4EUPG

The complex between tcr jkf6 and human class i mhc hla-a2 presenting the mart-1(27-35)(a27l) peptide
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
201
structure length
201
Chain Sequence
b'KEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMSIYSNGDKEDGRFTAQLNKASQYVSLLIRDAQPSDSATYLCAVSGGGADGLTFGKGTQVVVTPNIQNPDPAVYQLRDSKSADKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
molecule tags Immune system
source organism Homo sapiens
publication title Structural description of how different MART-1 antigenic peptides influence JKF6 T cell receptor recognition
rcsb
total genus 34
structure length 201
sequence length 201
chains with identical sequence I
ec nomenclature
pdb deposition date 2012-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4eupG01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4eupG02
4RGMB 1I85A 5ALBH 1HYSD 5D7LA 1ED3A 5HY9A 4LGPB 1FORL 3C87A 4Z7NF 3ARBD 5CCKH 2EDJA 4NC1C 1B4RA 3S3PA 1JZ7A 1R3KA 1KBGH 3BIKB 4OLUL 1A7RL 4XH2A 1NGXB 4YDJA 2CO6B 3F7VB 3FCTA 4D9LL 5EBMB 3GSXA 4QHUB 1TJHH 1Y6MR 5IR1B 1NSNH 4PJXE 1S9VA 4WTZG 3ECBA 3TN0A 2GSIB 1SEBA 4FQ1H 5C0CD 1I7TB 5E8PA 4X6DF 3ZMRA 1SYSA 2FB4H 5F1SA 3E2HC 5D1XC 4ONGL 3GJFK 5GRYA 3RTQC 1M6OB 2DQGH 2V5MA 1NGYB 4P46A 5DEFB 2OCFD 1B0GA 4WJ5A 3QG6A 2IANB 3ZT6A 3O9WB 3MLRH 2E27L 4X4ME 4P4RB 4JFZH 3RJDA 2V9TA 5E2JA 5DFVC 4XZUA 2NTFA 4OJFH 5C09A 1JI2A 2XA8L 4UTAL 3RTQA 4JZOA 4TVPH 4JQVC 3U6RA 3KPMA 4OF0A 1IAIM 2HLAA 4UDUB 2AQ2A 1U8OA 3HFMH 3K74B 4A6YL 3SO3C 2IADA 4U1MB 4M7LT 4LCYB 3ZE1E 4L8DB 3CDYA 4W81A 1RUPL 4OSUH 2QR0A 1NCAH 4GO6B 3L5JA 1KTDB 4YHNA 3DTXA 4OKVB 4TUOB 2NMSA 2DL9A 5ADOH 1ZHKA 3NFNA 3BAEH 1MCDA 2C3HA 5EOQH 5I16A 4PGEA 2VDNL 2OTUB 4E5XB 4QRRD 5ETUB 1Q9KA 5IHBA 4PJ5D 2BHZA 4MSWB 3MC0A 5ADPH 3FO0L 2QQKH 4YDVB 1RIUL 4KWUA 2NY5L 5LWYL 1S5IL 4K3EH 1NCDL 4X9GA 1BOGA 1CFTB 3W9DA 1IGYA 4KRLB 2D31B 3P40A 2EEDA 3I2CL 2DQGL 1VFAB 4ZSOB 1QEWA 4NRXA 2F19H 1RZ8B 1H8NA 1U8MA 1KC5H 2JJWA 5C6TH 1YEHH 3RZCB 2VDOH 1EXUB 3VE0A 1UKSA 3VWJB 5EU6E 1WJ3A 4XHJD 5D7JD 5CGMA 4LVHC 5HYQA 4KRPC 2CLZB 1TJHL 4M6AA 2Q20A 3I6GB 1UB5A 4BQ6A 1RUMH 5DJ2B 4RMWA 4XP5H 3TBSA 2BJMH 3F62A 4I18A 4MDIB 1O7VA 2DWEB 1J87A 3VXOA 1G9ML 5ERWB 3T4YB 2PUQT 5C0BB 4ZAKB 1I3RB 5I1KH 5CJXC 2W65A 2C1OB 4G6AC 4CNIB 1FYHB 2ZPKL 3B3IA 3TYGH 3DVGB 1UH4A 1KSRA 4IRJB 1AY1L 2DJSA 3MFFB 3ULSA 4C4KO 4K8RH 4UT9L 4K3JH 3OKYA 3VGDA 3DYPA 4PGBB 1JPTH 4KQ3H 1U2HA 2SEBB 4HG4K 2NXZB 5C08B 1BM3H 2X4RA 1MHCA 1MRDH 4OUUB 2EIEA 5CJQH 4QT5B 4OZFB 5BZWA 4NZJA 1ORSB 3QUXB 3HB3C 5DDHB 1DBML 1J0ZA 1D5MB 3CSYB 1BIIB 4NQXB 1QNZL 2GYSA 2PO6D 1X5JA 5EULV 5JPMA 1DDHA 2ATPB 3TNNB 1KCVL 2GSIA 2WWMD 4G9DA 3MJ8B 2Z35A 1EHNA 4L5FL 5E8NA 4YXLH 3F58H 5EOTB 3FQWA 4PJFA 3GMMB 2RB8A 1NKRA 4P4KB 4JJ5A 4DUXA 2FBJL 1L6ZA 1J5OH 3T2NH 4Y16A 4YWGH 1BZ9B 1X6LA 3DMMA 5DC9B 2DBJA 4MDJA 2FATL 2MQCA 3GBNL 1IAII 5F7LB 1A9EB 4KVNH 2W92A 3EO1A 4YHZL 3VXSD 1R5VA 4R4BA 3NZHH 4LEXH 3V8OA 4HUWA 1IM9D 3O0RL 1EHLH 5DRXB 4A2MA 3MZGB 1HHKA 4GRLA 2LAGB 4KJWD 5LCVH 3FOMA 4EDXA 3QA3A 3MZTA 3HZKA 3KHQA 2YD3A 4XRCB 1JZ8A 5JA8B 2OQJB 2QQKL 1F3JA 2CDFA 3RX8A 2VDRL 5MHSD 3BP7B 1SM3H 1QRNE 2GCYA 3TZVC 3L95B 3MRMB 4K71B 2HG5A 2AJUL 3G5YB 2DJUA 4G9FB 5JOFB 4P9MH 3TF7C 2X1PA 2C4FT 5CMAA 4BA8A 2RIKA 3B5HA 3MLVH 1X5LA 2H32H 4GMSL 3UMTA 3GFUA 3OKMA 2VLKE 4Y4KC 1RUAH 1QLFB 4UNTA 3RUGE 1ZTXH 1NEZG 5HYQB 4EI5D 3SE3C 5F3BA 5C6WH 4KROC 4WUUA 4QGYA 3LQAL 5C0AE 2ZKHH 5DD5L 2DJ4A 4ELMB 1T3FA 1P7KB 2BNRE 4XWOD 1G0XA 4RX4A 4LSPH 3A6BH 1KJ2H 1DE4B 1RVFL 5LXGL 3GIVA 4WWID 4YXKL 4GMTH 1NUDA 1J1PL 5EZLB 5GJSL 1J7VR 5A3IC 5BXFA 1I3VA 5JOPE 2HP4A 4MNHB 5DHVB 1IT9L 3QSKB 3NCJH 4EDWL 1NUGA 3LPGA 4EN3C 3HNVH 4RAUA 1DUZB 2YD2A 4BQ8A 3AVEA 3AMKA 5I6XB 3OQ3B 5EN2A 2VKXA 3DPBA 3ARGA 4WGVB 4MJID 3QDMA 1CBVL 2R1XA 4OCXL 2Z31B 3MRDA 1S9WA 4BZ2H 1QD0A 4MXQD 3KLAB 3QEGH 4Q6IA 2P5WB 2GFBA 2LTQC 4G8IB 1CLOH 4UOW1 4M62H 4UDTA 3ALPA 3EDKA 1BIHA 1YMHB 1CICB 4OCXH 1B0RB 2Z93A 3VU2A 3MLXH 3PUCA 2E5EA 5HHOE 3IXTB 4TULL 1UM4L 5I8KL 3FQRA 2NY1D 5F7HA 2DDQL 5KSBF 2Y07H 3MO1B 1QP1A 1JNLH 3SQOL 5GZOC 2BOBB 3QUMB 4NCDA 3ROLA 5KVEL 3GIZL 2IFGA 5B38G 5I18L 2FD6H 4ODUB 4EI5C 5LGHL 4E0RB 3DHMA 4NJAH 3DGGA 5HI5D 1L7TL 1G7LA 3AY4A 5CJOL 3ZTJG 4ZFOB 1YYML 3V6OE 5GSVA 4OF6A 4BM7A 4PRHA 4PTUB 5TDNB 1YYMH 2IQ9H 3TBVA 4FQJL 1BZ9A 3V4VL 2AERT 1UCBL 1I9EA 4M1DH 3N85L 2JJSC 3SDCA 2KQMA 4PRIA 2IPKA 3QZWA 4YXHL 3CXHK 5F7UA 2AJYH 2NZIA 3D5OF 4RFNB 2QKIB 3RX5A 2QQNL 5JO5B 1Z9MA 1FBIH 2OK0H 4PV9B 1XF3B 3PQYB 3FT3B 3JBG7 4M1CC 3MYJA 2BFVL 1AD9A 3HZMB 3IETA 2PW1B 4R96A 2W0FB 1MLCB 4AEIH 2IBZX 4K3JL 3UTSA 3MV7A 4N9GA 1OTUC 1MCPH 4YBQC 4JM2A 5I9QC 1FFNB 1N2RB 3HZVB 4M9PA 3LCYA 1DE4A 1B0GB 3VDBA 1A4KA 2YD6A 1CFBA 1JCKA 1KTLA 5DUBB 1U91A 2NY0C 3BXNB 2FJGA 3KPQB 2LVCA 1G7IB 4PJXF 1CFQB 2NY1C 3KYOB 3OKOB 2FEEL 4GFTB 3EFDH 1MCBA 2W60B 1QLEL 4AH2B 2DI9A 2R9HC 2DDQH 5JA9A 3MJ7B 3QCUL 3CFCH 1DJSA 5DO2D 4XNMB 2MKLC 2UZIL 4QGTA 4X6BB 5IJVA 1LEIB 5KAQF 3G5VB 1U8NB 4WHDA 2P24A 5SWSD 5JW4M 3MLPA 1AGCB 1IGFL 1T66C 3QEUA 3DTXB 2JJUA 1KACB 4OKVA 5F6IC 4WUUE 1HHJB 5D5MF 3G5ZB 