3SVB A;  4KPI A;  3SG5 A;  2H5O A;  2OKW A;  4P76 A;  1ZGP A;  4PFE A;  1CV7 A;  3A8S A;  2BTJ A;  2QLI A;  3E5V A;  2A54 B;  3VIC A;  2WIQ A;  3M24 A;  4JC2 A;  4ZIO A;  4DXM A;  1JC1 A;  3ZUJ A;  2YE1 A;  4W6G A;  5AQB B;  4Z4K A;  5EXC I;  2A50 B;  4Q7U A;  2V4E A;  3I19 A;  2P4M A;  2DUF A;  2AHA A;  4W6L A;  1GFL A;  4KF5 A;  1KYR A;  3MGF A;  4L13 A;  4DXP A;  1W7T A;  1YHH A;  2WHS A;  5LTR A;  4J8A A;  5EJU A;  3EKJ A;  2A46 A;  2EMO A;  3SRY A;  3IR8 A;  4B30 B;  3DQA A;  1YHG A;  2IB6 A;  1XA9 A;  3AI5 A;  4IZN A;  1RMO A;  4OQW A;  4OGS A;  4LW5 A;  2G3D B;  5HZU A;  2HPW A;  4KW9 A;  1YZW A;  2QLH A;  4HQC A;  1Q4B A;  1F09 A;  1EMA A;  3EK8 A;  4L12 A;  3PIB A;  3WCK A;  4HQ8 A;  3KCS A;  3PJB A;  2ARL A;  1OXF A;  5J2O A;  2G5Z B;  3E5W A;  2QU1 A;  2DD9 A;  2ZO7 A;  2HGY A;  4H48 A;  3DQJ A;  1OXE A;  2A52 B;  3SSK A;  1EMK A;  3M22 A;  2Q57 A;  4EMQ A;  2YFP A;  4ZFS A;  2VVJ A;  5H87 A;  2G2S B;  4R6B A;  1EMB A;  4GOB A;  2Z6Y A;  1JBZ A;  3O77 A;  5DTZ A;  1MOU A;  4DKM A;  3ZUF A;  3SSV A;  3BXB A;  3DQ8 A;  2ICR A;  2OGR A;  4LJB A;  5FVF A;  3SG7 A;  1Q4D A;  5EB6 A;  4U2V A;  2H5P A;  2GX0 A;  4OJ0 A;  4RTC A;  2O2B A;  4GES B;  2B3Q A;  5FHV A;  3W1C A;  4OY4 A;  4B5Y A;  3VHT B;  4W6K A;  2H8Q A;  1KP5 A;  1H6R A;  3PJ5 A;  3UG0 A;  3U8A A;  2A48 A;  3DQC A;  3GJ2 A;  2C9I A;  3U8C A;  4W72 A;  4W69 A;  3U0M A;  4W7D A;  3DQK A;  4XL5 A;  3P8U A;  4XOV A;  3ED8 A;  4KEX A;  3S05 A;  4W6T A;  4EDO A;  2VVH A;  3EVP A;  4RYS A;  3SVC A;  4W6O A;  4N3D A;  4H3L A;  4BDU A;  3SS0 A;  2GW4 B;  3GJ1 A;  5HW9 A;  3P28 A;  2AWK A;  3UFZ A;  4HQ9 A;  5BQL A;  2WHU A;  4KA9 A;  3SVR A;  1Q73 A;  2WHT A;  2AWL A;  4W7R A;  3H1O A;  1EMG A;  3ST3 A;  4KF4 A;  4KGF A;  4UTS A;  4ZIN A;  4W6A A;  2JAD A;  2A56 B;  4W6F A;  5F9G A;  3RWA A;  5LTP A;  1HUY A;  2PXW A;  4IK1 A;  5EXB A;  3EVU A;  3DQL A;  1QYF A;  5EXU A;  4W7X A;  2FL1 A;  3NT9 A;  4W6B A;  1YFP A;  3SV5 A;  4LJC A;  4ZF3 A;  2VAE A;  5EBJ A;  4W6I A;  2QLG A;  4J89 A;  5BTT A;  4ZF5 A;  4EN1 A;  2POX A;  3LVC A;  4Q7R A;  3CD9 A;  3LF3 A;  4LQT A;  3U0L A;  2G3O A;  4PPJ A;  1MYW A;  4Q9X A;  2DDD A;  4W6C A;  4KW4 A;  2C9J A;  5KTG A;  4I2Y A;  2V4E C;  3DQ1 A;  4KF5 C;  1YHI A;  3ZTF A;  4ZB1 A;  5LTQ A;  2AH8 A;  4DXN A;  5DTL A; 
