4EUPG

The complex between tcr jkf6 and human class i mhc hla-a2 presenting the mart-1(27-35)(a27l) peptide
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
201
structure length
201
Chain Sequence
KEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMSIYSNGDKEDGRFTAQLNKASQYVSLLIRDAQPSDSATYLCAVSGGGADGLTFGKGTQVVVTPNIQNPDPAVYQLRDSKSADKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Structural description of how different MART-1 antigenic peptides influence JKF6 T cell receptor recognition
rcsb
source organism Homo sapiens
total genus 34
structure length 201
sequence length 201
chains with identical sequence I
ec nomenclature
pdb deposition date 2012-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4eupG01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4eupG02
4M1GH 5TE6H 4PJGB 1AGFA 5AYUL 4OFVA 5GGSA 2XTJC 4PJ5D 3VXQA 2VMFA 3OKLB 3HMXA 2HFGH 5CILH 5CSGA 4U6YA 2WM0A 4U1JB 5C0DA 1T1YB 5D1QC 2WP3O 1CLOH 1YNKH 3B5HA 5IBLD 3V2AR 1CE1H 3P0VL 4LOUD 2QEJA 5CEYA 1KIPA 5D9SB 3QEUB 2FX9H 5F6IC 1RZKC 5SX4I 4NKIH 1MY7A 3H9HA 1X5GA 1K6QL 4ZUVA 3W39B 3OKEA 2XY1A 5F6HJ 2AJZA 3CD4A 3SDCC 1A6UL 2JJVA 1Q9WA 2KDGA 2WQ8A 3D39A 3OQ3B 1ACYL 4L8SB 4HFUH 2CKBH 1SYSB 3GJFH 4NKQB 3WNNA 2GK2A 3H7LA 4QOKD 5DJYA 4BK4A 2IWGA 2R0ZH 1E4XI 1ZLSH 1GGTA 3V52L 3VXUD 5E4EB 4OZIE 1E27B 1U36A 3OMZA 4LRIC 4YHOH 4PRPB 5KVDH 2FO4A 5GXBB 3W5NA 3IRZA 5E2WH 5EU5B 1J86A 1U92B 4N5EC 2HJKB 5FGRA 2VYRE 5IMMB 4UT6H 5E00B 4UTBL 4IBLT 2DI7A 1NCNA 3MV8D 4ZXBB 1OP9A 3EO0A 3QHZH 1U8NB 1S78C 1N8ZB 1MH5B 3MRCA 3ARFC 4YR6B 5DC9B 5IB3A 3EDJA 3M17B 3KNBB 3MZGB 4XBGA 3T0ED 3UX9B 1S5HB 2X1XR 4WI3A 1ZLVK 3WE6B 1FNGB 1LEGA 3OAYK 4OZGA 4XGZA 5IOPA 2ADGB 3FB5A 5JZ7C 4ENEC 3U7YH 4CJ0A 4O02L 3OSKA 2YXFA 5C2BL 1UJ3C 4Y8AA 2XNAA 3RWFB 4XC3H 4JY6A 4LSUH 5D1XC 1T0NB 2F5AL 4K9EC 3GI8H 3GI9H 3D18A 3GMNB 4LHUB 4JM2B 2HTKD 4IHOA 5FYLD 2BNRA 4LCIL 4G42A 5T5FL 3QG6A 5KSUB 3IYLW 4YBLC 4ZMAT 4UOJA 1HHGB 2I60H 2DTSA 3O9WB 3FT2A 4QRUA 3ILQC 3KYOA 2XQBL 1U0QA 4JPIA 5D7JC 3PG2A 1KJ2L 4ONFL 3IKCB 1G7PB 4PGDB 2HT4C 1KXTB 4Y16C 5DD3H 1R3KB 3TNMB 4U33A 2SEBB 3U48A 3TWCH 2VIRA 5I1EL 1ACZA 3QH3B 4D0DB 2J12B 4Q6IC 3ZTJG 4YHYB 4GW5A 2FHFA 2O5YL 4JO1L 2FR4A 1G6VK 1JGEB 2BFVL 4G6JL 2OJZL 1MCHA 1D6VH 1S7XB 1J87A 3QULA 3N06B 1QA9B 3AAZA 4MXQC 3RDTB 4PLOB 3RGVB 3CSYB 1J5OH 2P48B 1JK8B 4ZTOH 2DBLL 2VDOH 3LD8B 1LE9B 4X7DC 1FL5B 4J4PD 3BW9A 4JR9H 5J1AA 2V2XA 1A02N 2R8SL 2WBJD 4QCIB 4YDIH 3P30L 3GGWA 5DJ6B 5CGTA 1WV7T 4XCCH 1SBSL 5E99L 3U7AA 5DVNA 3PWPD 1YDPB 4WFEE 3B3IB 2BVOB 4JG0H 4KPHH 4M6NL 43C9A 2CDFA 1H3TA 2AERT 2ZPKL 4UQ3B 4OLUH 4HULB 1C1EH 4MAUL 4WHTB 4OZFG 2OBGA 3B9KA 3GBMH 2XA8H 4GKOA 3RNQA 3SPVB 5GS0D 4PJBA 4GKZB 2J8UE 3MRLA 5L2JB 4HKJB 2IAMB 2HTLD 3FFDA 4MZ2A 1GZPB 4JJHA 4ZYKA 3M45A 3K8LA 1JNJA 4KJPC 3RVVD 4EKXA 3U30B 4MA8L 3CK0L 4LKCB 1ZMYA 4Z7QF 5TDPA 1FNSL 4L4TB 5EZLB 1I8LC 43CAB 3X12A 1NMBL 1NCCH 1L9NA 3WMSA 3GDBA 1Q94A 5IQ7H 1TQBB 3DX9A 3HZKA 4P99A 4OZ4A 4FQXA 3O3EA 4LASH 3IFNL 4HJGA 4ISVA 4Q0XH 3WN5B 2H32B 4RISH 2X4NA 1QBML 4LNVA 5HGBB 1M6OB 4PGCB 3R1GH 4AEHH 1EDQA 1OD7A 5J13B 2APBA 3WS6A 4PJ7F 2AJVL 4U6XB 3OAUH 3GSUB 2XTJB 4PJAB 1XGYH 5DYOA 3X14B 3MCLL 1INQB 1FZKB 5D1QB 1P7QA 3ECBB 1MIMH 3F6IA 3H3PL 4OCWL 1RHHB 1MCIA 3GSNA 3GRWL 4F7EB 5E5MA 3IDIB 4N5UA 4K3EH 2YMXL 3KPQA 4QO1A 1F3DJ 5F6IB 5FHAH 1SM3L 1U6AL 4OZHA 3FL7A 1G7MB 2NX5E 3DV6A 3WBDA 2CKBA 3GJFA 5JLZB 2HWZL 3SDCB 5GRXG 4M5ZH 4ZDHA 4POZC 2GTWA 4ODVH 1OVZA 1NSNL 3T2NH 4WUUE 1II4E 1MSPA 3L3IA 2JB5H 3TBSB 4O2FA 5C6TL 2A6KA 3P9LA 3CCHB 3GJFK 1PW3A 4IMLA 2FDBP 32C2A 4JDZA 5EN2A 3CJJA 5IV2B 3IXTB 3CU1A 2ZSVA 3RIFK 3GIVB 3HMWL 4CVXB 4P57A 4WU7B 4OGYH 3HUJF 1IAKB 2AEQH 1DUYA 5DEZA 3TBVA 1YNTB 1FN4A 2QLVB 3TPUB 4RA0C 3CIQA 3RWJA 3WIHL 2B8OT 4XPTL 1JPFA 5IB1B 5IQ9B 1IQWH 4I0CC 1XR9A 1MWAH 2RFXB 1FIEA 3ARFB 4G3YH 4OD1H 3G5ZA 4HCRL 4NQUA 3UBXI 2CIKB 2V7HB 5DD6A 4MAYA 5F7EH 3S8WA 2W0KA 3EJZC 2HJFA 2CLRA 3IDGA 4MCZB 5ACLA 4DKFH 2EECA 5ESVB 1KCSH 4Z7VA 4X8JB 3TBTA 1MUJB 1UJ3B 1OLZA 5D1XB 3TT3L 5MHSE 4X7TB 2A38A 4X6DB 4S1QL 3V6OC 3ULSB 3O45A 3VFRB 4Y0GA 3V4VL 5ICYB 4ODTL 4MMXC 1HKLL 1EXUA 4EN3B 4DTGH 4FQPA 5CCKH 3VWKD 2BNRD 1HILA 2D7TL 4NFDA 5D7JB 5LXGL 4TVPD 1ZT4A 2R0WH 1LDPL 2XWBA 4KMTL 2ADFH 4YUEL 4Y16B 5DXWA 4WW1B 5FYLL 1D5IH 3CFJA 1VENA 5GGRY 3OWEA 3L3KB 1OB1B 1T2JA 1A3RH 5I8EB 2CXGA 2HG5A 2HVJA 1P9MA 3LN5B 2F54A 4Q6IB 4X6BB 1QSFE 2YK1L 4G8EB 3HZYB 2FGZA 4M6AA 4OCSH 5DA4A 3VD3A 1A6TB 4HD9A 3QDJD 3P11L 1AO7E 1RUQH 5I1AA 1QRKA 5GSRB 2I25N 2Q6WB 2QSTA 1T20B 2PTVA 1IGJA 1HNFA 4LAQL 4NKOB 4QY8B 1HIMH 1AQKL 3CFKA 4LLAA 5LGJA 3TZVD 1CGVA 4UU9B 1AC0A 5L88H 3EOTH 2APVA 1KFAL 5FO9A 1AD9B 1SBBA 1U95B 2VL4A 1P84K 4P23A 3L3GA 1E6OH 4WJ5B 5DC0A 5EH1A 4A6YB 2NW3A 3RNKB 4DUXA 1DQLL 1DLHB 4IM8A 2VZSA 1NFKA 2P5WE 1X5XA 5CD3A 3DETC 1LO4L 1H0DA 3M1BB 3N85L 1UM6H 3DSNA 3NA4A 2DJ4A 4Z77A 2IG2L 1I7TB 4LPXA 4B5EA 1B4JH 1IVLA 1JGDB 2WWMD 3BWAB 3RWDA 2PO6D 4H0GA 1ETZB 3RI5K 2ATKB 1R3IH 4ZNEA 1A1NB 4CN4A 4WNQB 1GGBL 1HN1A 3PGCB 3D3VA 2P4AB 2AK1H 2YPLA 1DE4A 1QLEH 1YEHH 5ICZB 5IFAL 3MV11 3QQ4B 2X41A 