3ZDZF 3C2SA 1JVKA 1NEZA 3M8OH 5KBNC 4HIJB 5MP6H 4K2UL 4U1KB 1XZ0A 2AEQH 1OPGH 2F5AL 3ZTJH 3BSZL 3MRIA 3JSSA 2D9CA 4YHYB 1IEBA 4GMSH 4M7ZC 2XXCB 1KG0A 2VL5A 1FH5L 4NSKB 3BKML 1CF8L 3ARXA 4HMEA 2QTEA 4KROB 4LPYA 4HBCL 4O5LL 2Y36L 4N0CC 3ARQA 4YO0A 3SKJL 5MP6L 1E4WH 5C07D 3HNTH 1I9IH 3H0TB 3HUJB 3FTGA 4HPYL 4L8SB 4Z7VF 2VO5A 3GGWB 4PJ8A 3L5HA 5FDWA 1JPTL 3MGTB 3T65B 3VFTB 1NCCH 3SKMB 1T03L 1FL6B 4KKCD 1WC7B 5CLTA 1E4XI 4TSAL 1RUQH 1J11A 4N0UA 1X4XA 3UYOD 5K9JL 1JRHL 3HTLX 3WFHB 2IQAB 2AABL 3GJFB 3PGCB 1KXTB 2B0SL 4PGBA 1YECL 3G04A 4K7FB 3MJ9L 4ODWB 43C9A 3QUZC 1IL1A 1YEEH 4LPWA 5E2VL 1G84A 4LVNC 1KBGL 4GXVH 4OUUA 3VCLB 1VFUA 3T0BA 5BO1L 2NXYC 4K23H 3KJ4C 1BQHG 2VE6A 5LGJA 2L0DA 3GBML 1G0DA 3G6JF 5BVPH 4QHNA 1DQDH 4ZTOH 2YPVH 1D6VL 3ARDB 2UZYB 4G80A 4RNRA 3CCHA 1HYSC 1MLCA 3VFSB 3A0OA 3PQYD 1DBJL 5E2UL 2PCPA 5FYLD 1A6VL 1NPUA 5EWIL 1D5ZA 1E6JL 2C3WA 4FQQB 5TE6H 4MCZB 2XXMB 3X12A 4FTVD 1OY3B 4OBSA 2YK1L 5HHME 1AXTH 4Y5XB 4U3HA 1QFUL 3GMPB 4C58B 1G9NC 1WAAA 2P8LA 2OR7A 4G6JH 1K9TA 1N59B 1MF2H 1VGKA 5ID1A 1XR9B 4W70A 4HXAL 4JDTL 4GKZB 1QO3B 4Q2ZA 1JGLL 4FQJH 4P5TD 5TH2A 3RL1A 4X6CE 3HRZA 3GI9L 1MCWM 4M7ZB 5E8DH 1KJ2L 3IFNL 4XRCA 2D7PA 2UZXB 5JW4N 2V2XA 2JJTA 4KQ4L 5IUSA 3VRJA 2NY3D 5CEZH 5C0FB 3TZVB 2B2XL 4HWEL 4OLVL 1AC6A 5GGTL 4OI8A 1XGQB 3RWHA 2HTLD 3K8MA 1CGTA 1DBMH 3WFEH 1MJJB 3MACL 4MJ5A 4U33A 4MNGA 1RQ5A 2VISA 5D1QD 2FO4A 3VXUB 5KVFH 5E8EB 1JNNH 3ZLQC 5IMOA 4WO4D 5EC2B 2GTWB 4G9FD 5E7FA 2J5LB 4GQPH 4M93B 2X1XR 5T1LB 3LN5A 1S7XA 5C9JA 4YH6A 4N1HB 4XCNA 4K9EL 1T21B 4XTRC 1FDLL 1S7SB 4PJ9A 4IRSD 4XH2B 3D69A 3OX8B 3WMSA 4Y8DC 1KB5A 3ZHDA 3LKNB 1PZ5B 2VSCA 2Z8RA 3TO4B 4ZS6D 4MAYD 3D85D 2F8OA 3V4UL 1QG3A 2J3SA 3MBEA 3ECBB 5CP7B 4YBHA 5D7JC 1OTSC 3H9HB 4JM2C 1V3MA 3GJFA 5FYKH 2CO7B 1NAKH 1DZBA 4DGVH 4O58L 1DBBL 3OZ9H 4PJAB 3BD5A 2Q7YB 1Z0MA 5DRNB 2BVEA 1NCDH 2G5BB 5D2LF 5C6PB 3EJZC 5I1AA 5FO7B 2R1XB 1VFBA 1KPVA 3DVIA 5AD0A 5HVWA 3U7AA 4I5BB 2V7NA 2EDXA 2MHAA 2GEEA 1JFQH 4M8QA 4E41E 1CZ8H 4J4PA 4KK8C 2P5EB 1MI5E 1S9XA 4MA3A 5D7SL 1S9YA 3GNML 2V5TA 3WCYA 4AQ1B 5IIEB 2H6PA 3O6MH 1D9KA 5JUEH 2V9QA 2X4OA 4TOYL 3U7WH 2CXGA 4YHPA 5KN5A 2BNRB 3MLVL 3MYZA 2R0WL 4P99A 4L9LC 2Q8AL 5HHVL 5FIEA 3QXDA 4JRYB 5L0QC 2X9WA 4WDIB 5E9DD 2YD4A 5SV3A 3KXFD 1FV1A 4R4FL 4B7LA 4WFGD 1RIHL 1ONQB 4YDKL 2R1WA 1TETL 3IJSA 4LLQA 1UFUA 4M03A 4MQ7B 4XBPA 2VXSL 3WNNA 5LCVL 1CU4L 3P4OB 3IJHB 3JTTA 2C4XA 5HVHC 1BQHA 2Y23A 1W72L 4WHYH 1MNUL 2VWEC 5F89B 2C9AA 4XNZC 5E2VH 3ARFA 3GRWH 4LFHD 5HHNB 3TJEH 2DWDB 1OGAA 3HI5H 3MJ9H 3GHBL 4OD3L 1S7VB 4R2GD 1M05B 4KJWC 3JUYA 2NY2C 2IBGA 5HVGB 1SBBA 2GJ6D 3O6LL 3DUHA 5I30L 4RGNE 3WNPA 3SDXE 3Q3GA 3BIBX 1JF1B 4Y2DB 4HZLA 2VDMH 5DJZA 1G7MA 5ESAB 4APQA 3FAXA 4OCRL 4HDIB 3MCKB 1IILE 1YEIL 2GITB 3EYVB 1KCSH 3TO4C 3VXMB 1EEYB 5KVEH 1OCWH 3EJZD 1I8LA 1C7TA 5C9JB 4HKZB 2W0FA 1J0HA 1N5AA 3IU4H 2BMKA 4QRUB 4WRLA 1SBSH 3CSBA 4MNQD 3ZT7A 3O41A 5IOPA 4FQXB 1ZOXA 1XR8A 4DK3A 5DVNA 2EYTB 5JHLH 5CIPA 3UAJC 1AXSB 2FO4B 3VXUA 1D5IL 1FVDA 1N8ZB 5JIIA 4G6KL 3OPZL 1JWSA 2EYRA 5E8NB 4S11A 1WFNA 1DBJH 1HIMH 5E2UH 2HKFL 3VE0B 4NN7C 5FGRA 5A43C 1KUMA 2OR8A 3LN5B 4IEFB 1U41A 3D85B 5T3ZD 2YUZA 2NCMA 1OCWL 4AH2A 5T5NF 3GO1H 3WNLA 3EO0A 4ZPTB 5HY9B 2JB5L 2IG2L 2A6IB 5CHNB 5GZNC 3ULVF 1KPRB 3QUYC 4YX2H 3HMXA 1PG7W 3LKNA 2I9LB 4JE4B 4O4YH 4I1NB 3MXWL 4LSTH 1KELL 1W0VB 4HG4J 1QBBA 1CDHA 2FL5A 1CDJA 2Q87A 4F3FB 5IR1A 5T1KA 4H26B 3TP4A 5SV4A 4KRMB 4F57H 1IGTB 1IQDB 5TE7L 2N4IA 5C08A 2BNQA 2WLZA 5D9SB 3TIDA 4Z7WF 2ORBL 3RX7A 2D03L 4PP2B 4FFYH 4XPFH 3H7LA 3MLYH 1ACZA 2ERJB 4G5ZL 3AMLA 4GS7C 4X7SL 1W8OA 5DRNA 4P23D 2ZSVA 2J8UE 3BKCH 5C09E 2J88L 2ZCHH 3KJ4B 3WHXA 2OSLB 3OJ2C 2J1KA 3BDYL 2YBRB 2X89A 1FIEA 4OGYL 4J1UA 4M7JH 4L4VA 4X8JA 2WAHA 3NGBB 4O5LH 4XCCL 4OD2A 2H32B 3I6LD 1H5BA 2EDNA 1U3HC 1FNLA 2E7MA 4QTHB 4XPHH 5JDSB 2VDLL 3QB7C 3ZE2F 2BXZA 1MJUH 4F7TB 1FVCB 2V5RA 5DI8B 5BS0A 2QQNH 4WV1B 5FO8B 3NIFE 3SDCC 1AQKH 1IC4L 3SKUD 1WFTA 3HI1A 3P9WB 4U6YB 3SHSA 1KNOA 4YHYC 4GH7B 2ZCKH 3VFVB 3HRPA 3MNVA 1SEQL 4WU7A 2WINA 1NBZB 4YR6B 1D7FA 4ODVH 4XC3L 4PV8A 2WQRA 4LCCA 1X5YA 1TTUA 4PJEF 4OZHB 3MRFB 1AR1C 1S78D 2WW8A 4LHQB 5A3ID 1WFUA 4Y4HD 35C8H 5HGDB 1I3GH 4V1DD 3UC0L 3QPXH 2CUMA 5DZNA 2F74B 5TPWL 1K6QH 1MEXL 4LVHB 4DQOH 1F3DJ 3MOBH 1ADQH 1KELH 4XP4L 4H1LB 2XTJD 3ARDD 2IAND 3ZSSA 3V7MA 4HIIB 1U8KB 5LG1A 3QQ4B 5ABDE 3FKUS 2X44D 1S9WB 1UXWB 2X5PA 3BKMH 3NPSC 1PLGH 4ERSL 5TE4H 1NAMB 1QSFB 4KTYA 5EOCL 5KZCB 1VCAA 1JTPA 1U92A 4WHTB 4ODBD 1WICA 3S35X 3RPIB 4QRTB 5HVHB 4M5YL 4I0PA 5ENWA 4HKZA 3BO8A 1XR9A 2X4UB 5HDOA 1PW3A 2XFXA 5HXMA 4GRWB 3GSXB 3D87B 1ZHBA 4X4YA 1WUNT 4NBYB 4R7NB 2QL1A 1U95B 1JPGB 5T1DL 5ICYA 3OKEB 3MV8A 4DOHB 4H8WL 3W11C 4RFEA 1NUNB 4G8GB 4ZAKD 4IBLT 2H2PD 1TLKA 5DO2C 5IFHH 1JP5A 1I8MA 5DJ8B 1DBKH 1MIEL 3GM8A 1MHEA 1MQKL 5IEKA 3BP4B 1GGYA 4L1HA 3QUMH 4P5KA 2IBBA 4JM4H 1NLBH 2XZQL 1LDPL 2Q8BH 4OGXH 2NXZD 2ED9A 1RVFH 3BPLB 1A21A 2FEDD 4ZUUB 3REWB 1GOFA 1H3VA 4MD4B 5CD3A 3GMOB 2W07A 4OZGF 1PY9A 3SCMB 1SJHB 4FXGA 3QWRA 3QDGB 3DIFB 2X4TB 4JFYB 5BV7H 1T83A 5ACZB 4NKIL 1V8HA 3CH1A 3ZDZE 3SE9H 4P2RD 1A3RH 