#chains in the Genus database with same CATH topology
 4W6H A;  2B3P A;  1UIS A;  3BX9 A;  5BT0 A;  4EDS A;  1EML A;  1H4U A;  1GL4 A;  4PPK A;  5HZO A;  4H47 A;  3SSH A;  4ORN A;  2QRF A;  3ZUL A;  3DQ9 A;  2DDC A;  2A47 A;  2Q6P A;  1XMZ A;  2V4E B;  4KGE A;  3WLC A;  1HCJ A;  1B9C A;  3PJ7 A;  4W7C A;  4XOW A;  3E5T A;  4LJD A;  2ZO6 A;  3CB9 A;  4NWS A;  4GF6 B;  4DKN A;  3OSQ A;  1Z1Q A;  1KYP A;  1W7U A;  3SVS A;  3SG3 A;  1QYO A;  3EVV A;  1EME A;  1QY3 A;  2Z6Z A;  3CFH A;  3SSY A;  4W6M A;  2ZMU A;  4DXQ A;  1JBY A;  3H1R A;  4W6D A;  3DQ2 A;  3U8P A;  2AWM A;  4HE4 A;  2QZ0 A;  2HRS A;  2VZX A;  4IK4 A;  1YJF A;  2QT2 A;  4KW8 A;  2DUH A;  2HFC A;  3NT3 A;  3SST A;  2VAD A;  1ZGO A;  2WIS A;  2O24 A;  3CD1 A;  2RH7 A;  4W7F A;  4Z4M A;  1KYS A;  2IB5 A;  5H89 A;  1Z1P A;  4W7E A;  2H5Q A;  3DQD A;  3LS3 A;  3DPW A;  2G6E A;  5FVG A;  2HQZ A;  5DPH A;  3ADF A;  1GGX A;  3ST4 A;  3DQ3 A;  3LSA A;  3EK7 A;  3GL4 A;  5DQB A;  3SVO A;  4DXO A;  3SVE A;  3KCT A;  2OTB A;  2H5R A;  4IK5 A;  4Q7T A;  2G6Y A;  4ANJ A;  2ZMW A;  4XVP A;  3DQN A;  2PXS A;  5H88 A;  3LVA A;  3SG6 A;  1JC0 A;  5DTY A;  4W74 A;  3DQ5 A;  4W77 A;  5EHU A;  5DY6 A;  3SVN A;  3CFF A;  3U0N A;  1G7K A;  3EKH A;  3SVD A;  2H9W A;  3LF4 B;  4W6N A;  1RMP A;  3DQM A;  5HZT A;  4W6R A;  4JRB A;  3CGL A;  2FWQ A;  5HBD A;  3AI4 A;  1EMF A;  2QLE A;  2Y0G A;  5DRG A;  4TZG A;  5DRF A;  1BFP A;  2G16 B;  4W6P A;  5DPG A;  4W6U A;  1Q4C A;  1QYQ A;  2DUE A;  4W76 A;  4JF9 A;  1ZGQ A;  2WUR A;  5HZS A;  1C4F A;  4W75 A;  3BXC A;  1XAE A;  2DUI A;  3DQF A;  4TZA A;  4J88 A;  4KAG A;  2OJK A;  3DQ4 A;  5LK4 A;  3DQ6 A;  1RM9 A;  2Z6X A;  4JEO A;  2O29 A;  4R6D A;  3GEX A;  3SG4 A;  2GW3 A;  2FZU A;  2HJO A;  5DPJ A;  1RRX A;  5DTX A;  2HGD A;  4JGE A;  3VHT A;  3K1K A;  4Q9W A;  2WSN A;  3NF0 A;  2AWJ A;  3OSR A;  1Q4E A;  4W7A A;  1S6Z A;  4XGY A;  1EMM A;  4AS8 