1FH5L 4TUJB 3NH7H 5GS0L 1CGSL 4BSWA 1UB6A 4PJIB 4Y4HA 5H2BB 1U91A 4O5LL 4X80L 1PG7L 2Y36H 4Y19A 4LIQL 4X6FA 5D2NE 5L2KB 1NGZA 2NY5C 2VZVA 1EFQA 3DI2B 5HSFA 3B43A 3PWNA 3WLBB 2DDQH 2MPAL 2C5DC 4GFTB 2XFXA 4GKSB 5L9DH 1HYSD 1I9JL 2D03H 2IALA 3MA7A 1JTTA 3WHXA 3LEVH 3STZA 3RUGE 5FUOH 5D6DC 5KJRH 1MCSA 4F8QA 3BESR 3CLEL 1UZ8A 5KSVA 5T3ZE 1Q1JL 3BHBB 5CBAB 4NWTL 4JN2A 4AM0B 2A9ML 2APFA 1JGVH 4GXUM 1KPVB 4PRIB 1OGAE 2LVEA 3U0WH 2XACC 3ZE1E 1P7QD 1J88A 1JI2A 4NQEA 2WLZA 4QTIH 1KBGH 1XEDA 4GAJL 4S1RH 2CIIB 4GXVL 1EX0A 1JYWA 2VLKB 3BSZH 4D3CL 4AK1A 5F1NA 1FC2D 2VQUA 4R7DA 5FIEA 3FZUC 2FECI 5EOCH 1CFVL 4LSSL 2ZUSA 4BZ2L 4E42A 4RGNE 1R3HB 3HMXL 3BPOC 2R2BB 5F70A 3IF1A 3N1MC 3BIAX 4N0CC 5TF1H 3HZVA 5B38G 5JQ6H 1LEKB 1BLNA 1IGCH 3N1GC 1MOEA 1EHLH 2FD6L 4QRPE 1WWWX 1YECL 3GSVA 1JHLL 4TULH 5DI8A 3RPIB 3VCLB 2VB5A 5IT2H 1JYXA 3I6GB 4MA7L 5J3HC 3OGOE 4AEEA 3V6ZA 3PDOA 4JCMA 2ID5A 4HMEA 4P9HC 1SQ2N 1WICA 4YHPA 5DEGA 1HHJB 3HS0B 5C1MB 2BP3A 1VEPA 2R2CA 1RJYB 4JDTH 1CBVH 3TBWA 1I1AA 2FB4H 1QFHA 1KEGH 2HRPH 2E7BA 3W0WA 4ZFGL 1MJ7L 4FQIL 3HNVL 4HJ0D 2DQHH 3HI6H 2V17H 2ZCLL 3R4DA 4H20H 4MAYD 5JXAH 5DFWH 1U8IB 3C9NA 1QFWL 3SDDA 2AV1A 1SVCP 1YMHB 4XNXH 1OM3H 2KL6A 3A6CH 3X3GH 4ETQA 3QDMB 4LFHG 4P5TA 3TN0C 4DW2L 1GC1L 1S3KL 1YQ2A 1X5KA 3FRUA 1PY4A 4C58B 1VFAA 4NHUB 1F4YH 4HGMA 5HHOA 4QHLA 1E4JA 3ZYIA 5HVFB 3RHWF 1RUPL 5GGVY 4CVUA 4NDMA 1R5IB 2CDGA 1RK0A 2P8LB 2Q8BH 4JO2L 1SYVA 3TJEL 2JK5B 1XGUB 1YQVL 4URTB 3ZSSA 4QT5A 1A6ZA 2DKMA 1FC1A 3ARZA 3MYJB 3QEQA 1L4IA 5CS7A 1BP3B 1KEMH 1ZVSA 2VLRA 4PRNB 4Z7WA 3EYOB 4R8WL 2FX8L 3CVIL 4DKEH 3DNKA 1BOGA 4L4VA 4HDIA 4APQC 3F7PC 3QG7L 3IFOA 1R5VA 1I85C 1NBVL 5EC2A 4OGXL 1LP9B 1X5JA 1NC2B 1VGKA 2X4UA 3O8XC 2VE6A 4Z95H 4GG6A 3VFNB 1FLRL 3ZKQD 4DN4H 4OB5H 3RVTD 4TVPL 2XZQH 2NY4D 4JO3H 2F54D 5C08B 1TCMA 5JOFB 4PJFA 5HDOA 4LLDB 4UIMB 2R1XA 5FECA 4OI7A 5HHPA 5A2FA 5DHYB 3QQ3A 4DWHA 1CFNB 3WIFA 4DK3A 3ESUF 4FN0A 4KGLA 3ESVF 3L6FA 5IF0B 3VW3L 4TSAL 4CVWA 1DQTA 5SWQB 5DEFB 4ODHL 1K4CB 3OB0H 2X4SA 3IFPA 4E9LA 3OTTA 2N7AA 5IBTH 1MJJB 5JHLH 3FQTB 4FXGA 4KZDH 4G6AD 5D7IB 3VFPA 1G0YR 4P23D 5LVEA 1ZGLP 1PZ5B 4L3EA 3MJ9A 1RJCA 4RAUA 2XWJA 2ICES 3MRPA 1IQDB 1IEHA 2DQDL 1G0XA 5FA3B 1J10A 5IW1A 1B90A 3TVMD 5C0GA 3EYQC 3QDGB 2I5YL 3RWEB 1AGBA 2GTZB 1J05A 3TV3H 2R1YA 3TGXA 1EK3A 1IGML 4JVPA 2DJSA 1S9YB 5GZNC 1YEJH 2VL5A 3MV7A 3QUYA 5HHMD 2AXGB 5JQHC 3QFJD 2ZUQC 2NY2B 4MNGA 3D3VD 4R7NB 5SX4H 1NEZA 2X9YA 4MSWB 1D9KC 3QFDB 4NFBA 4OTXH 3MLTA 3MRMB 1T3FB 2AVGA 1JIBA 2DI9A 5E6IC 4Y4HD 3BH8B 5EBGA 3F8UB 4O9HL 1FVCA 1UVQB 3MFGB 3T8XA 3X11B 3HFML 5EPMB 1NBYA 4Z0XA 4MNHA 1F13A 5GISH 1MHEB 4YFEA 3DXAB 1A7OL 5JXED 3QA3A 1UCBL 1OAUL 1M7XA 3GMMA 4NCC1 5CAYB 4M1GL 5EO1A 5TE6L 4WI9A 4C83A 1BBJB 1CFBA 1T4KB 3V7AG 2R4RH 1PLGH 2HFGL 4RFOH 4NQED 3CFBA 1TETH 1ERNA 3ZHLA 3FMGH 3HAEH 1CLOL 1OCWH 3ZDYF 1YNKL 3DRTB 3BPOB 3B5TA 2CPCA 1ZS8A 4ZFZB 1T1ZB 4N0UE 2W65B 2DQFA 3IU3A 2IADB 4U3CA 1GXEA 3BH9B 2C4XA 2FX9L 3GSNL 1YEIH 4DGYH 3L1OH 1H3UA 4NKIL 3WUZA 1H3PH 3JUZA 5EDXA 2F53B 2UZIH 4CNIA 1FPTL 3E0GA 1B0RA 4K55A 1OAXH 1Z5LA 3MLYH 4KKCC 4HX1A 4G5ZL 2O5ZH 5JDSB 4HFUL 2CKBL 2DQJH 3S37H 2NY6D 3O3AB 5F9WB 5D1ZD 1ZLSL 4IRJA 5J6HA 3E1F1 3TO4D 4LFHD 2C3VA 1QRNE 4U1HA 2EXYD 4F37K 4YHOL 3QNYA 5KVDL 4Y4FA 2APWA 3BN9C 2A6IA 3WFHA 5CIPH 5I30H 4PRDA 5E7FA 1M05A 4FQQB 3BQUA 1FL6B 3GK8H 4UT6L 4F57H 4JANB 3T0BA 3W0WD 1Z9MA 4WWKC 3EHBC 3QHZL 4Y5YA 3TN0B 5H35B 5AUMB 1JF6A 5EU6E 5C0AE 2NR6C 3SDDD 2E7LA 5F9OL 2FCBA 1QPXA 2AXHA 1BM3H 3J8F7 1JV5A 5AEAA 4P5TD 1Q9LA 1AGEB 3VI4F 1F2QA 2NW2A 4PJDA 1U8JB 2GJ6B 2X7LB 1MY5A 4HWZA 3BZ4B 5HHOD 5IBUG 3VI3F 4FFWC 5FF6A 4G7VH 3KPSB 3O2DH 4XC3L 4EOWH 2JIXA 1EUUA 2UYLA 3CAFA 4LSUL 1YEDA 4K8RH 4GRLB 1JZ2A 2AEWA 3GSQB 4RGMB 3GI8L 4UV7H 4XCEB 4XPAH 1MAMH 4APQB 1U8QA 2YS4A 3QEQD 1BQHG 4F3FB 1QFOA 2VLRD 3FFCB 3O8XB 2A83A 2AJSH 4PV8B 3A6OA 5CGYC 2VUYA 1N0XH 4L4VD 2QQKH 4KJQC 4UBDC 1HI6A 2NYYD 1MLBA 5ANMA 3QUXA 3HI1B 4KH2A 4LEOA 1DQJB 4TYUA 1OP5H 1CTNA 3WNLA 1F4AA 1OF2B 2ITDA 3KG5A 2DM7A 3C5SB 5DD3L 3VFWA 2VISA 1A9BA 2HKFH 4U7SA 3TWCL 2GAZB 1IEAB 4HZAA 1WBZA 1X7QB 4YXLH 3ALPA 1J0YA 2Q76B 4N9GB 3IFLH 1RJZA 1L0QA 1MJUL 4AENB 4ZS6D 4ELMF 4MNQE 4X5XA 5GSVB 4ODWA 5C70A 4NN7C 5GRWA 1T03L 2VQ1B 3B6SA 1JNNH 4EDXB 3OB0K 4ZTOL 1CLCA 2D31A 1OHQA 2VDOL 3S4SB 1KNOB 3ALWA 4G80A 3SCMA 1CD1A 2FL5A 3CFCH 4JR9L 5BXFB 3DVFA 2F74B 1H15A 3G9AB 4UNVA 2MQCA 2NTFB 2GITB 3VFSB 3SDXE 4YDIL 4UTAL 1XCTB 4HS6A 4WI5A 5FGBC 3T3PE 5EZJA 1QKZH 1RZ8B 2PYEA 4XCCL 3F7YB 3OKNA 3LKNA 4P4KA 4KPHL 4JG0L 3C2AH 4H25B 5IMOB 4P2OA 2ZUQB 4S10A 1QZ1A 4W68A 4YPGA 3EJJX 1KPUA 2OR8A 1C1EL 3QXWA 3EOAA 1FAKT 4WI4A 4R4ND 3TBYA 2XA8L 2YR3A 2R29H 2XZCH 1GPOH 3QUYD 1FCCA 4G43A 1ZT7B 1UADC 4ZG1A 1D9KB 2G5BA 3UP1A 1D7FA 5HI5C 2M26A 1NGQH 5E6IB 3QUKA 3V6FB 4KXZI 4OIBA 2HKHH 3ULVH 1Y6NR 4Y5VA 4PB9H 1AGCA 3ZDZF 1R24A 1AXTH 1MI5E 4CAGA 3UTSE 3NAAH 1NCCL 1MVUB 2GJZA 4PJEB 3BPLC 5IQ7L 1BEYH 1X6NA 4WO4A 4U7MA 4P2QE 3FQXB 3VXMA 5IB2A 1RD6A 4R2GD 4LASL 4XXCA 3EDKA 4Q0XL 4NQSA 4YHKH 4RISL 1J11A 3R1GL 4AEHL 4NQXB 3BEWA 5BS0E 4E41B 2B7DT 3OAUL 3HAEA 1FFPA 