4PP2A 2YOCA 2K7PA 1J0JA 1PZ5A 5I1DA 5I1EH 3S34H 1CU4H 2APFA 1BP3B 5LJYH 3HC0A 5GS0H 2R4RL 2R0LL 4OZIA 3V5KA 1X44A 2CIKA 4HK3J 1FNAA 3MNVB 3EZ8A 3Q6GL 1CIUA 1MRFH 5CUSL 1QA9A 3HMWL 5DUBA 4C83A 4OM1L 1PSKH 1U91B 3EOAA 2AJXH 3U7WL 2FX9H 2KUTA 2YS4A 4F7TA 2R9HD 2WBJA 1YQ2A 3BRGC 5EFIB 3ZL4H 1HDMA 4NNXB 2VLKD 3I6GA 3C5JB 4UQ3A 3RWJB 2XRAL 1NDMB 4FFZH 5F97E 5HHXL 2IALA 1LQSR 2HJKB 4P9HC 3IJYB 1CD9B 1A47A 3K3QA 4ORGB 3PDOB 3QDJA 5I8KH 4JFEE 1IQWL 4MYWB 5DJ6A 4N0YL 2BSSA 3LN4B 1RZIB 4J3VA 4P2OC 1S7TA 4RQQB 1CGSL 5KSAD 5HYEA 3MV9D 4OZGE 1JIBA 4IHOA 5E6IA 5E08L 2OR9L 2VXQH 5E99L 2Y36H 4MXVF 3C6LC 1TIUA 1IEAB 4HWBL 3W5NA 1UACL 1INDH 1ES0A 2VMFA 4P2QA 3ARGB 3D3VD 1UXSA 4I3SH 4X6DE 3WLWD 4CAGA 1FSKB 2NY5C 4BH7A 3KPOB 4JANA 3H7BA 4GBXC 3HNSL 2DQJH 4PR5A 4RZCB 4OLYL 4Q6IB 2GKIA 2R39A 1KN4H 4UTAH 3QHZL 5CINL 5FUZH 2OTWA 2ERJC 4YC2C 3QDHA 1KYOK 4YAQB 1LD9B 1XGTB 1PZUB 4F7CA 4EZMA 1VEMA 3TT3H 1BAFL 3DXAB 3V4PH 1T0NA 4PJIB 4HPOH 3DVNA 1IKNA 1B0RA 2Z93B 4FQLL 1GPOH 5C3TA 1A6UH 5KSVB 4TSBL 1JYNA 3FB8A 3H9ZA 1JGDB 3PV6A 4U1SA 4X7EC 3RZCD 4U6HA 4LF3A 5DVMA 1ZGLB 1PX4A 1H15A 1CTNA 2I24N 1JNHA 5CWSB 4BQCA 5J89A 2BSRB 4KAQL 3WD5H 3QH3A 1J88A 2MTPA 3FOMB 4PLKD 4JFQB 4EDXB 1EEZB 5IB1A 2F53D 4XX1E 4YDJB 1NFIB 3ARDA 4RNRB 4KDTA 3IGAB 3NZ8B 1WWCA 2FBJH 1AXSA 1Q9LA 4Y4KB 4PTUA 1KT2B 1TPXC 2EE9A 2GSGA 3D1MC 3X3FL 3FL7A 1I7TA 3WNOA 1UZ8B 4A6YA 4JFOB 3KLHC 4LLWB 4OQTH 5HDLA 3ARTA 3RPKA 2ITCB 1TETH 3CVHA 6CGTA 1MIML 2HVJB 4PD4K 1ND0A 4P2RE 2R4RH 1J8HA 2XOTA 2ZUVA 5DK3A 4I9WD 4JJ5B 5E4IA 2AJSH 4Y1AA 3O4LA 1EUUA 1MFAL 2R0WH 1KN2L 3O2DL 4JKLA 4PJ5B 5EIQA 1ZANL 1R5WA 3DX8B 1M71B 3OV6A 4YGVA 3U9PH 4QWWC 4Q2ZB 3VW3H 3RWCB 3O6ML 3NIDF 2R1WB 3DOSA 3S96A 4LCWD 5CGTA 2EECA 3B4NA 3VFGL 1UWEH 3VFNA 4L3EA 2VH5H 5IVOA 4L4VD 5C0GB 1EZVX 3FQTB 3HHRB 1EO8H 3QIBD 2HFEA 1RZGB 4MXWL 3RBSA 4NZTL 4NT6B 4PGEB 4HLZG 4AIZA 3PWVB 5C71A 4NQSB 1EO8L 3IS0X 5I2IB 2FX8L 4ENED 4KJYA 1BLNB 1ETZB 5C0IB 3VXNB 1KIPB 2X6MA 4YJZL 2BCKB 1A3LL 1LK3H 3LSOA 1MFBL 2VR4A 4P23A 5D96C 5FA3B 1NAML 2DLHA 3THML 4P57A 1B3JA 4ETQB 4XX1G 5IESH 1AGDB 4UIMB 4JFEB 4ELKA 3U9PL 1R6VA 1QRKA 4D0BA 4Q6IC 5IMOB 2F19L 4BFBD 3D9AL 4AM0A 5E5RB 5C7XH 4JRXA 4ZUSA 4QTHA 3GSVA 1WT5C 4TQEL 3OKLB 1EAJA 1G7MB 4O2FA 1ZT4A 5ESAA 1R5IB 4HFWB 4XPBL 5BMFH 3CJJA 5CINH 3LV3A 3UTQB 2EZ0D 1HXYB 4L3CB 3BZEA 2MCPH 4PPTA 2X4PA 1KJVA 3O81A 1K4DA 2AW2A 3WIHA 1BBJB 3MRBB 3OF6A 4KRPB 1DTUA 2R2CA 1Z0NA 1D5XA 5SWSE 4LSSH 1CT8B 1T20A 1DLHA 1YNTA 3Q5OA 1I1AA 1I1AD 3QNXB 1ZWIA 3W5MA 4ZUVA 1ZGLA 3VRJB 1U3HB 5DXWA 4LFHG 2B0SH 4AMKH 2FWOA 3O45A 3C60A 1LE5A 4NIKB 1RZKL 1FE8L 3ILQC 4MAYB 4XCFH 3OF6D 2F54B 3MLUL 3D39A 1OW0A 1XGUA 5MEOB 3P77A 4NO0B 3MUGB 5F9WB 4Z78B 4FFWC 4EBQH 4OF7A 3DXAA 4LLMA 3X14A 3W39B 1FFPA 2AV1A 4Y8AA 1SJVA 5CILL 1GGIL 4F8QA 4U1GC 4HAFA 2CLVB 2XWTA 5C9KA 4JFXA 3H2WA 4YHPB 5KN5B 4U1LA 4U6HB 5L8JB 2EXYD 3CVHB 2DOCA 3B9EA 3EBAA 5IBLD 1FL3A 5I1CL 5DQDL 2VIRA 2R69L 3AREB 4KI1A 2HH0H 4KKBD 3QDAA 1P4BL 4BUHA 3MTRA 4Z7QE 4MSWA 3IT8D 5HI3D 4NZRL 3TBYA 4WO4C 1RIVH 4DGIL 1S5HB 5I1LA 1RMFL 2XKSA 3GJEB 3NH7H 3L3IA 12E8H 3F5WA 1VFAA 4ZSOA 4LNVA 3ESUF 4E41B 4UB0L 5KSUA 1YNLH 3CDGB 3WV0A 4ZO9A 4QRPA 1FGNL 5ID0A 4EVNA 5E9DA 1MUJB 1FPTL 4U7KA 2F58H 4GBXB 1F6AA 5KANI 4Y1AD 4YDVA 1MCFA 4KC3B 4M61B 3RTQB 2AEPL 1AKJB 3L5WB 2Q86B 1AXIB 2CMRL 2H6PB 5HGAB 2QSQA 3G08B 4YQXL 2R1YA 3PNWA 5A2IH 5BVJA 5GIRB 4JHAH 1PEZA 1Q9OB 4ZOBA 1KTDA 1QACA 4QOKA 1U6AL 1GGCL 3CMOH 1A8JH 3QJFB 1MCLA 2NR6C 1D5BB 1JE6A 2YPLD 3EOTL 2CDGB 3BN9D 2UYLA 3D0VA 3QEQD 4HLJA 2VAAB 4MDIA 3NCYP 3HB3D 4P9HL 5EA0H 1N8ZA 3DRQB 3SGEH 5L9DL 3SKNB 4N5EC 3JTTB 3EOAB 4ZUSB 3EYQD 3L7EA 1RFDH 3BEWA 3FB7A 4NRXB 1F5WA 4L8SA 3WYRA 4HJGB 5MERB 1OF2A 2FJGB 3SKMA 5ACLA 3KPNB 4YPJA 1HCVA 3TPUB 5TDPA 3GDBA 3FFDB 5I66B 3CNKA 1QFWM 5FAAA 4J8RB 4JHZA 1XH3A 4JG1L 4Y16B 1EFXB 4OCWH 2YRLA 5L7XH 3UZVB 4H8WC 4ERSH 1QOKA 4ZFZB 3AREC 4OLZH 1WZ1L 3CU1A 4MWFA 5B38B 3G5XA 3AFLA 4AG4H 4HUWB 1MRCL 1P1ZA 1DBKL 2B1HL 3MJ8A 1CFNB 5HYJD 2NY4C 5F6HI 4WO4A 3D3VA 4P2QD 1JFQL 4YEFA 5JHDB 4GMTL 1XIWB 4PGDB 3ZDXF 2DQHL 1MHCB 1DQML 1ZVSA 2YA2A 1UVQB 1YY8A 1HILA 4QT5A 1G7HB 3MXVL 1ZLSH 3TO2B 4OLWH 3TZVD 5FGBC 5KJRL 1RIUH 4FOMA 1FCCA 1MH5B 4HUXA 4WI6A 1MFDH 3MRMA 1AQDB 5EORL 5CS7A 4KKNA 1RIHH 3PWPD 3TNNA 5TDOB 3IDMA 4Y5VA 1J1OL 1JPFA 5SX4I 4HS8H 1SYVA 4XVUC 3MV11 1RHHB 4HHAB 5L8KB 5D2LA 1P2CB 4C54A 2QQLH 3QA3B 4J7RA 2Y5TB 1CG9A 1HKFA 4PRAA 4XBGA 1AJ7L 3NCFB 3WNKA 2VLKA 3HN3A 3QWQB 5MEPB 4FP8L 3ZSTA 4LF3B 4GJTB 4U6TA 4FTVA 3AXLA 5FYJL 4X6EB 4DTGL 1I1FA 1UCTA 1MWAA 2CKBH 2EDQA 2CIIA 4P3CH 1F42A 1X4ZA 1FIGH 5I1HL 3QPXL 2XKUA 2WZPD 1W0WA 4E41A 3IGAA 3NZ8A 2RHEA 5IROA 3UO1L 1EK3A 4KK9C 4PJGE 2K3TA 3D0LA 5IW6A 1Q9KB 3VFUB 3OB0K 4NC2B 4XC3H 4N9GB 1U36A 2V2WA 2EH8H 2MPAL 4QHKJ 2QSTA 5CEZL 5C0EB 1MFEH 1INQA 4HF5H 1XF4A 3E8UH 3S7GA 2ITCA 2EDWA 1B9ZA 4D9RD 5E8DL 4PLJD 5K9QG 3KPRB 4LPUA 1S7WB 1Q9OA 2VH5L 3QWRD 4LU5H 2ADIB 5F88B 5JW5A 1X5FA 3NVQA 5FYJD 1REIA 2AS5M 5C86A 5D71L 1FNSH 5I1GL 3TBSB 5AUMB 5CSBA 3QUXD 2UYLB 3D0VB 4LL9A 1TZHA 4HUUA 5DD3H 5KVDL 5EIIA 2XV6B 4YBQD 5B8CA 5INDB 