4EUPH

The complex between tcr jkf6 and human class i mhc hla-a2 presenting the mart-1(27-35)(a27l) peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
241
structure length
241
Chain Sequence
KVTQSSRYLVKRTGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSYDVKMKEKGDIPEGYSVSREKKERFSLILASASTDQTSMYLCASSFLGTGVEQYFGPGTRLTVVEDLNKVFPPEVALFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSEADEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural description of how different MART-1 antigenic peptides influence JKF6 T cell receptor recognition
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 56
structure length 241
sequence length 241
chains with identical sequence J
ec nomenclature
pdb deposition date 2012-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4eupH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4eupH02
5BS0A 4JY6A 3KJ4B 3O11A 4Q6YA 4LKXA 2YN5A 1H0DA 5D1QB 5EC1A 1H3TA 4Q0XH 1KUMA 1V8HA 3FAWA 4GT7A 3HPJB 2OJZH 3J7HA 4RBPK 8CGTA 4WENB 4JRXA 5BXFB 4ZPTB 4MYWB 4ZG1A 1QLFA 3TH3T 4OFPA 3EOTH 5SWSD 2F5AH 2PTUA 3EJZD 3IDMB 3CX2A 3VMNA 1MY5A 3GHBH 3VFPA 1IZJA 3ULVC 2CK0H 4ZXBC 4PRHB 1WF5A 2R29H 2XKUA 4XPTL 1FL5B 4U3XA 5DD5H 5HI5D 2IBZY 4PTUA 1U6AH 3ARDA 4GAGL 4I0CC 2J8HA 4D0CB 4OUOA 3WXWH 3TLRA 1G0DA 5FA3A 5KSUB 5E95B 4P2OA 4ZD3H 4BH7B 3RTQD 4U6YA 3AC0A 1AI1L 2VDQH 2A6DB 2P5EB 3D2UD 4X99B 4EIGB 1G9NH 4PYHA 3K1KC 5DK2B 3MA7A 2E7MA 1A3LH 2H3NA 1ACYL 2DQFB 4MA3B 4GKZB 5DD0L 4JRYE 3ULSA 3QUKA 3L3JA 5E24E 1A64A 2AXFB 2AKRB 2YUZA 5CD3A 4P46C 4LRIC 3CLEH 1A6AA 1ES0A 3BT2H 2H8PA 1X7QB 5I8OH 1NFKA 1RURL 1X4ZA 4D2NA 3MFGB 3GSNH 5K9KA 3OZ9H 4AEIH 3P4OA 3DNKA 3HMXA 4FQXD 1KPRB 1Q9WA 3WCYA 4H25B 1CGTA 4CAGA 3OMZA 2OXGA 4Q9QH 1B9ZA 1U8OB 5GS0H 3VMPA 4QRPE 3TJEL 4WFFE 4LSQH 5IVXA 3B9KC 5D6DC 2FHBA 3BPOB 3DX6B 4OKVA 