3FB8A 4CDHA 1XGYL 3MROB 1JF1B 1X3DA 3QNZB 1NLDH 2XKNB 5EG6C 1U8MB 4HUKB 1CWVA 1PJ9A 5FUZH 3V5KB 5DJDA 4HPOH 1GYAA 5TDNA 1JNHA 1Z9OA 3CMOL 2BHZA 4K3EL 5LG1A 3RVWC 4NQCE 5FDWB 3G6JE 4MQXC 5FHAL 5B21A 2DBJA 5L0QC 2J6EA 3IDMA 4JFFE 2G75B 2Q7YB 4LPUA 5E1AB 2H26B 4GT7A 1ZSDA 4ORGA 4N90D 4BKLA 1YMMB 4LNRB 1L0XA 4CMHC 5DRWB 3F58H 2EH8H 4NKMB 4ODVL 3T2NL 3R0NA 5IB4B 4IJ3C 3MNZB 2JB5L 4JFEB 4JGJA 3H42H 3ROOA 5IJKA 4RMSA 4LLWB 2EZ0C 4Y2OA 3I84A 4ONOA 5CIPA 1DUZA 2VITB 1X5IA 3VFTA 2VLJE 1IGYA 4NZTH 1QBLH 4I0PA 4OGYL 2AEQL 1LD9A 4AG4H 5IHUH 4HIXH 3R06A 4B0MM 1JGLH 5DT1L 4GSDH 1YUHA 4XNQA 1D5MA 1UXSA 4Y4FD 1HXMA 1IQWL 2YPKA 5C0IA 3BQUD 1H5BA 2YSSA 1MWAL 2OR9H 1KB5A 4G3YL 1R0AH 4OD1L 3FQRB 5F7MC 3WLWC 1FCGA 5GRVK 2GK0A 2MQ0A 1JYVA 3G6DH 4KK8D 4U0RB 1URLA 4PRAB 5IVXB 3GNMH 5KAQG 3JWDH 1JHTB 3TP4A 4DKFL 3PIQA 4V1DE 1P4BL 3MXWH 1KCSL 4HKXB 4PJ9A 3C8KA 1MLCA 1FE8H 1BBDH 2X4QA 35C8H 2ZG1A 1GJIA 4OAWA 1YJDC 5C3TA 4WI2A 1WFTA 2QKIB 1A9EA 4JZOB 4XVUC 2DF3A 2EEBA 2NY3D 9CGTA 4FQ2H 5EO9A 2JJWA 3ES6B 1SJEB 5DFVD 4JRYB 2JIXD 2HH0L 2KKQA 3TF7C 3U1SH 3QISA 1C5CH 2YWZA 3CSPA 4DTGL 1GOFA 2EDRA 4L8DB 4WDIA 3WXVL 2WBKA 2LTQC 1M71A 2BHYA 4KTDH 4ONHB 4WENB 5EU4B 2R0WL 3WD5H 4NO5A 2ADFL 3BEVB 2C7UB 4G8FB 4BQBA 3LMJH 1D5IL 4E5XA 2DIAA 5DA0B 1CDBA 1OP5K 3SKOA 3QUXD 1A3RL 2XN9E 3TIEA 1FYTD 3MRRA 5EOCJ 2PF6A 3DECA 5E95B 5IB5B 5KW9H 4OCSL 5E8OA 4NSKB 1IZKA 4HHAA 3IXAA 1B0WA 5C0EB 2WLYA 3WNOA 4NO0B 3Q5YA 1RUQL 1KB9K 2XG4A 2E27H 2BNQB 3HZMB 4NN7B 1QPPA 5IHBA 4PLJC 5I8CA 1HH9A 3KPNA 2BSSB 1DBAH 3U36A 5ID0A 3BIKA 4FRWA 5HGAA 4OCXH 3W2DH 1YEKH 4XB7A 3BMVA 4PGZA 1HIML 3MRDB 3HC0A 1JVKA 3LEYH 4RRPA 2XI9A 3BP7B 4PTTB 5L88L 1OAZH 3VD9A 3LQZA 1CF8H 1S5IL 5KS9A 4KZEL 2VRAA 4QWWC 3UTZA 3ARDC 5I0DA 2OXGA 1E6OL 1M7IA 4N8CH 4DN3L 3SCMD 4M00A 3JZ7A 1XR8A 1OTUC 3ULUF 2ZJSH 3KYNA 2OL3A 5EBMA 2BNUA 3B2VH 2PYED 3O4LB 1MCEA 1UT9A 4FFVC 1KJVB 5IVZB 2A6DB 3MRJA 4QYOB 4JFDD 5E94A 5I19H 1WITA 1HXYB 3MJ9L 3O0RH 4P2OD 4RRPG 4PYGA 5DMGC 5F88A 1IL1A 1KPRA 3JBG7 2AK1L 4M8VA 4Z0BH 1XF3B 5F71A 2M8XA 1YEHL 3HC4H 4MXWL 4W4NA 2IH3A 3NH7L 5E9DB 5GIRB 4PV9B 2K1MA 5D6CA 1VFOA 4PLKD 1ZA3B 1D5BB 4YE4H 4U6HB 1REIA 2MTPA 3KPMB 1FDLH 4BELD 2NNAB 3BPLB 3TA3A 5DK0A 1QVOA 5EUOF 5F21B 4I3GA 5C0BA 2YD7A 5IJVA 1MAJA 1YN6A 3DVGB 3PHOB 2VLLB 4BH7B 1RJLA 2VAAA 5D7LA 2H2PC 2DDQL 3UBXA 2Y07H 4J3UA 4WO4D 5INDA 3VXMD 5HHXH 4L8CB 2FJFB 4ZOCA 3P40A 5L9DL 2D03L 4PJHA 3TFKD 4NOFA 3BD5A 3LEVL 1BD2E 4JAMB 5FUOL 3BZDA 5KJRL 2Y7QA 1S7TB 1FZMB 4HXBH 2IQAB 4G8IA 4JZJC 4DVRH 3R8QA 3QUMA 4FOMA 4HIHA 4ZUUB 2VN4A 5ESQB 3ORJA 4LSRL 1JGVL 5D72H 2CLZA 3L5IA 3U0WL 5BW7A 5CJXC 5I1DB 1OT2A 3RVXC 1CZ8H 3INUH 5L0QB 3WSQH 1RY7B 1HEZB 3BRGC 4QTIL 2FLRT 3W9DB 1KBGL 4LCCA 2Z35A 4S1RL 2H32H 3HN3A 4ZSOB 3VH8G 4PJGA 2ZNXA 3UBXG 4CMHB 3BSZL 3HB3C 1WWCA 2VERN 3OKLA 1G9NC 4U1JA 5EOCL 4EUPB 4L29B 5KOMC 2ZUTA 1S7RA 5GRUH 5TF1L 2UWEF 2GSIB 1GGCH 3VDCA 1KELH 3BMWA 3WJLA 1IGCL 5D9SA 3QEUA 3CLFH 4ONGH 1EHLL 2X4PB 3O2VH 5BMFL 4TULL 3HE7C 3Q6FB 3MOAH 3VG9C 4M61B 4JFHD 4FMFA 5IT2L 5F7HA 2JF1A 3W39A 2Y9RT 2XT1B 1RZKH 2HFTA 1I3GH 1RU9H 4JQIH 4L8SA 4CMMB 1SYSA 2V2TB 3QR2A 2YEZB 4I0PD 2HT2C 1HZHH 2NY7H 4LCWB 2FB4L 5H8DA 1KEGL 2EDEA 1BF8A 2HRPL 5SWSE 3D0VB 2NXZC 2ZCHH 1LO3H 3GIZH 1K4DB 4PRPA 1IM9B 2DQHL 3HI6L 2V17L 4UV4H 5EU5A 3NMEA 4OI9A 3D69B 1U92A 2HJKA 4H20L 5IMMA 1OAQH 5E00A 3MJ8B 1OM3L 1UACH 3X3GL 3FCTB 1ZOXA 1UKSA 1XCQB 4RQQB 4LMQE 1JN6B 4ZXBA 1U8NA 4YHNB 3MACL 1N8ZA 1FVDB 5I76B 1PKQA 5IEKB 1MH5A 4PJ9D 4K8RD 4YR6A 3MGOB 3M17A 4G6KH 3KNBA 2CR3A 4R4BB 1PX4A 1S5HA 4LCUB 4S0TD 3WE6A 1FNGA 3BXNA 1X4XA 3QRGH 3O6LH 2ADGA 1GHFH 2P46B 3HG1E 2LTQB 3OHXB 1KEML 4I8DA 2BXYA 3RWFA 1CGYA 1YPZE 2CRZA 4G8GB 4DKEL 1T0NA 2BVPB 4QRRE 5D2LF 5JNYB 3RRQA 3V0WH 2IEPA 2RHEA 4GUPB 4XWGH 1WT5C 3IJYB 3ARUA 3GMNA 4LHUA 4JM2A 4K9EH 4Z95L 1IAOB 4WHYH 6CGTA 2EICA 5AZ2L 2PCPB 3I50H 3ZKSD 4DN4L 3BAEH 2AAVA 1HHGA 4OB5L 2XZQL 1WUNT 2CUIA 4JO3L 1RMFH 3O9WA 2Q1EA 4KKAD 3PWJB 4XHJC 1MCDA 3VD5A 4DQOL 3UTTE 1JZ5A 4J3XA 3IKCA 1G7PA 4PGDA 3UCRA 4JVWA 5FO8B 1R3KA 2APXA 1KCUL 3TNMA 2SEBA 1WBYA 3MLWH 5I1CH 4MS8C 3RKPA 3ARXA 3QH3A 4D0DA 1RK1B 4KI5D 3B9KC 3ARDB 1VB9A 2FZ3B 4O2CB 1WZKA 1DBKL 1JGEA 2BCKB 4PJ5E 5D71H 5ILTL 3QZWB 2B1HH 5HDBF 1S7XA 5IBTL 5JHLL 1QA9A 3LKRB 4KZDL 4HC1H 5HDLA 3RGVA 1XGPB 1KCRL 1QSEB 1TQCC 1U58B 5ACZB 1JK8A 3U7WH 4BA8A 1NCWH 3OL2A 4XAWH 5JO5A 1LE9A 2GEEA 2BERA 1FL5A 4Z7UF 2VDML 5IR1A 2CO6B 3NABH 4PJ7B 4PJ8D 4YZFF 3TV3L 4QCIA 3VRJB 4FQXC 5MEOB 3IETB 5DJ6A 3VFUB 1GZQB 5F1SA 1YEJL 3FQWB 3ULVD 1YDPA 3MNWB 2ENYA 3B3IA 3DYOA 4A6YH 2BVOA 3VXUE 1LMKA 3PWLB 5MEPB 4QLRA 1AGFB 1KTKE 4WHTA 1Y0LB 5DK3A 3DRQB 3SPVA 4JGUA 2WSKA 3D0LB 1F90H 4GKZA 4YJZL 4OTXL 5L2JA 2IAMA 4C4KT 4JKMA 4JKPH 5DC4B 1GZPA 1MHHB 2AEPL 1TZHA 1V7MH 2JB6B 2D7MA 1SY6A 3MV8E 3LSOB 2A74B 5C0BD 3BZEB 1E4XL 2I26N 1QTYT 4LKCA 4XP4H 4L4TA 2WBWB 5EZLA 3PGDB 2KZ1B 3OKEB 3T0EE 1ZANL 4QXGH 3GO1H 5EBWB 5GISL 3E6FB 3LRSA 4JZJB 3V5HB 3D39B 25C8H 4CADB 5HVWA 3H9SA 4JRXA 5I8OH 3HUJB 3JTSB 5K59F 2DQCH 4KK5C 3LHPH 2H32A 1NGWA 4NZRH 2PN5A 2IJ0C 5FM8A 5HGBA 1KB9J 4PGCA 