5L6YH 5LQBL 5LBSL 1NFKA 1RFDL 4Y4FB 5B39A 2XQYK 3VGAC 5TH2B 3RL1B 1IAOA 4AT6A 3AS3A 2VOTA 4H5SA 4PG2C 5TE6L 5T33H 5HYJA 1U0QA 4IJ3C 3MV8D 4TRPH 4QRSA 2YSSB 4HXBL 5HBBA 1YEDB 1Z6JT 4FQXC 2IFFL 3FO9A 1RZFH 3HS0B 1PD6A 1C08B 4OFIA 4M7KL 1G6RL 3IXTA 2CSPA 3VG0H 2IPUK 1X4YA 2QADB 4OIIL 4NQVB 2J8UA 1F8TH 1NAMA 2YXFA 3AAZA 2D4FA 3F58L 3O6FB 1AQDA 2VR9A 1CTOA 1MCIA 2AEPH 3FN9A 1JWUB 3DYMA 3P4LA 1A7NH 1WIUA 4G8IA 3GK8L 4YPGB 3VFWA 4YIQA 1SVCP 1JBJA 1QSEE 4JKKA 1CICC 3WJLA 2G9HA 2D0HA 1MNUH 2DKMA 2IANA 3KNBB 4ZFGH 4GRWH 4WY7H 3QEQA 4PRAB 5E2WH 3WUWB 4JFDE 4AIOA 2BC4A 4JPKH 3O3DB 3PQYE 3BPLC 5CSZB 4W6XB 1J05A 4P9ML 1I9IL 2GJJA 2DQEL 3DI2B 3FQXA 5I71B 1I1FB 1RIVL 5D71H 3T08A 1B4JH 4KKLD 5AEAA 4AEHH 3RGVC 3PL6B 2YHGA 1DQDL 1AJ7H 4NN5B 4QYOA 1YYLH 3GSNL 1N5YH 5EFIA 3L3DB 4WEBH 4QHLA 1R3IH 1LE9A 3I02A 1LO3H 3GMLA 4XPAH 1ODAA 3MV9E 3NIGF 3LRSB 5CBEA 4RBPH 4CDHA 2DMBA 4A6YH 3FRPA 4WV1A 3MSPA 1OPGL 3CX5K 2DI8A 4EUPG 1FG2B 1KNOB 2GK0B 2Z4QB 1BEYH 4QRPD 3LEXA 4WU5B 2BXYA 3V95A 1RURH 3GRWL 1CIDA 3UBXG 3OBAA 3DLQR 1DSFL 3O3UN 4F33A 4LDLB 3CFDB 1AGEA 5EU7C 3P73B 1YEHL 2PYEB 5EDXA 1J1PH 1CQKA 2GTZA 5T3XD 1JN6A 2H2PC 2NXYD 5H2BA 3QEUB 3BN3B 1CXHA 3ARZA 3MRGB 4NT6A 4Y4FC 3O8XB 1EFQA 1IGIH 3C6LB 4I4WB 1ZSDA 1ZA6A 4K3HA 4WDIA 5FYJH 3JWDL 3BEVA 3VI4F 3ME0A 4P0DA 4LASL 2R29H 3KPRE 1F6FB 5IQ7L 2H3NB 4TUJA 3OJDA 5TQ0H 2FX7L 3BP5A 1XF5B 1K2DA 3D3VE 3GM0A 3STLB 3VFPA 5SWZB 1TQBC 2G2RB 3B9KC 1CF8H 3E0GA 5T1KD 2XQBL 2DQDH 5INCB 5TF0A 3MRRA 5DK2A 3R0MA 1IAKA 3P2TA 4MD0A 3LRGA 1BZ7A 1C5BL 4RMTA 3GSQB 3DXAD 1F6AB 3QISA 1QLRB 3EYOA 4WHTA 2A9ML 1A6ZA 1KPRA 3MA7B 4OCSL 4Z76B 1JHLH 5J6GB 1VADA 5GS0L 1ORSA 2AJ3B 4X7TB 1AI1H 1A7OL 3REVB 2R8SH 1BIIA 2RGSA 3OB8A 5I8EB 5D8JL 2VDPH 1T20B 2CK0L 4OZGB 3U7YL 4OZHF 4L9DA 3KPSB 3UJIL 3QG7L 3N1MC 3AS0A 3MGTA 3VFTA 1NEZB 1VPOL 3TBWB 3EUUA 25C8L 2VC2L 2VQ1B 4QRUA 2XWJB 2UWEF 1OP5K 2Z91A 3C9NB 2GJZB 1H5BC 3MBEB 4ZD3H 3OJVC 4ZOAA 3P30L 3GI9H 1NLDL 1KEML 1FZMA 5IB2A 2IWGA 2PN5A 1YNKL 4M48L 1BVKB 2Z8SA 3OSKA 4ZODA 1JWUA 3H3BC 2OJEA 2GUOA 1NQBA 2GJ6A 3LQZA 3ULVL 1BGXL 2YMXH 1RJYA 3VI4E 3BW9B 5JHDE 5EZJB 2VXVL 4OFPA 1FGNH 1OGAD 2IPTH 1KPVB 1I8KB 5EPMA 4PY8I 1ZAGA 5JHLL 3LMJH 4ZYKA 4M02A 4X8XA 4Z8FL 2YN5A 3F12A 1JNJA 3V7AE 5GRJL 4HIXL 4XMPH 1BM3L 4IJ3B 3S36X 1EMTH 4X5WA 1M7IA 1WCBA 2ZG3A 3QIBA 2DLFH 4BKLA 4KTDH 1FNSL 4L3ED 4CGTA 4NHCL 4P46C 4MJ6A 5A2FA 1YQVL 4DFHA 4HUKB 5IVXE 3VXSB 1RK0A 4U1IB 3CU7A 1H0DA 1EO5A 2FLRT 4MB4A 1IGML 3ZKXC 3S3JA 1N64H 3ZKQD 5IV2B 3BD4A 5GISL 5HJ3B 3Q5YA 1C1EH 1HNFA 1QFWI 1FSKC 4Z7OF 1ZT7A 2V5YA 1NDMA 1OVZA 3VH8G 2VDKL 4DVRL 2EDDA 4HH8A 5J1TC 4CU8A 3B2VL 1I3GL 5DQ9B 4DGYL 4RMUA 1CL7I 2A1WH 3QDJE 3IDIA 3TV3L 3RWEA 1AHWC 1SY6L 3O8XC 3QNZA 1CG9B 3BH8A 4FQ2L 1T5WA 4R7DB 5F3HA 5D7IE 4RSVA 3PWUB 5DD5H 1XCQB 4XTRD 2A77L 3DMMD 1X5XA 3HG1E 1PKOA 1CXEA 4OLYH 4N0UE 5FUCC 4CMHC 2F53A 4HKXB 3JWOC 1U8JB 4GKNB 3BE1H 1D6VH 3CPLB 4NFDA 4NQEB 5HHVH 4LRNH 3KPLB 2CPCA 4HJ0D 4EXKA 1FGVL 5DSCA 3LB6D 1P9MC 3RZCA 4LBEB 4PBVC 1YY9D 4Z0BL 2BOCB 4N5UA 2E3VA 2AJUH 2PO6A 3LEVL 3VFRB 4BYHA 2JIXB 3F6LA 4KRPD 4MAYA 5TQ0L 4HJGA 4G42B 1Y6KR 2VSDA 1LEKA 3OXSA 4R2GC 3M1BA 2A77H 4DN4H 4Y5YB 2YD5A 3DX6A 5BZWB 4IRSA 1FVDB 5D70L 1FNGB 5A2LH 5FF6B 2HLFD 1NGXA 4MCYA 1OAYH 3ULUF 3SGKC 3QPQC 4U0RB 3AB0B 4XNXL 3OHXB 2EIZB 2EO9A 1JZ5A 2NLJB 1CLYL 3HC4H 3CH1B 1HXYA 2OBGA 3T8XA 2JELL 3D3VB 5E03A 1CFVH 3BJ91 4UTBL 1ERNA 4I0PB 5JXEC 1BEYL 3T2OA 5DD0H 2AI0H 2WV3A 3MXWH 2IEPA 5E6ID 3QUXA 2BVUA 1HHHB 1C5CL 1JYWA 1RSFA 3MV9A 3I6LE 1J5OL 4XVTL 4WEBL 3ZZ1A 1HILB 4NWTH 4GG8A 1OSZA 1T04A 1LK2A 3LAFA 2IMNA 5EC1A 4BFIB 4G9DB 1WBZB 2VLLA 1SM3L 3I3BA 2A2QT 2NY6B 1E4KC 4M6ML 4KMTH 5J9PB 2H8PB 4P5TA 3GHEH 4HK0A 5GGRA 4YDIH 2R0LH 5F9DC 3X11B 4L4JA 1ZLSL 3G9AB 1XGRB 2QADC 3MOAL 4QRRA 3OJMB 1FQ9C 4ZFGL 5EO0B 3TNMA 1RU9L 2WBJD 2XI9A 2OTUA 5D5MB 2ZSWB 3IU4L 2VDKH 3ULUC 1X5AA 2HJLB 4E41D 3WSQH 3OWEA 2LTQB 5C8JB 3CVHH 3RL2A 4YUEL 2GHWB 2LFGA 3B9KB 5T3ZH 3X3GL 4Q9RL 3QEQB 4KHTH 2FYYB 4JM4L 1RJZB 3UBXI 2P5WE 3RTQD 4F80A 1MCOH 1OM3H 1K8DA 1JPST 4IHOB 4PGZA 5C92A 1KTKE 5D96B 3GO1L 1VPOH 1JNLL 3AS2A 3SQOH 4Q97A 3FQXB 1MWAH 4P2RA 3OGCB 5DD6A 5ICZB 1IGCH 5GZOD 2Z0BA 4FQLH 5HGDA 1IKFL 3KVQA 3PWPA 5GGSA 5DWUH 2OK0L 3S4SG 5GXBB 2H9GA 1RZJH 4WI7A 1AP2B 2BY3A 3QNZB 1ZA3A 3MRNA 5ACMA 1FG9C 5E00A 3TZVA 3F7YA 5FUZL 5JLZB 4JZNB 3NH7L 1XH3B 2FIKA 2R23B 3IB4A 1R3KB 1CLOL 1LEKB 1K8IB 1OAXL 1WC7A 1BJMA 4LNRA 1C5BH 4PJCE 5E2WL 3TYGL 1L7IL 3E6FB 4X9BA 4LARH 4PJ8D 5F7EH 5DDHA 3QUKA 5D7LD 2BK8A 3FMGL 1E0OB 1GOGA 5B3JF 5C0RH 3GMRA 3WIHL 3EYSL 3T0WA 5DD0L 4O00A 3WN5A 1ZLUH 2VJXA 4GW4B 5EOTA 3PWNB 2OL3H 5JQ6H 4JO2L 1FO0L 5F96L 4XNQB 4FZ8H 1A5FL 2BDNH 4I0PD 4R0LB 3EAKA 4ONOA 4P2QB 3EDEA 3K2UH 3PABA 1MCEA 4PJBF 2QV2A 3JZ7A 1SEBB 4N8CL 4NGHH 2VLLB 4EIGB 5FK9B 1GL4B 3FT4B 4Y19B 1YPZB 4Q9CA 3DUSA 3TIDB 1OGTA 2W9DL 5SWSA 2D3VA 5F8QC 3QUYB 3EYUL 3IXAA 3IVKA 2WUBL 4QCIB 2VE6B 4DUWA 1YMMB 4GG6E 3BIKA 5DJ0B 1T7VA 4GLRI 2ZSVB 1RUKH 2YPLA 3C8KB 3RWFB 2IAMB 4WWKD 4EI5B 1INDL 3KS0J 4NN7B 2I9LA 4F2MB 1NL0L 2DMKA 3V0WH 1A4JB 5DS8B 2AXGB 4QOKD 4X6EA 1DL7H 5ACZA 