A;  3SVU A;  3WLD A;  2QLG B;  3G9A A;  2DUG A;  4W6S A;  5HGE A;  1QXT A;  5BTT B;  3SSP A;  3NED A;  3U0K A;  3EVR A;  3DQH A;  3CFA A;  3DQU A;  3DQ7 A;  2Z1O A;  5DU0 A;  2YDZ A;  2A53 B;  3W1D A;  4W6J A;  2EMN A;  1XSS A;  3NEZ A;  3DQE A;  4H3M A;  3V3D A;  1YJ2 A;  1OXD A;  4IK8 A;  3DQO A;  2G6X A;  2OTE A;  4JFG A;  5DQM A;  5T3I A;  3CBE A;  3BXA A;  2VVI A;  4LJD C;  1Q4A A;  1XQM A;  4W73 A;  3SG2 A;  1EMC A;  4H3N A;  3TMR A;  3DQI A;  3ST0 A;  2HQK A;  4IK3 A;  3DPZ A;  2OKY A;  1W7S A;  4EUL A;  3TMT A;  2DD7 A;  4LQU A;  2WSO A;  1MOV A;  4PPL A;  2GX2 A;  3LVD A;  2H6V A;  3O78 A;  5FVI A;  4HVF A;  2IE2 A;  3VK1 A;  2EMD A;  3EK4 A;  3IP2 A;  4IK9 A;  4P1Q A;  4ZBL A;  3RWT A;  3ST2 A;  4B30 A;  3SSL A;  5DPI A;  2IOV A;  4DXI A;  4AR7 A;  4OHS A;  2HCG A;  3LA1 A;  4RYW A;  1RMM A;  3DPX A;  3GB3 A;  3OGO A;  4ZF4 A;  1F0B A;  3AKO A;  1ZUX A;  4L1I A;  2YE0 A;  5EB7 A;  3SVB A;  4KPI A;  3SG5 A;  2H5O A;  2OKW A;  4P76 A;  1ZGP A;  4PFE A;  1CV7 A;  3A8S A;  2BTJ A;  2QLI A;  3E5V A;  2A54 B;  3VIC A;  2WIQ A;  3M24 A;  4JC2 A;  4ZIO A;  4DXM A;  1JC1 A;  3ZUJ A;  2YE1 A;  4W6G A;  5AQB B;  4Z4K A;  5EXC I;  2A50 B;  4Q7U A;  2V4E A;  3I19 A;  2P4M A;  2DUF A;  2AHA A;  4W6L A;  1GFL A;  4KF5 A;  1KYR A;  3MGF A;  4L13 A;  4DXP A;  1W7T A;  1YHH A;  2WHS A;  5LTR A;  4J8A A;  5EJU A;  3EKJ A;  2A46 A;  2EMO A;  3SRY A;  3IR8 A;  4B30 B;  3DQA A;  1YHG A;  2IB6 A;  1XA9 A;  3AI5 A;  4IZN A;  1RMO A;  4OQW A;  4OGS A;  4LW5 A;  2G3D B;  5HZU A;  2HPW A;  4KW9 A;  1YZW A;  2QLH A;  4HQC A;  1Q4B A;  1F09 A;  1EMA A;  3EK8 A;  4L12 A;  3PIB A;  3WCK A;  4HQ8 A;  3KCS A;  3PJB A;  2ARL A;  1OXF A;  5J2O A;  2G5Z B;  3E5W A;  2QU1 A;  2DD9 A;  2ZO7 A;  2HGY A;  4H48 A;  3DQJ A;  1OXE A;  2A52 B;  3SSK A;  1EMK A;  3M22 A;  2Q57 A;  4EMQ A;  2YFP A;  4ZFS A;  2VVJ A;  5H87 A;  2G2S B;  4R6B A;  1EMB A;  4GOB A;  2Z6Y A;  1JBZ A;  3O77 A;  5DTZ A;  1MOU A;  4DKM A;  3ZUF A;  3SSV A;  3BXB A;  3DQ8 A;  2ICR A;  2OGR A;  4LJB A;  5FVF A;  3SG7 A;  1Q4D A;  5EB6 A;  4U2V A;  2H5P A;  2GX0 A;  4OJ0 A;  4RTC