4YIQB 3V8OA 1KIRB 2D9CA 2NY0C 4U6XA 3GSUA 2BHUA 2LFGA 2R4RL 1PLGL 4RFOL 4JPVH 5TQ2H 4PJAA 5FYLE 3X14A 3FMGL 4UMGA 1FZKA 5D1QA 3ZDXF 2NMSA 3ECBA 5DD1H 1XF5B 5TE4H 4HUWB 1RHHA 3FHQA 3I3DA 4M93C 4F7EA 4EI5C 2J2ZA 3IDIA 4ZPVB 1ZAGA 3AROA 4LBEB 1OP3H 4CKVX 1YEIL 4DGYL 3L1OL 1H3PL 4PJCF 3HE7B 1DN0B 5T5NG 2UZIL 3KPTA 4WFGD 3RIAK 3PABB 1G7MA 4YXKH 4TQEH 1F6LL 1OAXL 1ZA6B 3SDCA 5JLZA 4O58H 4OF3A 2VDLH 3MLYL 4XGZB 5IOPB 4JREC 5BRZB 2O5ZL 2DQJL 3S37L 5TH2B 1NAMB 1A7BA 1CDHA 1LO0H 4FQCH 1UM4L 3CCHA 2YRPA 4ZOEA 2NXZB 1H9VA 4JDVA 3SE9H 4LRIA 3IXTA 3RTQC 3L9RB 5I30L 3GIVA 5C0CE 1VFBB 4CVXA 4KVNH 4AEIH 4G42B 3CFDB 3MOBH 1NFDA 1IAKA 4F57L 1NKRA 5E5UB 1V3MA 1YNTA 3TPUA 1HSAB 1FAIH 1EIBA 1UQSB 2R69H 5IVOA 4QRUB 5GRVL 5IROA 5IB1A 5CZXC 4OFKA 5C9KA 2RFXA 1JRHI 3ZE0F 1J1XH 2V7HA 1T0MA 3UTQB 1BM3L 1KB5L 1MCOH 3GBLA 4ZXBD 1WFOA 3PWPE 1NUDA 1VPOH 4X6CE 1T7WA 5FM5O 5H37H 4TNWK 1P9MC 2D3VA 4MCZA 3MLZH 3S88L 1AD0B 5ESVA 3TNNB 3CDGA 5CKAA 1MUJA 4G7VL 5GPRA 4Z7OF 1UJ3A 1RZFH 1EAPB 1TLKA 1YEGH 1HHIB 5D1XA 5EWIH 1KIUA 1S9WB 4UV7L 5FM4A 4XPAL 4GMTH 4X7TA 4X6DA 5SV3A 3DX7A 3ULSA 4H1LB 3K81A 3KPPB 4LIQE 3VFRA 4KV5E 4R26H 5TJWK 1A6VH 1JP5A 4NZUH 4Y1AE 1YZZA 4U4BA 5ICYA 1BQLH 2AJSL 2ESVB 5JIHA 1CFTB 3DO3A 1N0XL 3E6HB 2OYPA 1AI1H 1CXLA 3I3EA 3LN4B 4EN3A 2DMCA 3BD3A 4LHUD 2VXSH 3QIBA 4XBEH 3REVB 5D7JA 5F89B 4LHQB 5SWZE 1OTSC 4HEPG 5MENA 2HKFL 1HINH 4Y16A 4WW1A 3O9WD 3L3KA 4BM7A 1OB1A 4M6MH 43C9B 1INDH 4KXZH 4RFEB 5I8EA 4QXUL 4YXLL 1KOAA 4Q6IA 4X6BA 3B9KB 4G8EA 3IFLL 1CXIA 3HZYA 4F58L 4PJBB 2Y6SC 2CXKA 1TJIH 1A6TA 2P7TB 4GW4B 2NZ9C 5ISZE 4HC1A 4NHCH 1LK2B 2FGWL 1FFQA 4LGRB 1JNNL 2BOBB 2DQEH 4RZCB 1T20A 1TQCB 4OLYH 5HI4C 1A5FH 4NKOA 4QY8A 4JFZH 1BF2A 4GRWF 3CFCL 3RDTD 4K7PH 2P43B 4UU9A 3RGVD 1J9CT 3RJQB 5CJOH 4OZ4B 4FQXB 3O3EB 2IQ9H 1AD9A 1U95A 4WJ5A 3SOBL 3RNKA 1RVFH 4OJFH 1DLHA 2X4NB 5IMKB 1EEYA 1TNMA 3C2AL 2DS4A 4I2XE 5DQJB 3AMKA 1LK3H 3AS3A 1P4LA 3M1BA 2OL3L 2R29L 1I7TA 4YBQC 2XZCL 1GPOL 2R39A 3BWAA 1JGDA 1YNLH 3DJ9A 1ETZA 3TJHC 2ATKA 4Z8FL 1NGQL 1QNZH 1A1NA 3ULVL 4WNQA 2HKHL 3PGCA 3FO9A 4ODXB 1FNHA 4PB9L 1BZQK 2Z92B 3LH2H 5ICZA 3BUYB 3QQ4A 4XP6H 3EJYC 4G7YH 1G84A 1AXTL 1WSST 2IAMD 3K4DA 2VR4A 5HD8C 2HLAB 4LP4A 4TUJA 4OZHB 1I8LA 2FIKA 3NAAL 2G9HA 3PV6B 4PJIA 1DQDH 5MP6H 5KSBF 5H2BA 1OTTD 5C07A 5L2KA 4L4TD 4O2FB 1I1FB 2UVFA 4YHKL 3FO2B 4UB0H 3P9LB 3F65A 4K3JH 1IFHH 3C87A 3WLBA 5BQ7B 2NY5H 1VDGA 4W6WB 2GIYA 3C60B 3OR6A 4OZGE 2ZSVB 4U1GB 2NY0B 4LVNC 3BO8A 4GKSA 4YQXH 4Z6AT 1FN4B 2V7NB 5JIIA 2Q7NA 3RWJB 3D85B 5BZDB 3DVNB 3BHBA 5FUZL 5CBAA 1JPFB 4HPOL 3NZ8A 1FFOB 1RURH 4M93B 2XTJD 4EI5B 3QUML 5I16B 1KPVA 2BNRE 2K7PA 4PRIA 4M4RA 5D1QD 1I1AC 1V05A 1NDMA 1WAAA 4TVPE 5DR5H 3BT2H 2MKWA 4D0BB 4FP8H 3J7HA 4OFIA 1OP3K 1IEBA 2CIIA 1AY1H 2EH8L 3F58L 4JREB 2VLKA 1B4RA 1UZ6F 2R23B 1UKQA 3NCJH 3OF6D 5D4QA 2KBGA 3LPFA 4QNPF 3DMMC 3H42L 4HK3J 5JIKA 3SGEI 3ARRA 3W11C 3KPRB 1R3HA 3SDCD 1MCRA 5L8JB 3QDJE 4NBXB 4WW2F 3TT1H 4FFZH 3RTQB 4MJIB 1M7DA 2AABH 4NZTL 5CWSB 2ZUYA 1QBLL 3RPIA 3VCLA 5IHUL 4HIXL 2ITCB 1JGLL 3D9AH 3I6GA 5LKNA 4GSDL 5M94B 5HTSA 1F4WH 1OGAD 3HE6A 3VG0H 5L8KB 4G9FB 2OR9L 4N5ED 1R0AL 1HHJA 2P24B 3SKMB 3GMQB 1RJYA 3SJVB 1NFDF 4P9HH 3G6DL 4XNZC 3VXTB 2C26A 5K59E 4XCNB 3VXRB 1K85A 1BVLB 5E2UH 3GNML 1S78D 3JWDL 3CSBA 4H0IA 4J6RH 5J6GB 2ZOKB 1CG9B 3MXWL 3ARFD 4AZ8A 5EO0B 4AIXA 1FE8L 1QLFB 1U8IA 1T0PB 35C8L 5B39B 1YMHA 1UJTA 3HPLB 4D9RE 3MLXH 4UDUB 1NL0H 5JZ7D 2ZOLB 2ARJB 3P4NB 4ENED 2ERJC 3WUWB 4FQ2L 2ARWA 3V6OA 4HPYL 4JY4B 3UAJC 1EO8H 2X89A 5DRNB 3R8BB 1R5IA 5D1XD 2P8LA 1LE5B 5H37G 1C5CL 2BK8A 5I1LB 1W8OA 3MFFB 3MC0A 2JK5A 1XGUA 2DMBA 4NC2B 3C2SA 1J8HA 5FM5M 3MYJA 1GCFA 4KTDL 3FJTA 2DL9A 4PRNA 3EYOA 3LMJL 1T89A 1UA6H 1U8HB 2DKUA 2EDKA 1JZ6A 3ILQD 1H0DB 4HGKC 3QSKB 2X9XA 3EYUH 1UFUA 5D7JD 5KW9L 3D1MC 4UQ2A 2HP4A 1NC2A 3VFNA 2HT4D 1WIOA 5FYJU 1PFCA 4Y16D 1IKNA 2V9QA 3ZLQC 3LQAL 4NUJA 3MMEB 3WEXB 3JV0A 3L3DB 4POUB 2E27L 2EKSB 2L0DA 4YWGH 1NH6A 2UZYB 3UZEA 2I9TB 3NCCB 1DBAL 5C08A 5CJ5A 2YPLB 4YHIB 3EDDA 3SGJC 5JOFA 3W2DL 1YEKL 4LLDA 3MPCA 4UIMA 1EBAA 2VDQH 2VWEE 3LEYL 1MFAH 4MXQD 5DHYA 1C7TA 4P59H 1CFNA 3PXHA 1OAZL 1UB6B 4MD4B 1S9XB 4KJWC 4F80A 3T4AB 5IF0A 3P73B 4OLWH 4Y19B 5SWQA 4N8CL 1DBMH 5DEFA 2I27N 4PD4K 5CLTA 1K4CA 4Q9BA 5C6PB 4KVCL 3SKJL 1BFSA 4IS6B 1MJJA 4HBQA 2ZJSL 3FQTA 1SJVA 3NPSC 3TLRA 3E3QC 4G9DB 4D9QE 2VZUA 3MV9B 5D7IA 4Z5RB 3B2VL 5J56B 1PZ5A 3WHXB 2DQTH 2H41A 5I19L 1AGDB 3BFOA 1IQDA 4JKKA 3O0RL 5FA3A 3TYGH 3UPRB 4IRSB 3QDGA 3QWOB 4OBSA 3I2CH 3RWEA 2RIKA 2GTZA 1RSFA 4OIAA 1MRDH 2HVKB 3FT4B 5DJZA 2ENSA 3HC4L 4PGJA 1E6JH 2CUMA 2CMRH 2AXGA 5C7XH 4HAGA 3DX8B 1F58L 2J88H 4KJPD 2RAMA 1FDLL 4LARH 4R7NA 1S8DB 4MSWA 3CPLB 3DURB 3QFDA 3VDAA 4E42B 1RI8A 3MRMA 1T3FA 3IF1B 2ZG2A 4FS0A 2Y07L 2ATPA 3HZVB 5HHXL 4CW1B 5CP3H 4P48A 4LVNB 5L2KD 1UVQA 3SDAA 2VN7A 5IFHL 4Z7VE 3X11A 1I8IB 4TTGA 2DLFH 4H26B 5D6DA 5EPMA 5FCSH 1BQSA 1TZIB 4HXBL 4DVRL 5IK3B 4HXAL 2B1AH 1BFOB 1MHEA 3PDOB 1A22B 1K2DB 5M7QA 4FTVA 4HLJA 3DXAA 1P2CB 5D72L 5F7DB 3AS2A 3L3HB 1CZ8L 1DFBH 1I1AB 4IRJC 3L5WB 3INUL 3ZE2F 3LPWA 3WSQL 1SMAA 2P5EB 5DJXB 