3KYAA 4Y4HA 3KYKL 2RAMA 2WIIA 4ODUA 5SWZD 5T1KB 5GGTA 2PO6C 2ZCLL 5JORA 2VITA 3GSRB 3WEXA 4TQEH 5IW6B 1UM5L 3MV7D 3UTSD 4L8CA 1TVBA 3C08H 1CDYA 2V7HA 4UNVA 2Q76B 3KGRA 4GKSB 2ICWB 2OTPA 3O4OC 5IP4A 4Z6AT 2HLAB 4UDUA 4WHCA 4CL7A 1UZ8A 3NZHL 3TGXA 5AYUL 3K1DA 3U36B 5J06A 1F3RB 5TDOA 4I9WE 5TF1L 4UU9B 1I7UB 3VXRE 1MCQA 2HMID 2X89D 1WZ1H 2X40A 4XCYA 3FN0H 2GIYA 4LLYB 1LDPH 4PRID 1ZA3B 1TTFA 1A2YA 3T09A 2D0FA 3SJVE 1U58B 3DETC 2H2SD 4X99A 1YN7A 3A6CL 1ZKAA 1OGAB 3Q2CA 2RQ8A 2F8VA 2NX5E 4N90E 5D2NC 4ZSOE 1RV6X 4PRHD 4UT7H 1TTGA 3LEYL 3UPRA 4Y5XC 4ZUWA 2BFVH 1XEDA 4G6KH 5C08D 2C7UB 2W59A 3UCRA 5F7NC 2G75B 4XVUD 1AGFB 5FOBB 4NFBA 4D8PA 5EZIH 4NM8H 3FQWB 4PG2A 4WY7L 4AIZB 4JFDD 5IEHA 4OLXL 4YHML 3N0PB 1A6VH 1SHMA 4KK6C 5EO1B 2YXMA 1T5XA 1SBSL 1XZ0B 1G6VK 4NKIH 3CC5A 5I75B 3TC9A 1ZVHA 1QLRA 3RDTC 3D39D 1N0XL 5I1JL 4FQHB 2MQ3A 4LPTA 2AGJH 4OFKA 1TCRB 2L4OA 3C60D 1F8TL 3H3KA 4OGAC 3B5TA 3AM8C 4R7NA 2OLDA 5GRXG 5SX5K 3P30H 2C4FU 4NZTH 1BFOA 4NRYB 2BJML 4WFHD 2AQ1A 4ZOEA 3WDJA 5L2JB 1GYAA 2Z35B 3MGOB 3FT4A 3QDMD 3VXUD 1YECH 4AG4L 1U92B 4MJIA 2MPAH 1CGYA 1ZLVK 4H8WH 4DVBB 3PHQA 1DANU 1UENA 1A1NA 2R4SL 1P6FA 4PYGA 3UC0H 4OZFA 1GPOL 1I1YA 1K4DB 1A0QH 4XP1L 3DMMB 5D8JH 2A6JB 1NBYB 1QPPA 4LRIC 1WZLA 4JY6A 5DT1L 1UZ6F 2HKHL 3IDNB 4M1GH 2C1PB 4WW2B 2XZCH 3Q6FA 2X4NB 3NCBB 3LOWA 2NY6C 4LCIH 1BVKA 1V05A 3OAUL 4JRXD 5C0CE 1KN4L 3B2UD 3DUSB 3TIEA 5D1QB 4RX4D 3GSNA 3FB6A 3C6SA 5KTEH 4JAMA 2C3XA 5EU3B 4JCMA 4Q0XH 2LU7A 5ISZB 5HHMD 3GMLB 4GAFB 4ALAH 1JF5A 4LU5L 4WUUD 4EJ1C 4PV9A 2VDLH 3ZE2E 1R3JA 3ARFD 4WUUB 5EZOL 4EI5A 4EIZC 4K94H 5DMIL 2QSCH 5DUML 3T2QA 2QJDA 2VN4A 4OZFG 3HPJA 2OR9H 3UTTD 5TF1H 1U3ZA 4GRMA 4XP6H 5IQ9A 2FGWL 1DANT 1CVSC 5DRWB 4U1JB 5BV7B 3QIBB 3PWPE 1HSBA 2XY2A 4PJIF 5FEBA 1CE6A 3S9DB 4LCWA 2FJFB 1FVCA 3KWWA 1JTOA 2LU3A 5GGUB 4OGZA 2V2TB 4CW1A 1IQWH 3KXFA 2UUDK 3WUWA 1XGYH 1Q72H 3K4ZA 2I9TA 4O58H 4JPIB 5E6IB 3O4LD 2ZOKB 1VKXB 4X4MA 3O6KH 2PCPB 4EI6A 1WCQA 2DQIH 2JK5A 2V2WB 1J8HD 1SEQH 1NC4B 3RQ3A 3MODL 3K1KC 3SDYL 3B43A 2VABA 4WFFE 3NA9H 4OF8A 4NM4L 2ZUSA 1MAKA 5JMRA 1VB9A 3I75A 4XWGL 1NL0H 3V0WL 3PP3H 4J4PD 4CNIA 2ZUUA 3B3IB 4LLAA 5FM5M 5FOJA 2OP4H 3OKNA 5EBWB 4AJ0A 4LEOA 4U1NA 3VXTB 2DQUL 4JG1H 5HTSA 4JFEA 2FHBA 4JO3L 2P7TB 4AEIL 4E9LA 2F54E 2ARWA 1OAQH 5D2NE 2IALB 1JL8A 4CVWA 3QIWC 1A6WH 3MX0A 5I8EA 3MO1A 2GTZB 3MUHL 3V0VA 2Z31A 1UXSB 2NPLX 1FJ1B 3UTZB 4PJ7A 5KVFL 2KZ1B 5IFAH 1BVLB 2BDNL 3WFDL 2B7DT 1F3DH 3F7QA 3RI5F 3U82B 4ZO8A 3MBED 5DC0A 3D85A 4D9RE 5AZ2H 3IFPA 4DVBA 4ODHH 3OGCA 4JGMA 2AV7A 5DD6B 5K9KA 4PJ9D 4I3RH 1AR2A 3DO7A 3ZL4L 3PHOB 3TO2A 1EH9A 1A7RH 2ADJB 1BD2E 3VFPB 3KLHD 1QBLH 4L29A 4PY7B 1II4E 4WW2A 4PJDA 1HKLL 3QNYB 4W6WB 2EZ0C 4RFOH 4HXAH 4MMZC 1I4FB 2QR0B 4BH7B 1W8NA 4WTZA 3T0EA 2EDRA 5ITFA 2XTJE 2IH3B 1KCVH 5D1QA 3EYOB 5FGSA 5HD8C 1KTRL 2EYSA 1S7QA 2P1YA 1A6ZB 3I84A 4J6RL 1G7JB 4XHJC 4NOFA 2O5ZH 1MFCL 1MCHA 3CZFA 4Y4KA 1I1CA 1TFHA 1CE1L 4BZ1L 4PJAF 5KSAA 4MAYC 1WWWX 3KJ6L 5JMOC 4GAGH 4KZEL 4BQ9A 5D7JA 1NCTA 5ISZE 4CUCA 2WNGA 3WXVL 5IB3B 3O11A 3L3JA 1F13A 3BQUB 2BNUB 2MFNA 3ARPA 3BZ4A 4KMTL 3FB8B 5A40E 1KEGL 4CN1A 1EGJL 4HKBB 1MREH 1P1ZB 4J6RH 2FZ3A 5E8PB 4GUPA 5BQ7A 3QDJD 3B9AA 2X1QA 3V9FA 4U1IA 1T1YB 4IDJH 3ZHLA 3PWVA 4M1DL 1UB6A 3KWWB 5JDSA 1N7ML 4QYOB 5DRZB 4PJ5A 4BELD 3S3SA 5IKCA 2W0KA 3GMPA 4IDLA 1UVQA 1PQZB 2EO1A 2EKJA 1C5DA 4I0CC 1P7QA 1IZJA 3HA0A 2R2BA 3GIZH 2EXYC 3S96B 1LWRA 5F70A 1EJ6A 2B20A 4JFHD 1KXQE 5FHBH 5IBLC 4C83B 4L8DA 3TVMC 5FV2A 3U2SA 2P8PA 2XNAA 2HTKD 2JCCA 4TSBH 2WWMC 5I19H 4N8VG 5EZJA 3RUGB 1XF3A 3PQYA 4EBQL 3DMMC 2VYRE 3QR2A 1ZGLM 3JV0A 5AUMA 5FM8A 5D4QA 1VHPA 1MCCA 4HWZB 1WZMA 1BBDH 4JREC 3IDUA 1BWMA 2ZOKA 3CUPB 1CXKA 3VGBA 2BHYA 3HNTL 4EI6B 4Z18A 4X7FC 3RWCA 1NMBL 3V5DB 4WCYL 1BX2B 3C5ZB 3PGDB 4JY4A 5JOEA 4GG6F 3OB0H 2QSCL 4JN2B 1WITA 5F7KC 4PJ7B 3TN0D 3KYMB 5E5MA 4Q9QL 3QWOA 4NKOA 5GPRA 4PJFB 3HS0A 3WUWG 2A6DB 3M1BB 4R8WL 1S8DB 4IRSB 3ULVC 4Z77B 2R23A 4HZAA 1GOHA 2IAMC 1CFSA 3OAUH 1OGAE 1PG7L 4PJHA 5BV7C 4ZXBC 3LPFA 5TPWH 3QCVL 1U8QB 4X0KB 4XNXH 4NQVA 4ZAKA 4HX1A 3BT2L 3E6FA 4DW2L 5GJTL 1X3DA 3P0VL 4PY7A 2P5ED 3RWEB 1OP9A 2ICES 5J1AA 4XI5C 2EDTA 4R7DA 3MLSH 1JZ4A 1TNNA 3HR5A 4I18C 3QUMA 4HQQL 2IGFL 3UX9B 3ZO0A 4FFZL 5FKPA 5TQ2L 2GQHA 3UBXB 4CVXB 4KRNA 5I1DB 4NWUH 1RUAL 3K80A 4KXZH 3J7HA 3C08L 1FZKA 3EFFB 3C5SA 1AQKL 1E4XH 1IC4H 3V7AG 1MI5B 4Z7UF 3DXAE 4XWOC 4LSQL 4PJDB 1D5ZB 3QQ9C 2CJUL 3G04B 3DIFA 43C9B 4KUZH 1E28A 4PJBB 1QQDA 4C56A 3I3DA 5E6YA 4GLRH 5D9SA 3SDAA 4PJCF 5AAWA 3ALXA 2MKWA 1OWWA 3FO9B 1DVFC 4JZJC 4P4RA 5DR5L 4NBZB 1ZVSB 1MAJA 1JGVH 1FAKT 5J0BA 2ZOLB 4GRWE 5GZND 2VLRB 3QQ3A 1XGUB 2Q1EA 4D0DB 1PY4A 3IAGC 2D0GA 2IADB 3FZUD 2N7BA 3TN0C 4V1DA 4UIKL 2HVKA 4PRNB 4J23A 4NZDA 1IL1B 3BZ4B 1PYWA 1LO0L 5FYLL 5KG9B 3EOTH 5I1GH 4JM2D 3AC0A 2DQTL 1JWMB 4JM2B 2YPVL 2BNQE 1XF2B 4G6AD 2LQRA 4Q58C 3QDGD 3AB0C 3TJHC 5D5ME 5DLML 5FDYA 4QHMB 4E42A 2R2HA 3CLFH 3ZKMD 3GKWL 1JGEB 2LU4A 2O5YL 1RPQA 1LNUA 3WIIH 5GHWL 5BS0D 4W68A 1MWAB 3STZB 2VRAA 2VXUH 2MOVA 3JUZA 3X17A 4ONHA 2X7LB 3EYSH 3V5DA 3BHBB 2VDOL 2FX9L 2R2EB 5I2IA 3DURB 4OLXH 