A;  2O2B A;  4GES B;  2B3Q A;  5FHV A;  3W1C A;  4OY4 A;  4B5Y A;  3VHT B;  4W6K A;  2H8Q A;  1KP5 A;  1H6R A;  3PJ5 A;  3UG0 A;  3U8A A;  2A48 A;  3DQC A;  3GJ2 A;  2C9I A;  3U8C A;  4W72 A;  4W69 A;  3U0M A;  4W7D A;  3DQK A;  4XL5 A;  3P8U A;  4XOV A;  3ED8 A;  4KEX A;  3S05 A;  4W6T A;  4EDO A;  2VVH A;  3EVP A;  4RYS A;  3SVC A;  4W6O A;  4N3D A;  4H3L A;  4BDU A;  3SS0 A;  2GW4 B;  3GJ1 A;  5HW9 A;  3P28 A;  2AWK A;  3UFZ A;  4HQ9 A;  5BQL A;  2WHU A;  4KA9 A;  3SVR A;  1Q73 A;  2WHT A;  2AWL A;  4W7R A;  3H1O A;  1EMG A;  3ST3 A;  4KF4 A;  4KGF A;  4UTS A;  4ZIN A;  4W6A A;  2JAD A;  2A56 B;  4W6F A;  5F9G A;  3RWA A;  5LTP A;  1HUY A;  2PXW A;  4IK1 A;  5EXB A;  3EVU A;  3DQL A;  1QYF A;  5EXU A;  4W7X A;  2FL1 A;  3NT9 A;  4W6B A;  1YFP A;  3SV5 A;  4LJC A;  4ZF3 A;  2VAE A;  5EBJ A;  4W6I A;  2QLG A;  4J89 A;  5BTT A;  4ZF5 A;  4EN1 A;  2POX A;  3LVC A;  4Q7R A;  3CD9 A;  3LF3 A;  4LQT A;  3U0L A;  2G3O A;  4PPJ A;  1MYW A;  4Q9X A;  2DDD A;  4W6C A;  4KW4 A;  2C9J A;  5KTG A;  4I2Y A;  2V4E C;  3DQ1 A;  4KF5 C;  1YHI A;  3ZTF A;  4ZB1 A;  5LTQ A;  2AH8 A;  4DXN A;  5DTL A; 
#chains in the Genus database with same CATH homology
 4W6H A;  2B3P A;  1UIS A;  3BX9 A;  5BT0 A;  4EDS A;  1EML A;  1H4U A;  1GL4 A;  4PPK A;  5HZO A;  4H47 A;  3SSH A;  4ORN A;  2QRF A;  3ZUL A;  3DQ9 A;  2DDC A;  2A47 A;  2Q6P A;  1XMZ A;  2V4E B;  4KGE A;  3WLC A;  1HCJ A;  1B9C A;  3PJ7 A;  4W7C A;  4XOW A;  3E5T A;  4LJD A;  2ZO6 A;  3CB9 A;  4NWS A;  4GF6 B;  4DKN A;  3OSQ A;  1Z1Q A;  1KYP A;  1W7U A;  3SVS A;  3SG3 A;  1QYO A;  3EVV A;  1EME A;  1QY3 A;  2Z6Z A;  3CFH A;  3SSY A;  4W6M A;  2ZMU A;  4DXQ A;  1JBY A;  3H1R A;  4W6D A;  3DQ2 A;  3U8P A;  2AWM A;  4HE4 A;  2QZ0 A;  2HRS A;  2VZX A;  4IK4 A;  1YJF A;  2QT2 A;  4KW8 A;  2DUH A;  2HFC A;  3NT3 A;  3SST A;  2VAD A;  1ZGO A;  2WIS A;  2O24 A;  3CD1 A;  2RH7 A;  4W7F A;  4Z4M A;  1KYS A;  2IB5 A;  5H89 A;  1Z1P A;  4W7E A;  2H5Q A;  3DQD A;  3LS3 A;  3DPW A;  2G6E A;  5FVG A;  2HQZ A;  5DPH A;  3ADF A;  1GGX A;  3ST4 A;  3DQ3 A;  3LSA A;  3EK7 A;  3GL4 A;  5DQB A;  3SVO A;  