4NRXB 1Y18B 3SQOL 4Y8DC 4OBRA 1BBJA 4NNYB 1T4KA 4PRID 5DZNA 4KKNA 4LSQL 4WV1C 3DMMB 1KV3A 5J12B 3DRTA 5FKAB 1GGYA 5GRUL 4LLMA 1QO3B 1GGCL 2VLKD 4POZD 1KELL 4ZFZA 2W65A 4XC1H 3WDJA 2IADA 3BH9A 1VFAB 3CLFL 2F54E 4ONGL 4F7PB 3RZCA 5D5MF 2ZUUA 5C09B 2JCCE 4MX7A 2F53A 3ARGC 1VADA 1RK0B 4CJ1A 1RZKL 5I75C 1I3GL 3FAWA 3K4ZA 1RU9L 3NCYS 3OAZH 4JQIL 3U4EB 1SYVB 1QR1B 5JDSA 1DBBH 2I24N 1CK0L 3O3AA 1UB5B 3D2UD 5DO2C 4DZ8B 4WEUD 1HZHL 2NY7L 4YBHA 5L6YH 1X5HA 3VXSA 5C2BH 4IOFD 4ETYA 5F7UA 4XNZB 4HG4K 1BOGB 2ZZUT 1LO3L 3IAGC 3GIZL 2JKXA 1PQZB 1MQ8A 3Q6GL 3T3MF 5I6XC 3PQYB 4M9PA 4FQQA 4LCIH 1RUMH 1FL6A 1OAQL 4V2CB 2G2RB 2ZCKH 1MIEH 3EJZD 1UACL 1C08A 1JTOA 3EBAA 5ICXB 1KCKA 3TN0A 5SX5H 5H35A 2XQBH 2ERJB 2V6HA 5AUMA 5FB8A 4XRCB 5DQDH 4G6KL 1EFXA 4ELMB 1JZ3A 5BJTB 5HHPB 3AXLB 1R5WB 1EERB 3QDMD 2D2OA 1XGTB 4HUVB 5E2VH 3QRGL 3O6LL 3RFZC 2GJ6A 2X7LA 1GHFL 5CJQH 2X6MA 3BZ4A 4PJXF 4L1DA 3D3VE 2O5YH 3HHRB 3KPSA 4NYLA 4TUOB 3IFPB 1GRWA 2OJZH 1P7HL 4GRLA 3GSQA 4XCEA 1IAMA 4HWEH 3BJ91 2W0FB 2PKDA 4APQA 4K9EL 4XB8A 2IANB 1I85A 4F3FA 4L3EB 3FFCA 3O8XA 4RAUB 4HWNA 3BPCB 3I50L 3G5XB 4P49A 3MRPB 3BAEL 4N9OB 4PV8A 3ULUC 1WISA 5CJBA 5IW1B 2ICEB 1RMFL 5INCB 4KDWA 5GGSY 1RZIB 4QRQB 4OF0A 5F7YC 1NKOA 1Y6MR 4JE4B 3T4YB 1MCPH 1NC2D 4O2EB 1JBJA 1XIWC 1OF2A 4ZUWB 3NACH 3C5SA 3LDBC 4KROC 4P4KC 4JHBA 5CEZH 2B2XH 3MLWL 2YZ1A 1G7JB 2KZWA 2GAZA 5I1CL 1IEAA 5DSCA 3FRPG 1U8PB 5C08D 1X7QA 2ZPKH 3DO7B 3F7QA 5CD5C 5I1KL 4RX4A 2Q76A 4N9GA 3JTTA 3VMOA 1SMOA 5D71L 2Y06H 4AENA 2B1HL 3MLTB 4NQEE 3P9WB 5GSVA 4GBXB 1Z0NA 4HC1L 2VQ1A 3NPSB 4NNPH 4EDXA 3KAAA 3EAKA 3U7WL 3ZYOA 3S4SA 1KNOA 3SY0B 5BXFA 3DETD 2F74A 2VABB 3NABL 4C56B 4ERSL 2NTFA 2EKJA 3U4BH 2Q8AH 1H3WM 2GITA 3VFSA 4KKBC 5F9DC 1XCTA 1W0YT 1EVUA 2J8OA 2RR3A 1AHWC 4CGTA 3EZJB 3F7YA 4LSTL 4OLVH 4G6FB 7CGTA 2XIDA 5TE7L 1QBMH 4A6YL 3OJDB 2DM2A 2C3HA 4H25A 4NWUH 1KLUB 5HHQB 4YGVB 1F90L 1DSFH 1D9KA 4BK5A 4JKPL 1ED3B 2OMNA 3H3PH 5CP3A 3W0WE 1V7ML 5E6IA 2ADIB 3OG6B 3V6FA 3MUJA 5A16B 5KVGH 4N8VB 2E8YA 7FABH 2FJHA 1NDGB 3A67H 1U6AH 5LGHH 4F9PC 1WFUA 1MVUA 4HX1B 25C8L 4PJEA 5TF0A 2P47B 3FQXA 5I8OL 4J3VA 1HCFX 4MMZC 2ED7A 5HHOE 1CR9L 4NZRL 5C6TH 5J6HB 4J7RA 4NQXA 4U1HB 5IHZB 1PKOA 3LPGA 4P4RB 3WJJA 5KN5B 4E41A 4PRDB 4XNYH 4JPVL 3LS4L 4WV1B 5TQ2L 3QEQE 3MROA 4MB3A 2VLRE 1JF1A 4Z7WE 5DD1L 3QNZA 2Q86B 4XNUL 5TE4L 2XKNA 1U8MA 4C55A 4GW1B 5F96H 4L4VE 4MCYB 4XI5C 3V5KA 4XPTH 4HZLB 3MO1B 1T21B 2YD6A 1EO5A 5JA9A 4DOHE 1MI5D 5FDWA 4HCRH 3FZUD 4LK4A 3TH2T 4GG6E 3K8KA 4X98A 5GGTH 3ARGB 4YXKL 2G75A 4OQTH 5JR1H 4TQEL 3IVKB 2Q7YA 4N0CD 5E1AA 2H26A 3C6LC 2VDLL 2DYPD 3MUZ1 1YMMA 2F15A 4ZODA 4LNRA 2NW2B 4ZUTB 5DRWA 5IB4A 4NKMA 4HWZB 3MNZA 5E2TL 3VRLF 5BCAA 1FZOB 4JFEA 3D6GA 4FQCL 3OAZK 2F53D 4PJFE 4PG9B 3RU8H 1I8KB 4NOBA 5J3HD 2LV4A 3NIDE 4LLWA 1H8SA 3GHBH 4EUPH 1YY8B 3SE9L 4QOKB 1IZJA 5JMOC 1U8QB 3OKYA 2VITA 5DUBB 3ET9F 1L6XA 2XOTA 3MOBL 4MDIB 5F7KC 1DN2A 1FAIL 2R69L 1DDHA 2WP3T 5C8JB 2HA1A 5FGCE 3KVQA 2YRLA 5C0RH 3G5YA 3FQRA 4KK9C 4YUEH 5SX5K 5F97E 3ZL4L 3W5MA 4PRAA 2RQ8A 1VPOL 4HT1L 4KDTC 5IVXA 3TN0D 3WXWH 2IH1B 3K1KC 3MLZL 4OD3H 3GSXB 2YK1H 4W6YB 4Q7DA 1RZFL 5KVFH 3OKKB 3MV7E 5EWIL 3S34H 2BOCB 5J9PA 2J1KA 2QKIA 4GMTL 2GJ6D 4JZOA 2EYSB 3BJLA 2B39A 1YJDH 2ED8A 4MNGE 4R26L 1A6VL 3KPSD 2D31B 3ES6A 1SJEA 1MRFH 1WK0A 5EA0L 4JRYA 5KAQF 1AI1L 2UVEA 1G9MC 5JIPA 4APQD 2CR6A 4L8DA 2VXSL 1BIHA 4XBEL 4BQCA 1KFAH 3O8XD 1YY9C 1Q9KB 5T1LB 2X4OB 3MRHB 1XIWB 4ONHA 5EU4A 1DQLH 1HINL 1CFQB 2EH7H 2C7UA 1FGNL 3BEVA 3LDBB 4G8FA 4P4KB 4BSJA 4M6ML 3LY6A 1INDL 4C57C 3GB7B 5DFTA 4NBYB 5IB5A 4W70A 4NSKA 4AJ0A 3RL2B 1TJIL 2R15A 1IJ9A 1VACB 3K1DA 4NHCL 5C0EA 4NO0A 4P2RB 2BNQA 3HZMA 1ITBB 1ITCA 2DQEL 5EUOB 2BSSA 4OLYL 1A5FL 1QR4A 2WIIB 3NIFE 3MRDA 4HG4J 5GRJH 4PTTA 4M3JA 2ICWB 3KS0H 3LZFH 2GJZB 4MD5B 3BP6B 3DBXA 2XTLA 2EDXA 4N90E 3TA3C 1X4ZA 2IQ9L 1AHWB 4MQSB 4OZIF 1KUMA 1KC5H 1J1OH 4LIQH 5E0QA 4OJFL 2X42A 4MB4A 2DL2A 3QO1B 3BEWB 3TCLB 2WBJB 1A7NH 3EYQD 4JZNB 3CC5B 4DUWA 2MPAH 4KRMB 4QHMB 4JLRB 3S36X 1QHPA 1NGPH 1OAKL 2OS7A 3I6LD 4YHZH 3O4LA 5IVZA 1WVZA 1I9JH 1AXSB 2A6DA 5GZND 2VTFA 3CXDH 4QYOA 1YNLL 5I71C 1HXYA 1LO2H 3AMLA 4GS7C 3REWB 1QNZL 4HGWB 2HJLB 4NM8H 3ABZA 5TDNB 4NWTH 5BVJB 1GL4B 5BW7C 2B4CC 1XF3A 3LH2L 1IT9H 4Q74A 1N0LA 3WL9B 1NCUA 4XP6L 4G7YL 1D9KD 2AXFB 4AEFA 4UOW1 3UZQA 1U2HA 5E9DA 4MDJA 1EPFA 2UWEB 4PV9A 1ZT1A 5E6ID 1ZA3A 3MGTA 1ZSDB 4GAJH 1D5BA 4BKLB 4U6HA 1MPAH 3BDBA 3KPMA 5MP6L 2NNAA 1QUNA 3L5JA 1B3JA 3PHOA 4PR5B 2VLLA 5TDOB 4BH7A 4UB0L 4WVRA 3RY6A 5K9QG 4OGZA 4K3JL 1IFHL 2VZTA 2NY5L 4LGPB 5H94B 4XVTH 3U83A 1CXEA 4Z78B 1G6RB 3U46B 3WJLC 5EC1A 1G7IB 4L8CA 2FJFA 4PJDE 5IW3A 4BH8B 5HYJD 4FQLH 1BX2A 4F2MB 4JAMA 1HCVA 5B3JE 2H2SC 1FNLA 2AXJA 3NVQA 1AP2A 1S7TA 1FZMA 1QFWM 2IQAA 4FQHB 2VZ1A 3MJ7B 4L8SC 1RURL 2YPKB 4ZUUA 5ESQA 5GGTA 4JFXB 1W72B 4IEFB 5A2LH 5I1DA 4OQTA 5ID1B 5E4EC 3KXFB 1UM5H 3BT2L 4FP8L 1HEZA 3W9DA 2J8HA 3C6LB 4ZSOA 1LNUB 1AY1L 1X44A 4ZFOB 5ANME 1S7WB 4GJTB 3NCJL 1AQDA 1K9TA 5E7BA 4L29A 5J1SC 5JOPD 1G9NH 3QNXB 1YMMD 4NT6B 4UINH 5DJ2B 5CMAB 1FBIH 3VFVB 4KKCD 3TT1L 4OM0H 5C0FB 5IG7B 