4YHMH 5JXAH 3RUGA 1OP3H 2FHFA 4ZXBB 2HT2C 1N26A 3L3KA 2BSSB 2E8ZA 3SDCD 1UQSA 3RKDC 4HSQA 2DBLH 1DQLL 1EBAA 1E6JH 1B6UA 3MPCA 4Z7VE 5FUOH 1A7PL 3G6DH 4O9HH 4D0BB 1FG2A 3ARSA 4JHBA 4NKMA 5TGBB 1VADB 4CMHB 1G7PA 4HS6A 5EBMA 4K8RL 2BNQD 4BZ2L 4OZHA 5C2BL 1YEIH 1A3RL 1ZT4B 3OXRA 3GIVB 4LLUA 2Q3AA 3ROLB 2ZUXA 2EDOA 5DHYA 2BVPA 1QVOB 4GW4A 4OM0H 1HH9B 4QRRE 4K3GA 4JLRA 4PRDA 5J11B 4LKCA 2YUXA 3FFDA 1FVEA 1KJVB 3H0TA 4HS8L 1J1XH 4KDWA 1BECA 4J3TA 3W2DL 4YHLH 3JV4B 4ZPTA 3ARDC 5ICXA 3U9UA 4G42A 2HMIC 4OIIH 1EJOL 2H3NA 1K6QL 3IF1A 2O5XL 4TUJB 2NW3A 3MRLA 1TZIB 1KT2A 1IFHL 3MFGB 1C8PA 1T2XA 2VZ1A 4MWFB 3SKNA 3MV7E 3IRPX 3MBXH 3MRDB 2MNUA 2UZIH 1INEH 2I60L 3C8DA 1DBBH 5SWSB 4K3EL 3RRQA 1JPSL 3GSOB 4P3WA 5IG7A 1EX0A 5C07E 4GXUM 5H94A 1RZKH 4XVSH 4XCNB 3UDWC 3HKFA 5HHXH 2P7TA 2NTSP 3ARGD 3QXWA 4G8GE 1I8KA 5FM5O 5DEZA 5TDPB 3TO4D 1HXMB 4MNQA 4D9QD 3CXDL 1MCRA 5E94A 1KCRL 5F1IA 1YEKL 4X98B 2AK4D 1FZKB 3EFFA 1VFBB 2GSGB 1W2KT 4EXPX 1F97A 5C0ND 2P44B 2NY4B 1HHKB 3CX2A 4APQD 3UAJD 1HZHH 1FFNA 3BWAB 3NAAL 4WCYH 5IJKA 3GSRA 3WEXB 4UMGA 1F4WH 4GXUN 1S78C 1LEGB 1KTLB 3NPSB 3O2DA 4MCZA 1A1OB 3X12B 5DZOA 1ZVYA 4LSRH 1A6PA 5I73B 3ABZA 4Y1AB 2CKNA 5HHNA 5GS1B 3MNWA 3FRUA 2EKSA 4JFPA 5DWUL 2BSTB 1GHFH 5D7IF 5GRVK 3I6KB 2X4SA 2JLLA 2YZ8A 4XP4H 4IMLB 3S35H 2CKBA 2WSKA 4PUBL 1MQ8A 1HQ4A 2WQ8A 4EN3D 3WLWC 1ZLWK 1I7UA 3F5WB 1ORQB 4KY1L 3C5ZC 3I50H 1A7NL 4XAWH 3H3PH 1YMME 5C0BD 4HH9A 1FZOB 1U3YA 3IDJB 4LKXA 1MPAL 3HAEA 4YC2B 5IT2H 3P0VH 4OD1H 3QCTL 5DJ0A 3FT3A 4CDGC 5BJTA 3DGCR 3QCVH 1N5AB 3SDXF 4QHMA 4E42B 5AG9A 2FR4A 1XIWC 5IOPB 5CCKL 4YZFE 3TBTB 3BPCB 1F11B 4YHIA 2W9EL 4L8SC 2EE3A 1I7RA 4PJCA 4GRLD 4LLDA 3O9WD 4XXCC 2IFFH 1T2QH 2M2DA 3RVWD 1D9KD 4AM0B 2CGRL 4WTWA 4AL8L 2P8MB 1XFPA 3BZFA 1FL5A 5DJZB 3LKPA 4CJ1A 1S7WA 1W0WB 3GSWA 4Z7UA 1P5VA 3VXSA 5IBUB 4MLSA 2FWOB 3JXAA 3O45B 5CKGA 5DJCA 4NUGH 3CFJA 2ZJSH 4YXHH 1A14L 3V6FA 3FONA 4NO5A 4WV1C 1Q0YL 3TVMB 4CVUA 1MCSA 3VD5A 2W9EH 3BPOB 1AH1A 1E4KA 5INCA 2D7OA 2P5WD 4CMMA 1CR9L 2GFBB 2VQTA 4TVPE 3BQUC 5DJ6B 1QFHA 2X42A 5DVOA 4QRSB 3HAEH 1QBLL 2P5EE 2LVEA 3DNKA 4I3GA 4KKAC 1BHGA 4JLRB 4PRDB 2DTSA 5T3ZL 4NQDD 3X3GH 4Q9RH 5BCAA 3C60B 4CU7A 2AVGA 3JWOH 2J4WH 3CUPA 4B0MM 3IRZA 4RAHA 2XKNB 5HI4C 4HQQH 1Q94B 15C8L 5HDBF 2AABH 2K7QA 4URTB 2V9RA 4ODTH 1WBYB 4GKNA 4MZ3A 3G6JA 3B9DA 2ZNWA 5C0DA 1YQVH 4V1DE 2P4AB 5IVXB 3KYMA 4NQCA 4WEMB 4TUKH 4G9FA 3W0WB 1FO0A 4FQQA 5JOFA 1FE8H 4XCFL 3H8NA 4TVSa 1S9XB 3S8WA 4GW1A 1KEGH 4KH2A 4L9LA 3R06B 5ITFB 1MJ8H 1AO7A 2MMXA 4O51B 1OSPL 1TENA 2EE6A 3OKMB 5F71A 3MQIA 1LE9B 1R3HA 4GAGL 3M07A 5I17A 3HPJB 4MCYB 1RUKL 2X4SB 1ACYH 2D7MA 4LLVA 5FCUH 4LRIA 4JB9H 4X4ZA 4OQTA 1V7ML 1RHHA 3WIFB 3O3AA 5J6HB 1X5KA 2VDML 4PREB 5EUOF 1XGPA 5J12C 5KSUB 4JO4L 3H42L 1NBVL 1BQUA 4E5XA 1H3TA 2I60H 4LK4A 3P9LA 3PHSA 4JQXC 3MV9B 3ORJA 4JY6B 5JIKA 4G43B 1UA6H 4PRBB 5E2TH 4U1HB 1T4KB 3BH9B 1QPXA 4XGZA 3OJDB 5J11C 4F33B 4I2XE 2DWDA 3IDYC 1J0IA 1NANI 2FSEB 3VWKC 2AKRA 2A38A 2K9UA 4L8BA 3A6OA 4D3CH 4QTIL 4H25B 2YD7A 3JVGA 3BEWB 5EBLA 4F58H 3O4LB 4KVCL 4OLUH 1HSAA 4KTEH 4GRWF 4MMXC 3BYYA 4LCUB 3PP4L 5C09D 2OL3B 5EU4A 5DJ2A 2ICEA 4G7YH 4ISVA 4OB5L 3TYFA 1OW0C 5DR5H 1F4WL 2VXTH 3U48A 2QBWA 4Z76A 2CD0A 1CD8A 1OARH 1PYWB 4WU5A 2YKLH 3HCVA 4P46D 5GRUL 5DFVD 4BSWB 1UWGL 3UZQA 2ZZUT 1P4BH 3RL2B 4J3UA 1JHTB 3CVIH 4OTXH 3GKZA 3S34L 3GI8H 2R2HB 5CZVL 3L6FA 5JXAL 5DUPL 4KI5C 2F53B 3ZE1F 2YMXL 2B4CC 4H1LA 1VGEH 3U0WH 2FCBA 4UV7L 1FYTB 3O2WL 3FQUB 3V6FB 4CADB 1FN4B 3EW3B 2GAZA 1AY1H 4H5SB 4CKVX 4M3KB 4UOW0 1P5UA 3SJVA 4V2CB 3DVNB 3VFRA 5I1KL 5C07A 2GTWA 2ZNXA 1U8OB 2D7TH 4ZTPL 3I9GH 3ZDYE 1Z2KA 4I48B 4L3CA 3BZEB 1QR1B 5FA4B 4X7CC 1EAPB 1XF1A 4QY8B 4IRZH 3MCLH 3HC0B 1JV5B 4FMFA 3V4UH 4XMLH 3NFPB 1X5HA 1A6UL 4HJ0C 1O7SA 1I1YB 2YA0A 3ARYA 3C5SB 3DRTA 3ZDYF 1S7UB 3AAZB 4ALAL 3GZKA 1OD7A 1T1XB 3UTZA 1KXVC 4LIQL 4UNUA 1OTSD 1AC0A 3PL6D 4M43H 1U3HA 1LVEA 4LSVH 1A6WL 4MAUL 4X6CB 2YBRA 2LV4A 4MJ6B 2MWCA 4YLQT 3WN5B 4LQFH 3QDME 3T0XA 1BBDL 1CDCA 1AO7B 1RZ8A 5L0QB 4FNLH 1G1CA 1EXUA 4XBGB 3QYCA 4KI5F 2IC2A 4DGYH 5T3ZE 3MNZB 3IDXL 1HOCB 4R0LA 1I8LC 3VXUE 2ADGB 4HK3N 3QDJB 5JUEL 1EERB 1NFDF 4NKDB 2APVA 3UPAA 3CXHJ 4HC1H 5B3NA 4F37F 4FTVB 5JXED 4XT1C 2X1WL 4JPWL 2ESVB 2ENSA 1CFVL 4R90H 1ZHLB 3MBEC 1YPZA 4Y5XA 4GAJL 4KY1H 4A2LA 1RZIA 4KFZC 2P8LB 2BNRA 1BZQK 3VRLE 4FFVC 3U7YH 3G6JE 1L0YA 4MXWH 3SEPA 4WFGE 4F9PA 5E0QA 1F90L 3VXQA 2O93L 4GAYA 4F37K 1A1MA 4XPGL 3HZMA 1N0XH 1MJ7H 4FQXA 5FKAB 1AFVL 3L3JB 1UC6A 2ILLA 1H8OA 1FC2D 5B8CB 1BQLL 4HPYH 2NX5D 4N90D 3ARBC 1RURL 3EGSB 3QO1B 5HDQH 1AXTL 2NX5B 5AWNH 5GRJH 1X5IA 2NY4D 3BUYA 4NNYA 4AK1A 4NM8L 3MGAA 1RJZA 5C08E 4GSDH 3O8XA 5C0JB 4BZ1H 3UTTE 3S37H 5DRZA 4TNWK 1OT1A 2PR4L 3BGFC 3CX5J 5EU6B 2IAMD 3L6FB 4WWKB 4HGKC 5DD3L 3S4SA 5KVDH 1BGXH 3VFMA 2A0LC 4UT7L 3ZYJA 3QEHA 2FX7H 3QFJB 4CN4A 5FGCB 1F4YL 1IC1A 1WBXB 3IJYA 1KJMA 2VLJA 1BBJA 3MRBA 1FN4A 4HC1A 1U8HB 3T0EE 1KEMH 3W82A 4BFGA 5DSCB 4JFFD 5BMFL 3SO5A 5DK2B 3HG1A 3KPSD 4PJ7E 1WTGT 3Q3GB 1JF6A 3IDYB 4ZFFA 4JZNA 1CS6A 5FYKU 4Z95L 5DRXA 1LO4H 3B2VH 3VDAA 1R3LA 5F96H 1YMHA 1MI5D 3LQAH 4Q7DA 