4DXO A;  3SVE A;  3KCT A;  2OTB A;  2H5R A;  4IK5 A;  4Q7T A;  2G6Y A;  4ANJ A;  2ZMW A;  4XVP A;  3DQN A;  2PXS A;  5H88 A;  3LVA A;  3SG6 A;  1JC0 A;  5DTY A;  4W74 A;  3DQ5 A;  4W77 A;  5EHU A;  5DY6 A;  3SVN A;  3CFF A;  3U0N A;  1G7K A;  3EKH A;  3SVD A;  2H9W A;  3LF4 B;  4W6N A;  1RMP A;  3DQM A;  5HZT A;  4W6R A;  4JRB A;  3CGL A;  2FWQ A;  5HBD A;  3AI4 A;  1EMF A;  2QLE A;  2Y0G A;  5DRG A;  4TZG A;  5DRF A;  1BFP A;  2G16 B;  4W6P A;  5DPG A;  4W6U A;  1Q4C A;  1QYQ A;  2DUE A;  4W76 A;  4JF9 A;  1ZGQ A;  2WUR A;  5HZS A;  1C4F A;  4W75 A;  3BXC A;  1XAE A;  2DUI A;  3DQF A;  4TZA A;  4J88 A;  4KAG A;  2OJK A;  3DQ4 A;  5LK4 A;  3DQ6 A;  1RM9 A;  2Z6X A;  4JEO A;  2O29 A;  4R6D A;  3GEX A;  3SG4 A;  2GW3 A;  2FZU A;  2HJO A;  5DPJ A;  1RRX A;  5DTX A;  2HGD A;  4JGE A;  3VHT A;  3K1K A;  4Q9W A;  2WSN A;  3NF0 A;  2AWJ A;  3OSR A;  1Q4E A;  4W7A A;  1S6Z A;  4XGY A;  1EMM A;  4AS8 A;  3SVU A;  3WLD A;  2QLG B;  3G9A A;  2DUG A;  4W6S A;  5HGE A;  1QXT A;  5BTT B;  3SSP A;  3NED A;  3U0K A;  3EVR A;  3DQH A;  3CFA A;  3DQU A;  3DQ7 A;  2Z1O A;  5DU0 A;  2YDZ A;  2A53 B;  3W1D A;  4W6J A;  2EMN A;  1XSS A;  3NEZ A;  3DQE A;  4H3M A;  3V3D A;  1YJ2 A;  1OXD A;  4IK8 A;  3DQO A;  2G6X A;  2OTE A;  4JFG A;  5DQM A;  5T3I A;  3CBE A;  3BXA A;  2VVI A;  4LJD C;  1Q4A A;  1XQM A;  4W73 A;  3SG2 A;  1EMC A;  4H3N A;  3TMR A;  3DQI A;  3ST0 A;  2HQK A;  4IK3 A;  3DPZ A;  2OKY A;  1W7S A;  4EUL A;  3TMT A;  2DD7 A;  4LQU A;  2WSO A;  1MOV A;  4PPL A;  2GX2 A;  3LVD A;  2H6V A;  3O78 A;  5FVI A;  4HVF A;  2IE2 A;  3VK1 A;  2EMD A;  3EK4 A;  3IP2 A;  4IK9 A;  4P1Q A;  4ZBL A;  3RWT A;  3ST2 A;  4B30 A;  3SSL A;  5DPI A;  2IOV A;  4DXI A;  4AR7 A;  4OHS A;  2HCG A;  3LA1 A;  4RYW A;  1RMM A;  3DPX A;  3GB3 A;  3OGO A;  4ZF4 A;  1F0B A;  3AKO A;  1ZUX A;  4L1I A;  2YE0 A;  5EB7 A;  3SVB A;  4KPI A;  3SG5 A;  2H5O A;  2OKW A;  4P76 A;  1ZGP A;  4PFE A;  1CV7 A;  3A8S A;  2BTJ A;  2QLI A;  3E5V A;  2A54 B;  3VIC A;  2WIQ A;  3M24 A;  4JC2 A;  4ZIO A;  4DXM A;  1JC1 A;  3ZUJ A;  2YE1 A;  4W6G A;  5AQB B;  4Z4K A;  5EXC I;  