4WWID 2GSIA 2WINB 3JWOC 4FFZL 2PW1B 2AABL 5E6ZA 4J23A 5EO9B 1VHPA 3OX8A 5A3IC 3CVHB 3Q6FA 4Y4KC 4M61A 5D2LB 1FV1A 2MNUA 4JO2H 3BN9D 1F4WL 2XPGB 4CMMA 3VG0L 2V2TA 1WGOA 2YEZA 3C5ZC 3EYVB 3BZFB 4LCWA 3THMH 4AIZB 4JQXC 4P9HL 4WWKD 2FX8H 4EUPG 3D0VA 3EHBD 4RMRA 5E2UL 1NAMH 1Q0YH 3AY4A 4J6RL 1K4DA 4JJ5B 3MRRB 1IM9A 4HIJB 2J8UF 3UO1H 2NR6D 3LQAC 4OGXH 3D69A 1WZ1H 4HHAB 2PYEE 4JM4H 3GFUA 1F4XH 1CL7I 3H7BB 3MJ8A 3FCTA 3MLXL 1XCQA 4RQQA 1NL0L 1JN6A 3Q1SH 5D2NA 3VWJA 5K9OB 4YHNA 3NTCH 5I76A 5FYKU 4FFWD 4GAFB 1B2WH 3OR7B 5IEKA 1J0KA 3MGOA 1EO8L 1ES0B 4CVZB 4R4BA 3QHTC 5ADPH 1KCLA 4LCUA 5KVMC 1UEMA 3ARWA 1U3ZA 5GS1C 2LE9A 1NEUA 3P0YL 3OJMB 4JRYD 3OHXA 1UYWH 4Z7UB 1N7MH 5CGYD 4R97C 1Z9SA 4G8GA 4KJQD 2FLBT 4UBDD 1UA6L 3S3JA 5HVHC 2BVPA 4I18C 3KYNB 1PZUB 2E6QA 4MA1B 4GUPA 3EYUL 3IJYA 4BFEA 2QHLA 3SE8L 1CICC 5CEZD 3VXME 1IAOA 5FK9B 2VDPL 1J7VR 3UJJH 1ZHKB 2DQDH 3B83A 5EZOH 4PRHB 5KG9A 3DTXB 4NFCA 1F45A 3ZKMC 1WFNA 3ELAT 5FO8A 2PW2B 2VDQL 1N6UA 4NO0D 4DCQA 4P59L 3PL6C 1N5AB 1WCBA 3JV5A 1OOAA 4P2CG 1RK1A 3EW3B 4E0RB 3ZYJA 2DTMH 3ARDA 4OLWL 4N1EA 2FZ3A 4O2CA 4BZ1H 1LEIA 3TZVB 2GCYB 3NCMA 2BCKA 2VDNL 5CUSH 5K9KB 1K3ZA 3QZWA 4YEEA 5F44A 4OZFB 2YBRB 3BP4B 1J8KA 4XPBH 3LKRA 1P6AB 2VSDA 2GKIA 1XGPA 5INDB 3PP3H 1QSEA 1S9VA 5ACZA 2XKUA 2DQTL 4G6AC 5I71B 4NBZB 5FV1L 1AKJD 3BKCH 1X4YA 5HPOA 3TYGL 2R1WB 5C92A 3I2CL 4PJ7A 4OGAD 4HIHB 4XWOC 5MEOA 3HPJB 3O11B 2PO6B 3O6FC 3VFUA 1GZQA 3D87B 1E6JL 2CMRL 3MNWA 5HI5D 5C7XL 3QZWG 4GMSH 1JZ4A 4XVJH 3OKOB 3BX7C 2J88L 4UOW0 3PWLA 4PGBB 5MEPA 4LARL 1RZGB 3MBED 2R2EB 1Y0LA 4JHZA 3DRQA 1CDGA 4PJCB 3D0LA 1HDMB 5JDJA 3FOMB 3T0DA 1JE6A 3ZZ1A 5E08H 1S7RB 1MHHA 4CRPA 2JB6A 3Q5TA 3LSOA 2XXCB 4NC0B 3V8CA 3IB4A 2A74A 3BZEA 1OSZB 3GSNH 3BE1L 4I5BB 2DLFL 2O93L 2D7NA 5A1AA 5C2UB 3PGDA 1O7SA 1FPTH 4WW2C 1MVFA 5EBWA 2B1AL 3E6FA 5JW4N 4JZJA 3V5HA 5F7LB 4G5ZH 4CADA 4DKAA 2W91A 3HUJA 3JTSA 1QFUL 1IC1A 3C08H 5CJXA 4P46C 1CD0A 1DFBL 5F3BB 1T22B 5GGVL 4YIQA 12E8L 3H3KA 2X4RB 1KIRA 2OX5A 4GAYA 3RVWD 4RIRB 1ZGLM 3AREA 2ICWI 4MQXD 1XF5A 5JUEH 3SGKC 5ITBL 4HUWA 3SDYH 5IROC 3CGTA 4LLUB 4XC1L 2EDBA 1PKQB 2BVEA 3FO1B 4ZPVA 4LBEA 5JPMB 5JHDB 5F9OH 2X5PA 1EGJH 2EIDA 3MRBB 3HE7A 1DN0A 4Y4KB 2QV2A 5KBNC 4M7KH 3PABA 2EZ0D 4LGSB 4GH7B 1MAKA 1ZA6A 2RJMA 3BXNB 3KLHC 5BRZA 1WF5A 1DBBL 5TH2A 1CD8A 1PD6A 3NFNB 4PTUA 3I85A 5L6YL 3C5ZB 4KI5E 1NAMA 2YZ8A 4KY1H 2XG5A 4LDOB 1OGTB 4LPTA 5DLMH 4PP2B 4L9LB 5D96B 4LSVH 1KIQB 1QD0A 3MTRA 4LPWA 5DJ0B 3L9RA 5KS9E 5T5NF 1VFBA 1YEFL 1RUML 3FTGB 3CFDA 3WLWD 3VE0B 2EXYC 2ZCKL 4HFWB 1MIEL 1C5DB 1HKFA 1HSAA 5DD0L 1UQSA 4EN3C 1IM9D 2B5IB 1JPSH 2ADJB 3QIBC 5K9JH 2BY1A 2AK4B 4JY5H 4U6VH 5DQDL 5HYQB 4PS4H 1ZGLB 4YDLB 1JGUL 2ZSWB 4XPFH 2BJMH 3UTQA 4NCDA 4X9BA 5DK2B 1WBYB 3WO4B 4NO2B 3ULVE 4XVUD 5E2VL 2X9WA 3CH1A 5CJQL 5GS1B 1AD0A 3TNNA 4DK6A 5C0NC 4GRWB 1MJUH 4R97B 1EAPA 2YN5A 5DMIH 1HHIA 5HVHB 1S9WA 4I18B 1F5WA 4HWEL 1T03H 5C0CD 2ZG3A 1LQSR 5D7SH 5F8QC 5EOQH 1WT5A 3RUGF 4Q6YA 4H1LA 3KPPA 2Z8VC 1CICB 3QDAA 5T1MB 4I3SH 5C0BE 2ESVA 5JO5B 1CFTA 5FUCE 1A1MB 5IR1B 3E6HA 5D7LE 1YN7B 2DQGH 3DHMA 3LN4A 3T1WA 3ZE1F 4UTAH 5CFHA 1MCPL 1FQ9C 3REVA 5F89A 6FABH 4K71C 4PJHE 4YC2C 3NACL 4MJ2A 5CGMA 5CEZL 2B2XL 1PEZA 3HC3H 2FX7H 1Q72H 3PL6B 4PLJD 4RFEA 2QQQA 3QAZC 1ZK9A 4MD0B 3QCVH 1GGIH 2Y06L 1BZ7B 2CRMA 2P7TA 4GW4A 2J5LC 1LK2A 3I9GH 5I18H 1AJ7H 5DJCB 4DFHA 3NN8A 1TZHB 5KSBB 4NNPL 4KRPC 2BOBA 4QWWD 4Y1AD 4PJGE 3ARDD 4RZCA 2C1PB 1ZVHA 4JHAH 3T04D 1T1XB 5ESAB 1OTUD 3PP3K 3W9EA 4U1NA 2A6JB 4WFGE 3U4BL 1W8NA 3LRSB 2Q8AL 2OJEA 5SWZD 4FFVD 3H9SB 4JRXB 3UPCA 4NQDB 1IGIH 1WTLA 2A1WH 2LVCA 3O6FB 4OLVL 5DUMH 1TTUA 3TVMB 1NGWB 3P4LA 5IMKA 5DMJB 3VRIB 4ZNCD 2DMKA 2OP4L 1IM3A 4EIGB 1FYHB 5DMGD 1ORQB 3U79A 1TENA 5DQJA 2A73B 2OK0H 4NWUL 3IAQA 3BUTA 4OLXH 3RP1A 2GFBB 5ISZD 5HHMB 1ONQB 4XXDA 3LAFA 4TSBH 1DSFL 3QFJB 5B22A 4HQQH 4EEEA 1FJ1B 4XTRC 4ZO9A 3MLVH 1EHNA 4N68A 3T2QA 4CU7A 4ODXA 4PRPE 3CMOH 5KVGL 2Z92A 3MR9B 7FABL 3BUYA 3LEXB 5ITFB 3A67L 2VKXA 4OKVB 2H2PD 2HLAA 5LGHL 1P7KB 4WW2B 4K94L 4EBQH 3PV6A 3NCFB 4YO0B 2H9GB 1V8HA 3RWIA 1PGRB 2VNCA 3EOBB 2Y5EA 1I1FA 4P46B 3FO2A 2PR4H 5B3NA 3CUPB 5JTWA 5BQ7A 5C6WH 3D39D 2OXHA 4JDVB 4DAGH 3C60A 1E28B 1JRHL 2W0LA 3GJEB 4XNYL 2MSPA 2OZ4A 3RVXD 1NFDB 4KAQH 4OCYH 4P5KA 5B38B 4WHDA 2B0SH 2V7NA 4S11A 5DT1H 1CYGA 4YAQA 1NCDH 3D85A 5BZDA 5F96L 4Y5XC 3DVNA 3HE6C 1TJGH 1FFOA 2QR0B 2HYMA 1EGJA 4AT6B 1FO0B 4EI5A 3VGDA 5I16A 3F62A 2YN3A 1SEQH 3KS0J 1T0MB 5GGTL 5JR1L 4OQTL 4D0BA 4QHUB 1P69B 1NBZB 3CH8A 3VGGA 3MRIB 5IKCB 5EU7C 4X4XB 3FB7B 5J4MA 1P4BH 2R23A 3CDGB 2MCG1 4GAGL 3HE7D 5B4MC 3RU8L 4PBVC 4LVOC 3KPRA 3OXRB 3GHBL 5IHLB 4YDVB 3OB8A 5D1ZB 3DX7B 3RTQA 3GSWB 4MJIA 4TSCH 5CWSA 3QHFL 2HT2D 2YRZA 1R3LA 3TO4B 2ITCA 2NXZD 2HH0H 1LILA 5DRXB 3QB7C 3QIBB 4P5MA 3WXVH 4G9FA 2P24A 5C0RL 3SKMA 3GMQA 5F9AC 4OCNC 2JJTA 3SJVA 5MENB 1T89C 1H8NA 2K9UA 4IMKC 3L5HA 4XCNA 3VXRA 3VXTA 1BVLA 1KXVC 3MLRH 3WXWL 1N3NB 1CI5A 2KUTA 5J6GA 2ZOKA 2QADC 4OD3L 2YXMA 5ALBL 1CG9A 5EO0A 3V0VB 1T5XB 1IKNC 1QLFA 3BGFB 4WTZA 5KVFL 3ZT5A 5I9QC 5B39A 2B20A 3S34L 3HPLA 4UDUA 1Q0XH 3GM0A 2FYYB 2ARJA 