1X5GA 2VERN 5SWZE 3BPNC 2ZG1A 1C16A 1CL7L 1D6EB 3BZFB 2BC4B 3ROOA 5K33A 3QP3A 2HTKC 2R56H 3NN8B 4NQCE 3ESVF 3EIFA 5FYKD 4DKDC 1RZJC 5ANMA 4X8JB 5CLWA 3GMQA 1JNHB 3KYNB 5DJCB 4XAKD 4X80L 4I2XA 4TNWF 5I8CB 3RFZC 1VEPA 1E6OH 3VA6A 4MJ2A 2E9JA 4LOUD 2DTMH 2DD8H 3S6CA 4FQHA 5E9DE 1OAZH 1T89A 3I02B 1N4XL 4GG8B 1UJ3C 5CGYD 4BK4A 2Z9TA 5TFSH 5FF6A 3LMJL 2YD1A 2ZSWA 2FDBP 3ARRA 5D1XB 5CJQL 1HYRC 5KG9A 3UDWA 1F02I 3FQTA 1FLRL 1XF2A 3NACL 2MSPA 4OLVH 1EO7A 4HCRL 3U83A 3T8XB 4XVJH 4PS4L 1RULH 5J13B 4JRYA 4S1DD 5J7CC 3N85H 3GSUB 3KXFB 4H20H 5EIVA 3WIIL 1UM6L 3M17A 1IAIH 2VZ3A 4EEEA 2Z31C 3D48R 3BN9C 5JQ6L 1YPZF 2A73A 2EC9U 1UZ6E 3O3EB 3ARGC 4UAOC 1UXWA 3FAWA 5FO9A 4YXLL 5I18H 1AKJA 1DLFL 4GW1B 1XF5A 5FHAL 1RULL 5JIHA 3PXJA 3SDAB 2HT2D 1GZPA 4GQ9L 5DMJB 4QXUL 1LO3L 3EYQC 1BJ1H 4UUJA 3WHE1 3BXNA 1EIBA 4IOFC 4UQ2B 2V7HB 5EBWA 3F7RA 1B88A 1KB9J 1S7RB 4QXTB 2ICWA 4U0QB 5BJTB 5T1MA 2Y6SC 1A1MB 3D69B 1ZT7B 2WWKO 4S2SA 1VACB 3UROR 2AJVH 3TESA 3B8YA 4YR6A 3WE6B 4MAUH 4Y2DA 3DI3B 3QO1A 3EGSA 4O2CB 1IM9A 4JPKL 5TJWK 3GSVB 5F6IB 1UYWL 3IDGA 1OL0A 1XCQA 2HFGL 1B0WA 4JN2A 1A0QL 4XP1H 3RVVC 5ILTH 4LGSB 2W9LA 3HE6B 1Q9WA 4TOYH 3D39B 4LNRB 4Y16D 3FZUC 2ADFL 2JB6B 4ACPA 3VWKB 2EEAA 1MCOL 1OM3L 1HKLH 2CLVA 5KJRH 4IRJA 1JPSH 1DDHB 1JRHH 2ATPA 3GMRB 5EBLB 4OCNC 5CJOH 3LQMA 4W4NA 4PJGA 3RWGB 1MHHA 1MIEH 2VQUA 3BGAA 1AP2A 3TJHD 1GAFL 4UV4H 3MLUH 4ZUTB 5LVEA 2GUOB 1P7HL 3O9WC 3HMXL 1UEYA 3TBWA 3BW9A 2QEJA 4QCIA 3RKPA 5I8CA 3QO0B 4XP6L 5KSAB 3BI9X 3U4EB 5FKPB 1DFBL 3INUH 1GZQB 1F4HA 2LABA 5FCUL 1D6EA 3TCXA 4OZIE 5EUOA 4O2EA 5GGVL 3BWUC 5F8RC 3IAPA 4JVPA 2RCSL 2XG5A 3S37L 2HFGH 4JFOA 4MJIB 2XA3A 1L7IH 4RFEB 4M5YH 2PTTA 2DLIA 2XYCA 3KYNA 3IU3B 4MZ2A 2W9DH 1RJLB 1CXFA 3PWNA 4OJFL 5IB5A 4L8CB 5IKCB 4NWTL 3RAJL 3CCHB 3MRLB 1DQLH 3F12B 4POUB 1C5CH 1IGFH 4XNUL 2VLKB 2FEDC 3UYRL 1X7QA 4NRZA 3BGFB 3B9KD 3UXFA 4LHUB 4RDQF 2HVKB 5HI4D 1NC2B 2HRPH 1U8IB 2IH1B 4LHUD 2FECL 3T0EB 1GZPB 3P0YL 5FHBL 7FABH 2J4WL 3CDGA 5F7MC 5FECB 4QHLB 4JPWH 1CXLA 2H41A 1C1EL 2YC1A 4X9FA 5I15L 5B4MC 5IHUH 5H35B 4DZBA 3L95A 2VLRD 5CJ5A 1OQOA 4M7KH 1XR8B 3NABL 4OF5A 2Y4SA 3K2MC 1FFOB 1RJCA 4Y4HB 2JJTC 3WSQL 2ZUYA 4JQIH 3RGVD 2FH6A 3MRHB 2HN7A 4LLYA 3SOBL 1NCWL 1HI6B 1L9NA 2FHCA 3ARFC 1NUFA 3MLXL 3D6GA 2R0KH 1U58A 2E7BA 4LCUA 3ZKSD 2OTWB 5CJ8A 3W11D 3K4AA 3EYUH 3I6KA 4ZAKC 3VMNA 1JYVA 1NMBH 2MCPL 1P7KA 4AL8H 1FNFA 4APQC 4QF1A 4NKMB 5TGBA 5D7KD 5HHOD 1Y6NR 3KAAA 5D72L 2NXZC 5C0CA 4NN6B 3SKOB 4U7SA 4AT6B 3C09B 4KKAD 3O6FD 3V4VH 3GBMH 5EH1A 1QZ1A 1VFOA 2J6EL 2R56L 3WNMA 5HHQA 2XPGA 1KB5B 3BUTA 3LS4L 4K7PY 1MPAH 2VAAA 4IMKC 4YHIB 1KCLA 1IARB 3GBNH 3OR6B 1LHZA 3BP5B 3ARBA 3QDMB 5IF0A 4HLZH 3S5LA 3U0WL 2EDEA 1MEXH 4YWGL 2HFTA 3EDFA 1FL5B 3S35L 5T1LD 1I75A 4JKPH 3GSWB 3OHXA 4YFDB 4MA8H 1QSZA 4HEME 3DGGB 4JRXE 3GSNB 4PJAA 5DQJA 3FO0H 4RGND 4J8RA 3QHZH 3V8CA 2PKDA 2PETA 4L1DA 3ZKND 2H45A 1OARL 5GS3A 2V7NB 5IB2B 1N0LA 3PABB 2DQUH 3CDCA 4H0GA 5TE4L 3DRTB 4PRNA 4FMKA 1HHIB 3EHBC 3LEYH 4PJDF 4WW2F 1SYSB 3TA3B 3VXRA 4HMCA 3TIEB 4G8FA 5KOMC 4LCWB 1CI5A 2PNDA 1K5NB 3MGOA 3NPZB 1YMMA 2XY1A 3R0NA 1NKOA 4YBLB 2XWBB 2C3VA 5I75C 4ZYKB 1R3JB 1JHKH 1T66D 1R24B 1DBAH 1LNUB 5B22A 3RBGA 4OD1L 1KGCD 3VH8A 4HKJB 4TPRH 4I77H 1F90H 3MLWL 5KSAC 1OB1A 4OZ4A 2FZ3B 4PJGF 1HH6A 3GMNB 5CD5D 5AZEH 2VN7A 4R97B 2OJEB 3CDFA 4JO4H 3PWLB 4ODVL 1RJYB 3DURA 1IKNC 3TCLA 1VENA 4N8PA 1ZHLA 4G3YH 4TUOA 1QYGH 2X9YA 1J8HB 3BISA 4ODSL 3MRJB 1WLHA 4PY8J 2FYYA 4KI5E 4N0CD 1YNLL 4LEOB 4U1NB 1QFWH 4Z7UE 3G9VA 2FO1A 1S5IH 4NOBA 2I9TB 3S36H 2UVEA 2VDQL 3H6JA 2AXHA 1B2WL 5I1IL 1JYXA 1BD2A 3MREA 1XF4B 2QQQA 3EJYC 5C2BH 2P8PB 2X2YA 4KJPC 5IQ9B 1X9QA 2BVOB 4IM8A 4P59L 3O3BB 1KB5L 3QNXA 5E4EC 1RZKC 1RZGA 2YA1A 2PR4H 4M5ZL 1NGWB 4EN3B 4IOSD 5GGVH 4NQSA 2AEIT 2Y1VA 5HJ3A 5DJ8A 2W60A 3P11H 3U30C 4FABL 3VD7A 3SPVA 1WK0A 7CGTA 2VXVH 3KPNA 3NCMA 1CZ8L 2RR3A 4HUUB 1YEGH 3PWJA 1CLYH 3HC4L 3OR6A 3STZA 5IESL 3ZDXE 3HMXH 3DHJA 4N0YH 2D4DA 4ETYA 4CVZB 1Q72L 4U7MA 3C09C 5C0AA 1Z5LB 1KCSL 5FOBA 4OI9A 4JFXB 5DF0A 4NKOB 5I76B 1CYGA 1GGUA 2UY7A 2XIDA 1HSAB 3FJTA 4QXTA 5DGRA 1D9KB 4ODXB 4S10A 1YEJH 2X4PB 1RK1A 2GJ6E 3BO8B 4Y4FD 2V5SA 5F1IB 4QRQA 5IFHL 3CVHL 1T22A 4KPHL 4LSUH 2A6KB 2YPLB 3S5LB 1FPTH 2IQAA 3OTTA 4K94L 1JZ2A 4PRIE 1PJ9A 4RBPK 1RU9H 2B8OT 1UM4H 2DRUA 4MQXD 1WBYA 3W0WE 1YYLL 3P9MB 5AYQA 1D5IH 1DLHB 3VXMD 1DEEA 2CDEB 5DURB 3L3IB 3LKRA 1CLZL 5KTEL 1EEZA 2Y7QA 3T65A 1A6TA 1GH7A 4PRHE 3IJHA 5HVFB 2Q6WA 4Y5VB 2WLYA 4QHKI 1BJ8A 5SX5H 4NHUB 1T0MA 3IFPB 4D2NA 4Q6YA 2DQJL 5L88L 1NMAH 1TVBB 4WW2C 5KZCD 3RWIB 1BMGA 2Z4QA 3NA4A 1ROWA 5I74B 1WZKA 2ZPKH 3DO7B 4I3SL 1OSZB 3RUGF 4U3CA 2XQBH 5I17B 3IKCB 2XZAL 3Q1SH 1QHPA 3UTPE 3MOQA 5A2JH 3EZJB 1Q0XH 5HGHB 5BS0E 5BQ7B 5J9PA 3P4MB 3FB5A 3WDHA 4EDWH 4HK0B 1HCFX 1UH2A 1J12A 2J8HA 4LASH 1YEJL 5ESQA 3V6OA 5E95B 3WIFA 4RMSA 2X10A 5GISH 4ZDHB 3QJFA 4EQ3A 4HUVB 1U42A 4ZG1A 5JQHC 1EGJA 2E7CA 3VG0L 5H8DA 5CBEB 4WFHE 5KAQG 3F8UB 3GUTA 3DECA 3QAZC 4O2EB 4LSPL 4DK6A 1GIGH 3OZ9L 3QUYD 1AGBB 3K7UA 4LLDB 2DQTH 1M7DA 1Z9LA 4JKMA 4JEGB 4NNYB 4BH8B 3PJSA 2YZ1A 4F9LC 1C12A 4AMKL 3WO4B 1KJ3H 