4TSBL 3U0TA 2X4PA 4BK4A 2Z0BA 1CLZL 3BSZL 1INQB 3AB0B 5BW7C 1AIFB 2ITCB 1OOAA 1PEZA 2IADA 3RWCB 1KLGB 3N1GC 2R0LL 2CMRL 3DX9A 1MEXH 3O11B 5IVZA 2Q76B 1E27B 4DKEL 5F21B 35C8H 3IDYC 3B9EA 4L9LB 3NZ8A 4KQ4H 2E6JA 4PJHA 4XPAL 4L4TE 1F11B 2FL5B 3H2WA 3HNSH 4KMLB 3UDWC 5ADOH 1W0WB 3AMLA 4WEBH 4XBPB 5CILL 1EMTL 4XMPL 1N8ZB 4J6RL 1OPGL 2APVA 1EFQA 3RWFB 1A8JH 1ZLWH 2BSSA 3T2QA 4DGYH 4OLYL 3ZE2F 4MJ5A 2OZ4H 3RY5A 3JUYA 5T1LB 2JELH 3ARFC 3KPSB 1WEJL 4Y5YA 4HF5L 2VQ1B 4JFDE 3DROB 4OF7A 4PV9B 4EQ2A 1WZMA 4ZQKA 2NQCA 2HFTA 5EU3B 5KSAC 1JK8B 3Q6FB 2C4FT 5IROC 2C7UB 2V17H 5DMYA 1MHCB 4OF0A 2W91A 3G6JF 2V7NA 1XGRA 2HVJB 4IDLA 3EHBD 2A9ML 1FV1A 3LZFH 4F58H 4WUUA 2WUBH 1GJIA 3BZFB 1JPFA 4XNUL 3SDDB 4U4BA 5BRZB 5KVEH 3BUYB 1ZHLB 1BFTA 1I4FB 2EIEA 4GAFB 4WNQB 3HCVA 4NZTH 1CDHA 1WWWX 1ZOXA 3F62A 4Y19D 3RUGE 4GXUM 4ZFGH 3RZCA 3MXVL 2IPKA 3IDYB 2B1HH 4Y1AA 1RZJL 3KVQA 2DS4A 2XG4A 1R24A 1U91B 3ZKSD 4Y2DB 3GBNL 4NKMB 1JHLL 4ISVB 2WANA 3WD5H 5HJ3A 5MHSE 2EH7L 1IT9L 5JW3H 1OAYH 1DEDA 3ULSB 4R97B 4PLJC 4KVCH 4KVNH 1OAYL 5T1KB 4PGCA 2XA8H 4WCYH 2F5BH 3WUWA 1BJ1J 2XZAL 2AEIT 4XP9L 4NC1C 1A3RH 2XN9D 1NSNL 3BQUD 1ZSDB 3PWUA 4W4NA 1AD0A 5EOCH 1JGUH 4GBXB 1T2XA 2CUHA 5C6WH 5JXEC 1R3LB 2HLAA 2IQ9H 3MRFB 1IEAA 1WAAE 5D7JD 1F13A 2FZ3A 3VDBA 3LIZH 2ZJSL 4BK5A 5KVEL 3MRGA 5D7JB 5GSRA 3L3IA 2I60H 4WI2A 1H5BA 2B1AH 2JJTA 3MROA 4FTVD 3WFDL 3I02B 5HY9B 1KB5A 3WXVH 3CVHA 3GO1H 4FQJL 3TO4D 1MCNA 3MYZA 1S9XA 3IDGB 2CLVA 1Q9OB 4LEOB 3MV01 3P73B 5SWZE 3GI8L 4Z7WF 5D6CA 2XRAH 4YDVA 4XMKL 1YMHA 4YHZL 3CDGA 3LKPA 1HOCB 4KTYA 4KMQA 5J12B 1NC4B 4O58L 3STZB 5IF0A 3MOAL 1NGWB 4G7VH 1M6OB 3LH2H 4XBGA 3LRSA 4K71C 5CGYC 4XB8A 1P2CB 3ZE1E 1HSBB 1R3HA 1CU4H 1KULA 1WBYB 1KJMB 1BBDL 1MWAL 2DYPB 3GSUB 1EO7A 3MRMA 3R06A 2WLYA 5F89B 3DECA 1ZLUH 2Q7NA 4K9EC 4ONGL 4HKBB 5C0AA 2FGWH 3B2UD 1QKZL 