2ZOLA 3N0PB 3P4NA 3MA9H 1GOHA 3WUWA 1YJDL 3N1PC 5DTFB 4JY4A 3HRPA 1MRFL 5LBSH 5DRNA 4LL9A 3NFPB 4I48B 3QXAB 1EZVY 2DQUH 4KHTH 2V9RA 4UNTA 5DURB 1LE5A 1XH3B 5EULV 5I1LA 4PY7B 5LCVH 1UKTA 3MFFA 3QWRA 1S5IH 4KZEH 1GAFL 3RX8A 3B8YA 1PEWA 2ESVD 4K71B 4DN3H 1TCRB 4YC2B 2EH7L 1EEYB 4L4TE 5B39G 3SQBA 2VAJA 1U8HA 3FT3B 1XGRB 2FRGP 4XHJD 4HKZB 2HRLA 4TRPH 1P4LB 4J1UB 2NXYC 3QAZB 2YUWA 2IPKB 5DJ8B 5I15H 2RBLA 4D9RD 4ZO7A 3MMEA 3WEXA 2J5LB 2ZNWA 3MJ9H 3L3DA 4MS8D 3RVUC 2WW8A 1NPUA 2EKSA 2LAGB 3VMPA 3FO9B 4KRPB 2ARJQ 3B9KD 2I9TA 1AC6A 4YHIA 3V9FA 4MXWH 2XTJE 1I4FB 4PJAE 1NCBH 5GRJL 1N5YH 2FIKB 2NY2C 2G9HB 3LZFL 4MD4A 1S9XA 3T4AA 4OUUB 1YC8A 3P73A 2FATH 4JG1H 2Q20A 1KC5L 5C07B 1J1OL 1VSCA 4P3WA 1FL3A 4EJ1C 3V4UH 4Y2DC 3G9VA 2BSRB 4IS6A 1A7NL 3QXTA 2AI0H 2DM4A 4MXVF 4G9DA 3OR6B 3MV9A 4FQXD 1NGPL 4Z5RA 4YHZL 2PNDA 3BO8B 3WFCH 3SDAC 1I8MB 3CXDL 1A2YB 3UTOA 2C3WA 1AGDA 5MEQB 1U8LB 1LO2L 2QSVA 3U4AA 1TJHH 1CVRA 3UPRA 4NM8L 4IRSA 3QWOA 3O3BB 1EVTC 1LP9F 3NZ8B 4WCYH 3QUZC 1U3HC 1QQDB 4YNYB 2HVKA 3FT4A 4LSRH 1IT9L 1S9KC 1F2XK 1I3UA 1XGQB 2W38A 4LQ1A 1NDMB 5LAXB 5EIQA 3DX8A 3QEHB 3BN3B 1IEBB 1TVBA 1MPAL 3WKNA 5KVEH 4QGTA 5D5MB 1S8DA 4NO3B 4FXKB 3CPLA 1EEZB 5IESH 3DURA 4BFIB 3PNWB 4D9QD 1BJ8A 1XF4A 2Z93B 3RWHB 4XVTL 4HF5H 4LDLB 4ORZC 1CGTA 4LVHC 5FKPB 4CW1A 1X9QA 1M7DB 4K7FB 4TOYH 4ZO6A 4KK5D 4FQLL 3RZCC 3W81A 3F7VB 1I8IA 5BMFH 4U3HA 3FO0L 3MBXL 4G6MH 2K7QA 4H26A 4YFLF 5FXCH 4FFYH 4XX1E 1TZIA 5IK3A 1AE6H 1BFOA 3PF2A 4Y5XB 1K2DA 5E24E 5J8OA 2NY0D 3HE6B 4X6DE 1P2CA 1MREH 5F9WC 3H3BC 5E56A 5F7DA 1GVIA 3DGGA 1T66C 3L3HA 1SHMA 1UM5L 3L5WA 4NC1C 4XMPH 4IDJH 8FABB 1FNAA 3D85D 2C3XA 2P5EA 5DJXA 4NRXA 1Y18A 3VDBA 1NAKH 3PUCA 4EDWL 4EI5D 1FORH 4NNYA 3VXPB 4ZS7H 2DKSA 3DMMA 5HHNB 2FH6A 3GEWB 5GGQH 4LVOB 4KKLC 3UMTA 1G9NL 4UINL 5FKAA 4WU5B 1FBIL 1NMCC 4OM0L 2COQA 1PYWB 3MACH 4QGYA 4ZTPH 1QO3A 4F15C 4PJXB 4D0CB 1MCLA 1KGCD 3KGRA 4F7PA 5JW5B 3TPKA 5C09A 3O6MH 4TNVF 5IWLA 3SDXF 4IOIB 3IDXH 2CD0A 3T3PF 4LLVB 3U4EA 1QR1A 3RTQD 1AIFB 1OWWA 4MJID 3C6SB 3S9DB 1J8HB 2H8PB 5CHNB 4DZ8A 1UB5A 1I7ZB 3X13A 3THML 4YK4C 1TZGH 4RGOH 1S7SB 3T2OA 2NLJB 5KOVC 4GRLC 5IBUB 3MREB 1NAML 4RGMC 1Q0YL 1PQZA 4ZOBA 2JE8A 3NIGE 1JWMB 2QADB 5CZXD 4G9FD 1O0VA 3UO1L 3PQYA 4UQ2B 5DJAB 1QBBA 3HCVA 1WZ1L 2DLGA 1J0IA 4PREB 5AZ2H 3O6KH 4I9WD 4JM4L 1F4XL 2G2RA 3VXRD 4NUJB 5I9QB 2XKSA 4I4WB 2MKLC 4OUOA 1BQHB 2X2YA 1UWGH 3Q1SL 5ICXA 3KYKH 3NTCL 1B2WL 3HTLX 4UILH 3QIWC 4XRCA 4DQOH 2JTDA 4ELMA 4Z7NE 5ADPL 2H3NB 3QCUH 5BJTA 1KCUH 3AXLA 1R5WA 4KUCD 1XGTA 3ILPB 4HUVA 2NPLX 4H0HB 1DBJH 3AFLA 1UYWL 1N7ML 1DBKH 4TUOA 3PV7A 4NQVA 5ILTH 3G5VB 4X9GA 2W0FA 3P0GB 4PJIE 1KCRH 2NXYB 2IANA 4OV6F 1UGNA 1OTSD 3UJJL 3BPCA 4YHMH 3G5XA 5L2KE 1JYNA 2X05A 5EZOL 1FYTB 2VDMH 1A7RL 2ICEA 5INCA 3L7FB 4XBPB 2MQ3A 1RZIA 1DVFC 4EIZC 4QRQA 2DRUA 1VEMA 3ULUH 2V5TA 3G6JF 3T4YA 4DZBB 4AL8H 2DWDB 1SJXA 4O2EA 5DJZB 3STLB 1MCBA 3SGJA 2Y6SD 3BKJH 1DCLA 2YUZA 1KTDA 2P1YA 3B4NA 2G60H 2NZ9D 5FO7A 4ZUWA 5E8EA 2VR9A 4WFFD 3K7UA 4R6UA 4LKXB 1G7JA 4BUHA 1U8PA 4UDTB 2YPLD 3DO7A 1CLZH 2DTML 1Z9LA 3S35X 3T09A 4BZ1L 5HI4D 4HWBH 4Z18A 5FOBB 1MFCH 4PRIE 5CUSL 4KK6C 4L5FH 3DIFB 1WAAE 4RMWA 2ZKHH 4Y2DB 4GBXA 4XPBL 2AEPH 2ATPB 3GZKA 2DIBA 3SE3C 1P5VA 3VU2A 5I1GH 3ZHDA 1A14H 4Y19D 2VLKE 1E4XH 3SDAB 1VKXB 3BKCL 3SY0A 1ZANH 2VABA 4U1IB 4C56A 1B6DA 3MV9D 3TC9A 4FTVB 3LN9A 3QUZB 1U3HB 4JFDB 1NC4B 3KJ4C 4YBQD 3U9UA 1JWSB 2R4SH 1NEZG 3H8NA 3UTPD 1KTLB 3EIFA 3TJHD 4PJ8C 1MELA 4GMSL 3OJDA 1PX3A 4XVJL 1N2RB 1YYLH 2EDYA 3T0XA 3JSSA 3WJJC 4OV5B 4HWUA 3MRQB 1KLUA 5DQ9B 1YEEL 1UXWB 3K0WA 5HHQA 4YGVA 3EJYD 3Q2CA 5HD8D 1F11A 5GGRB 1JNLH 1ED3A 5E08L 1ZHLB 4HS8H 1BMGA 4LLMB 5EFIB 2ADIA 4NRZB 4LVHB 5A16A 4HH8A 4N8VA 3RZCB 5KANG 1NDGA 4P9ML 4MX7B 1VADB 4OFDA 4M8QB 1WIPA 3HLAB 2WV3A 1NGYB 3QDME 2J6EH 5IVNA 3C09C 1I7RB 1FG9C 3V6OE 3C08L 3VXSB 1B0GA 1UM4H 2V5SA 5IHZA 2E6JA 4TPRL 4P4RA 3T0WA 3D5OF 5GZOC 5KN5A 1PY9A 4RCAA 4MXVE 4N8VG 1G6RH 4WV1A 1I1AD 3WDHA 3ETBF 2OZ4L 2P5ED 2F5BH 1C08B 2Q86A 5JUEL 5BVPH 3SDYL 4GW1A 4YLQT 1W0WB 4MCYA 1NMCB 4PJ5A 3KPOB 4HZLA 4F15B 1D5ZB 5C3LD 4JVUA 5FB8B 3MO1A 5T3XH 1T21A 4MHHG 3DMMD 5EU3B 1LP9E 1EGJL 3W11D 1EFXB 3U6RB 1KB5H 4U0RC 3ARGA 4M7KL 1W72H 2XRAH 5E8DH 3IVKA 1NLBL 4ZUTA 4NRYB 3S88H 5C08E 1O7VA 1UG9A 1FZOA 3IS0X 5C09D 4QRTB 5GS2H 4NYLB 4KI1A 4YK4B 5CSZB 4PG9A 4KY1L 1I8KA 3GMRB 3QJHB 1ROWA 2I07B 3QP3A 5DLML 1YY8A 4QOKA 2IPTH 2DD8L 4LSVL 5GS3A 4HIIB 4ZPTB 4UIKH 5B8CA 5DUBA 2ZP0T 3SO3C 1KSRA 2Y23A 4MDIA 3UYRH 2WZPD 3S5LA 1WBXB 3FKUS 4EQ2A 1JPSL 1QEWB 5C8JA 5K9JL 1MCQA 3PQYD 5D7IE 5DVKA 4JY5L 4U6VL 2E9WA 3C8DA 4PS4L 3QIWB 3KR3H 1CU4H 3IJSB 4XPFL 2BJML 2Z8RA 3CDFA 3FONB 5CEXB 5DSCB 3LKPB 2IH1A 3QDGE 4QXUH 1GSMA 3GSXA 3UAJD 3U0PB 3JTTB 3L95B 3P9MB 4F58H 4YDKH 4PLNC 3OKKA 5DMIL 2HT3C 3O2WL 4LQFH 2FGWH 2BOCA 1KLGA 4OQ1A 4XHQA 5D7SL 5EOQL 2EYSA 2FBOJ 3EFFB 2BY0A 4OZIB 3STBA 1QYGH 2F8VA 1BIIA 1X5AA 3WO3B 4I3SL 2D7QA 1D6EB 2BX5A 1C7SA 2DQGL 4R90H 1DVFB 2V2WB 1NCAL 3ARPA 5IEHB 3RPKA 1G9MH 4L3ED 1Q9KA 5T1LA 6FABL 2X4OA 1MFBL 3MRHA 3SOBH 1XIWA 5IUSA 2RB8A 1CFQA 2D0HA 2OMBA 1DQMH 