2VUYA 4Z7UB 4GUPB 3WXVH 2OJZL 1DQJA 3LRHA 4LIQH 4P23B 5DTFB 5HYSB 2AJXL 3C6LA 4OTXL 3JWDC 5IVZB 1RD6A 1FP5A 3GHEL 3SDDA 1FH5H 2E9BA 2Y06L 2EDHA 1MCPL 4I0PC 2O5ZL 1CFSB 2FBOJ 3TVMA 1WV7T 4P2RB 1V7NL 3BSZH 4OGYH 2LAAA 2Q86A 3L5WA 3WE6A 1AGEB 1A3QA 2ED8A 4CVZA 1WF5A 2HT4C 3AUVA 1BFTA 3OKNB 4LBEA 2NYYD 5EUKB 4K3DH 3VXPB 6FABL 3EDDA 5J56B 5AAMA 1S7SA 4PJ9B 1MLBA 5I19L 3MRKA 2OMNA 4MJ5B 2IGFH 3ARUA 1DQQA 3SQBA 5SWQA 4KZDH 1I7RB 4OIAA 4PJCB 3LH2H 1MVUA 2CK0H 1I1AB 4Y5VC 3IDNA 1A7QL 3UYRH 4LLWA 3Q6FB 2FX8H 2PW2B 3MRNB 1KPUA 3BT2H 3MV8E 5EG6C 5MENA 1JPFB 1NCCL 3Q5TA 5L8LB 2BSED 4P3CL 2WK2A 4DN4L 4ODXA 1G7LB 2E6PA 2H32A 4R97C 5GSVB 1JGUH 4K9EH 1H3PL 4DAGL 1RZFL 2Y07L 3FONB 3BPNB 4NO5B 4G6JL 4ORZC 1I9JH 4WW1A 1HHHA 5T1DH 2BRRH 1MFNA 4LP5A 1R0AH 3RVVD 2C1PA 4HX1B 5KSVA 3WXWL 5D6CA 4TN9A 3LY6A 5JW4R 4GG6B 4HWNA 3O3AB 2VIRB 3AREA 3U0TB 4HCRA 5J6HA 4K2UH 1G6RA 3QEQE 2JCCE 5GSRB 3ZYIA 3FB5B 1R3LB 3C6SB 2FJFA 2Q6WB 5ESQB 3O6KL 1YPZE 3QEGL 2PXYB 4N1CA 4DCQB 2KKQA 4KQ4H 2E7LA 5CIPH 2YEZB 3L3DA 3E2HB 1GIGL 4ESKA 5I1LB 1KLGB 4QRRB 3ROOB 2GK2A 1TQCC 3IYLW 1K4CA 5DJXB 1WSST 1KIRA 5I15H 1LDSA 2WIIB 2AKRB 3GHBH 1QBAA 4OD3H 4RISL 1C12B 1NC2A 1T6WA 1V7MH 4NZUL 4LSTL 4HIHA 3OKLA 4O2FB 3LHPH 2F58L 2EC8A 1QSFA 3RZWA 5CZXC 3QXDB 1CD1A 3EOBA 4DFIA 3TH4T 3B6SA 3FOLA 4S2SB 4GW5B 1K8DB 5HI5C 4JPIA 3E6HA 3U79A 3L7FB 4QXWA 3MJ7A 5A16B 1U3JA 2VZUA 4Q0XL 2KH2B 5IB4A 4ONHB 1FIGL 3BEVB 1G7PB 2APBA 3L3OB 5BOZG 3BHBA 3TLRA 5M94B 1O5DT 4P2OA 4UOJA 4IOIA 4NP4L 4PG9A 2PO6B 4XMKH 1OD9A 1A4KB 3IDIB 2XZCL 3VWJC 1BVLA 1EEYA 3HPLA 3MRRB 4LKCB 1NJ9A 1CK0L 4WI5A 2ED7A 3PP4H 3QT2A 4HWBH 2IANE 1UB5B 1QFWL 1FNGA 3LVEA 3B83A 1J8HE 1HN1A 3NMEA 3UPRB 3RVTD 3C5ZA 4JY4B 4NO0D 4Z7VA 4JN1L 1AGDA 5HHMB 3QFJA 1KJMB 2VLJB 5IMKB 1GGCH 3CMOL 1OAKH 2O5YH 5B39G 4XXDA 3QHFL 3QUKB 4FXGB 4RRPA 2GITA 3EYVA 4YFLF 2J6EH 3BH8B 5ANME 2E27H 1H3XA 1SJEA 3QCTH 3R1GH 2BOCA 5LXGH 3SBWC 3AROA 1BF2A 1N6UA 2G9HB 2FLBT 3QO0A 1GC1C 2EYSB 4P4KD 5KS9A 1ZXQA 1G7JA 4PS4H 1GZQA 2N7AA 4Z5RB 3FFCB 3W2DH 3TM6A 5GS0C 3MRQA 4NN5C 5FCSH 4DOHE 1HK6A 4RGOL 4KJQC 4NQXA 4L29B 4WO4B 1AI1L 4ZS7H 2UWEE 3P4NB 5IEHB 1IQDA 5D7IB 5DJAA 3QH3B 3D25A 1NC4D 1L9MA 4JFFB 1FNEB 4L5FH 4KROD 4CVXA 3D2UD 2HJFA 4JHWL 3CGTA 1TCRA 5MEQA 3UEZA 3DX9A 4EVNB 4QHNB 4MA7H 5DK0B 3MNWB 5K93A 1PLGL 2RCSH 3UJJH 3B9VA 1CN4A 2VDQH 3LEXB 4LLMB 5IMLB 3LS5L 4NKDA 3VWJD 2COQA 5DS8A 1KIRB 4M9OA 4RGOH 2B39A 2AI0L 3T0VA 3D9AH 1ND0B 4Y2OA 1H5BB 3QCUH 2NY7H 1EAPA 4WGWB 3GK8H 1NGZA 5KSBA 1K5NA 3CK0L 1J9CT 5B4MD 1UA6L 5E2TL 3F7VA 3FCTB 1VESA 4Z95H 2GY5A 3V2AR 4OIBA 5BOPA 3MLWH 4WI3A 1DCLA 1RHFA 3QIWD 2OSLA 4V1DB 1Y18B 3FO2B 2VLME 1YC7A 3GKWH 4OFYD 1GJIA 1T1XA 1IGYB 2NY6D 5KW9H 1EJOH 2W0PA 1EV2E 1QO3A 1Q8MA 4HH9B 3AY4C 5DYOA 3SCMD 2DLFL 4TVPD 8FABA 4N9OB 2RBLA 4YK4B 1EEUA 4LAQH 2HKFH 4Z0BH 4PR5B 1F2XK 3QEHB 1MFAH 4YEEA 1N6QH 1MY7A 1S7RA 1EVTC 4UIMA 5E9DB 3CFBA 3EDJA 2VXSH 4YAQA 5GQBA 1GSMA 1MCKA 3VD4A 4U1JA 4F7CB 4WI4A 3SOBH 1QRNA 4YHKH 1BQLH 2ZCHL 2AJVL 4BSVB 4S0SD 1H3PH 2DAVA 5I8OL 2OL3A 2F15A 5CSGA 2ICEB 4UT6L 3KXFE 4ZTOL 5HHQB 2Q8AH 2N1KA 5J1AB 3QWOB 3RY5A 5D1ZD 4P5MA 4QXGH 3ET9F 3DX7B 4Z7NE 5JHDA 4GAYB 4YNYB 4GXVL 1FYTD 1Y0LB 4BSWA 5IF0B 3RWHB 3HNVL 3BRDA 4PGCA 1CICD 3WO3B 3HI5L 2VABB 1ADQL 2ENYA 3JWOL 4PJHB 4NQDB 4HV8A 5FB8A 5GJSH 1MAML 4O4YL 3WL9A 3O4OB 1QVOA 1HQRA 2XZAH 3Q1SL 4Y19A 3TEUA 5D6DC 1SJEB 4K7PX 2JB5H 5D7IA 4U0RC 5DJAB 5IFAL 4NHCH 3LKSB 4WI2A 4L9LB 2HVJA 3QIBC 4LSDA 5MERA 2F54A 5D2LB 2FB4L 4JR9H 4X9HA 2EDKA 4OFDA 2ZKHL 3TPUA 4M62L 3SDXB 3MJ9A 1MREL 1A1NB 1A9EA 1FAIL 2NNAA 3FFCA 5I1AB 1A4JA 4R6UA 3REWA 4MD4A 5CD3B 4JPVH 4X5WB 3G5ZA 2N56A 1HZHL 4PRPD 4HBCH 2DKSA 1YEFH 2O61A 2R0KL 3EJJX 8CGTA 1F4AA 5EA0L 5LBSH 2IH3A 4MQSB 2I5YH 1CQYA 2DTML 1KLFA 1DQTA 1S7QB 4QXUH 4O51A 1XGPB 4D94A 3RIFK 5IQ7H 2VXUL 2UWEA 4KK6D 2WANA 4GOSA 5ISZA 5M95B 5T3XE 5CSZA 2W0LA 4GKSA 4LSQH 1D5MA 3RGHA 3HE6D 3GMOA 5KW9L 4YO0B 2FNBA 4PJEE 1TVHA 2DYPD 3FN0L 5EO0A 3G6JB 2HWZL 2A74B 2BERA 2G60H 4I3RL 2ESVD 4G7VH 4NWUL 4XAKE 5KS9E 1HINL 1OGTB 2XN9A 3G6AB 1KENL 3GBLA 3IDMB 3KPRD 3I50L 4XAWL 2IH1A 1MHPH 3CZFB 32C2B 4IS6B 4XP9H 3R06A 5JO5A 3ULVD 3VRIB 4J3WA 3C8KA 3RWFA 1E27B 4H0IA 4L4TD 2HWZH 1N64L 5CEXB 3SGKA 5F7WC 5CEYB 3C8HA 3MRPB 4KJPD 12E8L 5H2BB 1AO7E 4KUCD 4P2YA 2X7LA 2AXFB 4NO3B 1T1YA 4PJAE 4KTDL 2A83A 4LDEB 4JO1H 2ICWJ 5LKNA 1GGBL 1RK0B 2H9GB 3Q48A 4P5MB 4O02H 4KVCH 1C5DB 3VH8B 2EXWC 1LE5B 1A02N 2HJKA 2BMKB 2ESVE 2Y5EA 1K4CB 3H9SD 2MQ0A 5DJXA 2AEQL 2F5AH 1G1YA 3QXAA 3VWKA 3NA9L 5L9DH 5KVMC 3DRQA 4BFEA 1K8IA 3SE3A 3UZEA 4JFFE 3KLAA 2OYPA 4TTDD 1MWAL 2C7UA 3ELAT 1KENH 5BW7A 1T80A 4HZLB 4YHZH 2NW2B 4HS3A 3KPOA 4JANB 3OMZA 1A3LH 5E5MB 1PKQA 4G9FE 3QFDA 5HSFA 1TNMA 3DVGA 3S4SB 1OF2B 4H88H 1IM3A 1T5WB 5GJTH 3QQNA 2J8UF 2YUWA 4ONGH 4IMKA 1LILA 4GW5A 1AHWA 2O5XH 5HD8D 3RI5K 3FQUA 3U4EA 3NFPA 1CXIA 4M7LL 2YN3A 4ODHL 4HKXA 3T3PF 3LS4H 3ULUD 3KG5A 3PHOA 5HHPA 3W0WD 3DO3A 3TBYB 1BFSA 5IWLA 1XCTB 5JR1L 4ZNCD 3ILPB 3LB6C 4I48A 2B5IB 1M6OA 4OT1H 4OBRA 5JNYA 5FYJE 4HJJH 2BNQB 5TDNA 2GJZA 3EO0B 2V17H 5I74C 4XMKL 4RAUB 1LEGA 2KBGA <