4UUJB 3ELAT 3U6RA 3N85H 4AL8H 1FJ1A 4R4BB 5BV7H 4OZHA 3OJVC 3QUML 1HSAA 4J3UA 4DVBA 1WC7B 4AIOA 3MRIA 4FFZH 5D2NE 1JUFB 5I1AA 2HJFB 3L3GB 4WTWA 1FVDB 5IW6A 4EDWL 4F9PA 4K3EH 4FHBD 3VCLA 3VFUB 5FGSA 4LCCB 4QEGA 4UILL 4LGRB 4I0KA 5T1LA 3P73A 3D69A 5K9QI 1JZ8A 4U6TA 4QWWC 3SOBL 1NGPL 3S7GA 3WIHH 1AGDB 4C56E 1FLRH 1YN7A 2GSGB 3PJSA 2YRLA 1OAZL 5I19H 4ZDHB 1JFQL 3AREC 5ITBL 3DGGB 4YDJB 3QUYA 3ULVH 3MNZA 4AT6A 5C07A 1KTDB 4HGMA 3RVWD 4WGWB 1JTTA 1V3JA 4M6OL 1I7ZA 2J6EH 1U8IA 5D1ZC 1ONQA 2WIIB 4IOIA 5DHYA 5T3XE 2YMXH 4I3SH 2UWEA 5AEAA 2FSEB 3IDNA 1MFAL 5DVNA 5I66A 1INEH 1W72A 2YPVL 3EDKA 4BQCA 1KB9J 4JHZA 2FCBA 2JJVA 1H8SA 3QUXA 5L9DL 5HI3C 3EDEA 1LDSA 3WFHA 3X11A 4NUJA 5I16B 5L6YL 2XZCL 1T2QH 4ZUVB 3WN5C 1FGVH 2AS5M 4PRAB 3LKRA 4FQCL 1F3DJ 4FZEL 1DQMH 1U91A 4CGTA 5HDOA 4X5WA 3RX5A 4MDJA 5LGHL 5MEQB 5F7KC 1IMHC 1HHIB 3BIKA 1OAXL 1T0MB 2EC9U 4PY7B 1QRNA 4XTRD 2LTQC 2KUTA 3NCYS 1F4YH 1SVCP 1DLHA 4AEHH 4JRYB 4IRJD 1G7IB 3L9RB 4GS7B 5KVDL 3IS0X 3V8OA 5KZCD 3CFJB 1BVKB 5CGTA 4YFLI 4F7EA 3BN9D 2E6QA 4RWYL 5T3XH 1UC6A 1OWRM 1LDPH 2Q8BL 4MB4A 1H15A 3QUKB 2ARWA 1NCDH 2X1XR 1I8KA 1ETZB 2XTLA 2FDBP 4JQVA 3D0LA 4OLZH 3MLVH 2SEBB 1F45A 3ALXA 5H37G 3T0XA 1JNHB 4EDXB 1VFAB 1JK8A 2WWMD 1LO4H 3O3UN 2X7LA 1KEGL 4ZUVA 3VCLB 5CIPB 4Z7UF 3VDAA 4XP6L 1RZIA 1CDJA 3JWDH 2A74B 1D5BB 3RRQA 1R5IA 2BCKB 3BKCH 5KVGL 5KVMC 4UI2A 1DVFB 1FG2B 2X1PA 2QHLA 3U4BH 5F7NC 4X5LA 5KVFH 1CYGA 4DW2H 4NNXA 3NVQA 1NL0H 4XBEL 1FHGA 2BOBB 2BDNH 2DQJL 1KLUA 4MA1C 5EU6E 4U1JB 4FABH 5C07B 1FBIL 3LSOA 3JVGC 1AJ7H 1PZ5B 1R3HB 3C60B 5HGBB 5TQ0L 4PB9L 3HE7C 5C0JB 1AKJD 4M5ZH 3RIFK 2DF3A 5IJVA 1KIUA 1XCTB 4DEPC 3QDJA 5CWSA 3CDGB 3LKPB 1K4CB 4OCMC 5AAWA 3D69B 1CDUA 3CVHH 3U7WL 3BHBB 4KK9D 2VZOA 1IZKA 3BZEB 2YZ8A 1OTTD 2QEJA 3U0PA 1LE5A 5IR1A 1MPAL 4UIKH 1PD6A 4S10A 1HEZA 3VRJA 3MA9H 2BVOA 