3HC3L 3DROB 1J1PH 2FX7L 4ELKA 1PBYA 1Q72L 5BOPA 4HWBA 1VCAA 3GB7A 1LDSA 2L7JA 2KH2B 2DLIA 2OL3H 3DXAE 3QCVL 1GGIL 3MV7D 3RL2A 1A47A 1VACA 4M1CD 2VZOA 4QXTB 4LP5A 3I9GL 5I18L 4P2RA 1AJ7L 5DMYA 4Z8FH 1RUKH 4KJWD 3AUVA 3VFGH 5EUOA 5JORA 2EDLA 4S2SB 1DR9A 3B2UD 2FJHB 2C1OB 4X5LA 4JHAL 2WIIA 2W07A 3QO0B 4HW6A 4K94C 3BGAA 4JEGB 5LWYH 2ICWA 5HGDB 4MD5A 3BP6A 1AHWA 3CXHK 1IGIL 3G6AA 2A1WL 3KJ4B 1L7IH 5DUML 4FQ1H 3RY6C 3ZO0A 1R3JB 3WNMA 4PJ8B 3QO1A 3DPBA 2F53E 2GT9B 3TCLA 2WBJA 1IKFH 3PP4L 4JZNA 3CC5A 2OK0L 4OZFH 4QHMA 2QSQA 4JLRA 3P2TA 1F8TH 1EJ6A 4FZ8H 4OLXL 3OKMB 4G6FD 4ZQKA 1AXSA 3RBGA 1E0OB 4TSBL 4K3GA 4HQQL 4B53A 4U1MB 5T33H 3REWA 4BFGA 4KJYB 3ZKNC 4HGWA 2HJLA 3MLVL 2O5XL 2C9AA 5BVJA 2DM3A 3QUMH 3WL9A 2AXFA 1U3JA 4GO6B 4X98B 2B4CH 5EB9A 3R0MA 4F9PA 2UWEA 4EBQL 4RWYH 1U41A 2YC1B 1I9IH 2DICA 3F12B 3C09B 1YPZF 3GMPB 1XMWA 3HAEG 4ODSH 4K2UH 2X44D 4PR5A 3VH8B 2PR4L 5TDOA 4H5SB 3KHQA 3AC0A 3EYSH 5H94A 4MLIA 4DAGL 3DV4B 4Z78A 1G6RA 3HI5H 3U46A 2CQVA 4X7SH 1G7IA 2GJ6E 2W9DH 4BH8A 2PXYC 4M43H 1A4KA 4Q9QL 2W9EL 1F42A 4KAQL 4F2MA 4IRJD 4OCYL 1JPTH 2MHAA 3KPSE 3VGAC 2B0SL 4LDEB 3L7EA 1JPST 4M6OH 2AJXH 2EDFA 1DANU 4KC3B 1NCDL 1DDHB 4FQHA 2J8UB 2WUCL 3MJ7A 5DDHB 1TJGL 4HH9B 5BOZG 4U0QB 1VERA 3TH3T 3G5YB 4JFXA 1W72A 1SEQL 4R0LB 4H8WC 3FFCE 1KT2B 5ID1A 3RGHA 3KXFA 3B9EA 5EZIL 4NN6C 4Z76B 4MJ5B 3AY4C 5J89A 1OARH 5I1IH 3C6LA 3DUSB 1LNUA 4ZFOA 1S7WA 3SKNB 3MRGA 4QKXB 4OIIL 4FZEH 5FYJH 1CQYA 1FG2A 1WEJH 3ARGD 2A0LC 1FGVH 5KSAC 5D2NC 2QSCH 3QNXA 4NT6A 3VWJC 5J9PB 5DJ2A 5IM7A 5CMAA 3UYPA 3VFVA 5C0FA 5IG7A 2WINA 5EUKB 2PW1A 4TSCL 4HPYH 5DO2D 1FRGH 1MHCB 3SO3B 4ZO8A 5IW6B 3CVHA 4I2XA 3JWOH 4RSVA 5ETUB 4EI6A 1CGWA 1ZHNB 5D2LA 3MLUH 1P1ZB 3UXFA 2ZUVA 2AS5M 3QXDA 2XPGA 2XA3A 2VH5H 4O00A 3EYVA 3BZFA 4LLYB 2H1PH 4AIZA 3LV3B 3O4OC 1KJ3H 3MLRL 1KCVH 4KDTA 4JJ5A 1U8OB 5L8LB 3FN9A 4HIJA 3DX6A 2NX5B 1BOYA 3IU4H 2WUBH 1ZTXH 3M07A 1S7VB 3I6LE 3G04B 2DQIH 4ZOAA 2OI9C 1P4IH 3H7BA 3LQAH 4M5YL 4WUUB 3D25B 2WANA 2BSTB 4YH6A 1Q0XL 3PJSA 2VC2H 5K9OA 3MA9L 4RGNC 5C71A 4DGVH 3OR7A 3QJFB 1A8JH 4UAOC 5LBSL 1ES0A 4CVZA 2DWEB 2DQUL 1RZJL 4KHTL 5FAAA 5C9JB 1W0VB 5LCVL 3CX2A 1CFSB 4MYWB 4X4MA 1LO5A 3DBXB 4K7PX 4X4ZA 3T1FB 5ELIA 1WIUA 1NJ9B 4Z7UA 4KVCH 3SKJH 3ULUD 2UUDH 3VWKA 4P3CH 4M02A 1HHHB 4GRWH 2XY2A 1IC5H 4TRPL 4N0FB 4IIQB 5I2IB 3ZYZA 4F7CB 2X4TB 4PJEE 4TTDC 5T1LD 4EQ3A 1XIWD 2YD2A 1M4KA 1KN2H 2LAAA 5FK9A 1FFNA 5I15L 1I9EA 2AV7B 1DANT 4KROD 4P4KD 2EXWC 1ZHKA 5HYJE 4JQVA 2X1PA 1EMTH 1I3VA 4PRHA 4TVSa 3FQNA 3ZMRA 3DTXA 5CD5D 1CN4A 2WNGA 3V5DB 3MCKB 1BPVA 3OGCB 4E41E 1WWBX 3QDJA 1UC6A 1D5XB 5F7FA 2PW2A 1NCBL 4P2RD 1BFVH 1N5YL 4MDJB 5I1HL 1ZT1B 1F58H 3MGTB 3MV01 4S1SH 1N5AA 1BVKB 2QQLH 4E0RA 2FATL 4JG1L 3TZVA 2GCYA 5K9KA 3V4UL 1EHAA 1MJ8H 4OZFA 2YBRA 3BP4A 5A40E 2AI0L 5JOPE 4KKBD 2R0LH 4D8PB 3ZSTA 1YMME 5EC1B 3X17A 4Q9RL 2YD8A 3QCTL 4TN9A 3WFCL 1JHKH 1SY6H 2AQ1A 1BX2B 5AD0B 5IFHH 2BY2A 4LLQB 4JFEE 2E5EA 4DKDC 1QSFB 3W82A 1TJHL 1AP2B 2Y25A 2R1WA 4GKNB 4HV8A 4HXAH 2EO9A 4WCYL 3MRFB 3HPJA 1AO7B 3O11A 2PO6A 5CJ8A 4NIKB 4X6CF 5HJ3B 2YUXA 2A77L 4IRZH 3WNPA 5DVMA 4HIEB 3OKOA 2P8MB 4WUKH 2EO1A 4PGBA 3SQOH 4NP4H 2OSLB 5KVEL 1RZGA 2R2EA 1OT1A 3AGVA 1AQDB 3AREC 4LSQH 4PJCA 5IESL 2FH8A 1EO7A 1HDMA 2R2HA 3QEGH 3FOMA 5BV7C 1IC7H 4HF5L 4KV5F 5IVXE 3EYFB 1ZE3C 2P5WB 3G08B 1C12A 4TOYL 2NQCA 1MFNA 3OX8B 2PXYB 2IFGA 1OSZA 4I5BA 4G6ML 1Q9OB 1W2KT 2HMIC 1FV1B 3VGAB 4FFYL 2AQ3A 4PB0H 1H3GA 5EORH 2ZUWA 4YEFA 1AE6L 2NY1C 4C59B 1EEQA 1A0QL 1MREL 1CK0H 3L3JA 3S36H 3CSGA 2VXVL 1CL7L 3SE4C 4JRYE 3SKUD 5F3BA 4PIRF 4XMPL 1T22A 4IDJL 1ZLWH 5T3XD 4NN6B 1TTFA 4ALAH 4XI5D 1NAKL 3Q6GH 1FORL 2X4RA 4JPKL 4K7PY 2CRIA 3L5XH 4RIRA 5AYQA 2J4WH 4ZS7L 3KXFD 3PGFH 5CEZE 3SGDI 5GGQL 4MJ6B 1OL0A 4DEPC 3C6LD 5KSAB 5D2NB 3VWJB 5GS2D 4ZTPL 3LS5H 3NCYP 4LLUA 3CXHJ 1N6QL 5KZCB 3FO1A 5JPMA 4J3TA 4PY8I 5JHDA 3H9ZA 1FO0H 3MRBA 3O6ML 4Y4KA 1ZHBA 3IDXL 1CGUA 2ICWJ 1MHPL 4KU1A 1C5BL 3RUGB 2OTWA 2BNQE 3DUUB 2VKWA 4OLZH 3V95A 3NFNA 1TFHA 3CFEB 3C5ZA 1TZGL 4OSUH 5ENWB 4JQXA 4RGOL 3O4OB 2IMNA 3AU1B 1OGTA 2Z31C 4JB9L 1OGAB 4PP2A 4L9LA 1KIQA 5DJ0A 3GUTB 4IOFC 1JCKA 2UV3A 1KJMB 3MODH 3FTGA 3H0TB 4KK9D 3VE0A 3O6KL 2FHBA 2OI9B 4HFWA 4X7EC 3SHSA 1C5DA 1CLYH 5I1JH 5I74C 5HGGS 1UWGL 3N9GH 3PWUB 4GRMB 5KG9B 4BUGA 1CD9B 4YXHH 3KYKL 1Z3GH 2ADJA 3OKDB 3QI9C 4RGNB 4UILL 2P49B 1BGXH 2AK4A 5HYQA 3TO2B 1I75A 1ZGLA 3O4LE 5HHVH 2F9BT 4UAOB 2ZSWA 2E6PA 3QCUL 5DK2A 4DCQB 4NO2A 4QRPB 1WCBB 3WS3B 4JFQB 1DBJL 1T04B 5GS1A 5I1KH 1KULA 5FDYA 4LHUG 3LB6C 1LEIB 4XMKH 15C8L 1G0DA 2CK0L 4OZGF 1G7QB 5E9DE 5FA4B 4I18A 1BWWA 3BGMA 4YBLB 4HLZH 1S9VB 1YY9D 2UUDK 1CICA 5FV2A 2Q3ZA 3ARSA 2YD4A 5T1MA 4YHML 1MRCL 2OQJB 1A1MA 5I17B 3LKOB 5HGHB 1YN7A 4ERSH 3ULUL 3JV6B 3VXNB 4AL8L 2VDKH 4HUUA 3BKJL 4LSTH 2G60L 4P3DA 5BZWB 5J57B 3QPQC 4PRHD 5TE7H 1KTRL 3EUUA 3PL6A 2JCCA 1KACB 1CLZL 3WHE1 1YC7A 1TMCB 4MD0A 5DD5H 2R56H 4HWBL 4X9FA 1MFCL 4OM1H 1NMAL 1BZ7A 1EEUA 3BRFA 4U05A 1BJ1H 3U0TB 4L5FL 2ZKHL 1KG0B 5DJCA 5GRYA 5E4IA 5KSBA 1T2QL 3GMLB 5I1GL 3TA3D 1GIGH 4ZSOE 1A14L 2C1PA 1F3JB 4XZUB 3KJ6H 5D7LD 1T1XA 5ESAA 3RWGA