2A50 B;  4Q7U A;  2V4E A;  3I19 A;  2P4M A;  2DUF A;  2AHA A;  4W6L A;  1GFL A;  4KF5 A;  1KYR A;  3MGF A;  4L13 A;  4DXP A;  1W7T A;  1YHH A;  2WHS A;  5LTR A;  4J8A A;  5EJU A;  3EKJ A;  2A46 A;  2EMO A;  3SRY A;  3IR8 A;  4B30 B;  3DQA A;  1YHG A;  2IB6 A;  1XA9 A;  3AI5 A;  4IZN A;  1RMO A;  4OQW A;  4OGS A;  4LW5 A;  2G3D B;  5HZU A;  2HPW A;  4KW9 A;  1YZW A;  2QLH A;  4HQC A;  1Q4B A;  1F09 A;  1EMA A;  3EK8 A;  4L12 A;  3PIB A;  3WCK A;  4HQ8 A;  3KCS A;  3PJB A;  2ARL A;  1OXF A;  5J2O A;  2G5Z B;  3E5W A;  2QU1 A;  2DD9 A;  2ZO7 A;  2HGY A;  4H48 A;  3DQJ A;  1OXE A;  2A52 B;  3SSK A;  1EMK A;  3M22 A;  2Q57 A;  4EMQ A;  2YFP A;  4ZFS A;  2VVJ A;  5H87 A;  2G2S B;  4R6B A;  1EMB A;  4GOB A;  2Z6Y A;  1JBZ A;  3O77 A;  5DTZ A;  1MOU A;  4DKM A;  3ZUF A;  3SSV A;  3BXB A;  3DQ8 A;  2ICR A;  2OGR A;  4LJB A;  5FVF A;  3SG7 A;  1Q4D A;  5EB6 A;  4U2V A;  2H5P A;  2GX0 A;  4OJ0 A;  4RTC A;  2O2B A;  4GES B;  2B3Q A;  5FHV A;  3W1C A;  4OY4 A;  4B5Y A;  3VHT B;  4W6K A;  2H8Q A;  1KP5 A;  1H6R A;  3PJ5 A;  3UG0 A;  3U8A A;  2A48 A;  3DQC A;  3GJ2 A;  2C9I A;  3U8C A;  4W72 A;  4W69 A;  3U0M A;  4W7D A;  3DQK A;  4XL5 A;  3P8U A;  4XOV A;  3ED8 A;  4KEX A;  3S05 A;  4W6T A;  4EDO A;  2VVH A;  3EVP A;  4RYS A;  3SVC A;  4W6O A;  4N3D A;  4H3L A;  4BDU A;  3SS0 A;  2GW4 B;  3GJ1 A;  5HW9 A;  3P28 A;  2AWK A;  3UFZ A;  4HQ9 A;  5BQL A;  2WHU A;  4KA9 A;  3SVR A;  1Q73 A;  2WHT A;  2AWL A;  4W7R A;  3H1O A;  1EMG A;  3ST3 A;  4KF4 A;  4KGF A;  4UTS A;  4ZIN A;  4W6A A;  2JAD A;  2A56 B;  4W6F A;  5F9G A;  3RWA A;  5LTP A;  1HUY A;  2PXW A;  4IK1 A;  5EXB A;  3EVU A;  3DQL A;  1QYF A;  5EXU A;  4W7X A;  2FL1 A;  3NT9 A;  4W6B A;  1YFP A;  3SV5 A;  4LJC A;  4ZF3 A;  2VAE A;  5EBJ A;  4W6I A;  2QLG A;  4J89 A;  5BTT A;  4ZF5 A;  4EN1 A;  2POX A;  3LVC A;  4Q7R A;  3CD9 A;  3LF3 A;  4LQT A;  3U0L A;  2G3O A;  4PPJ A;  1MYW A;  4Q9X A;  2DDD A;  4W6C A;  4KW4 A;  2C9J A;  5KTG A;  4I2Y A;  2V4E C;  3DQ1 A;  4KF5 C;  1YHI A;  3ZTF A;  4ZB1 A;  5LTQ A;  2AH8 A;  4DXN A;  5DTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...