2XZZA 3CFCH 2BNUA 3CX5K 4JM4H 4UOW1 5E56A 2JCCE 4QYOA 4Z7VF 3JV4A 1OP5K 3DYPA 3KPRB 1HI6B 3CCHA 5CP3H 4P5MB 3RDTB 1BP3B 4DW2L 3QB7C 1S8DA 3M8OL 4R26H 5F70A 3CXHK 3E6HB 2ID5A 1AC0A 1X44A 2VAAB 3VXRD 2NY0D 1YEFH 2VH5H 4OD2A 3RWJA 3WL9A 5D1ZA 5DJ6A 4UT9H 1YNTA 2EXYC 5KVGH 5EUOF 1IVLA 3B3IB 4LGSB 4LIQE 1NL0L 4XBEH 5ESQB 3MCLL 4MCYB 5F7UA 4LSPH 1IKFL 3JXAA 2ZKHH 1PG7H 2QKIB 3DETD 3VH8B 4PJCF 4PBVC 5JMOC 3U30C 2B4CH 1TMCB 5JIKA 5EPMB 3VXOB 3D9AH 2I5YL 3IFOA 3L3HB 2VE6A 3SKJH 2DQFA 3IU4H 4MA3A 5E8DL 5IFAL 5TE6H 3MYJA 4MHHI 4M9PA 4LBEA 2BHZA 1VFAA 2ZUTA 1F97A 1S9XB 3IDGA 3PWPD 3O4LE 4Y4HB 2OSLA 1P53A 5INDB 3U30B 4OI7A 2WWKT 3MA9L 2NY7H 3NIDF 2OR7A 2EIZA 4NJ9L 1BLNB 3DHMA 2XTJC 4YK4C 3EO0B 3EYFB 3HMXH 1WFTA 3DOSA 1JFQH 5ITBH 2VDKH 3IFPA 1QPPA 1B2WH 2Y9RT 4BYHA 4PRHA 4MD4A 2ED7A 3HNVL 3PL6A 4HX1A 1RQ5A 1LD9B 1T1ZB 3C2AH 4LLVB 3VFMB 3GGWB 2NXYB 3TBVA 1MCQA 4GKNB 7CGTA 1DQML 4K3EL 5DRNB 5ABDE 1ZWIB 2X4QB 3VFVB 3SDXF 1FGVL 3QEUA 2PYEE 4W6XB 3ZYJA 4KK6C 2DLIA 4MHHG 1Q0YH 4FMKA 4JQIH 3DXAD 5BZWB 4JM4L 1QEWA 5D7LB 3ABZA 3N50A 4LKXB 3FFCD 5E1HB 5IEKA 5AWNH 5C08A 1RVFL 5DSCB 3QXTA 1I8LA 1S7SA 5ALBL 2VZVA 3CXDH 4XP5H 5ESVA 5J3HC 5F8QC 4G7VL 5HYFA 4NNPH 5KSBE 3G9VA 3IRZA 4HG4J 5B38G 2X09A 3S3PA 2ICEB 4NM4H 3GM0A 3I6GB 5EOTA 1CGUA 5GGRA 1SQ2N 2XKNA 4X6FB 4ZFZB 2PR4H 3BGMB 3BXNB 3QNZA 3DI3B 2R0ZL 4FQXC 1VPOH 3O3EA 4P2OD 5FAAA 4G6AC 4H0GA 4Z76B 3QSKB 5ERWB 1XF5B 4F33A 4WV1B 1BQHB 1RMFL 2HRLA 5FF6A 4J4PD 5IIEA 3TIDA 2E7LA 3MBXH 4M7KH 5C0GA 3ZT6A 3QR2A 2VXVL 4RAVB 3B2UC 4M03A 1RZGB 5DI8A 1VGEH 3DX7B 3BOVA 4UDTB 5ACZB 3I3DA 4PGDB 2ADGB 4PJXA 4BKLA 2WQRA 2Y25A 2CRMA 4XBPA 5DK0A 2XWTA 3UZVB 4EBQL 3VXNB 3X12B 4PRPB 3MLZH 5EIIB 1I3GH 4HCRA 5F7HA 4OFIA 4M1GH 2AJVH 1MFAH 3UO1H 1QBLH 3INUH 1NAMA 2P47B 2VNCA 3OKKB 4NQDE 1EEZB 1LO0H 2DBLH 4OGXH 4F80A 5E4IA 3FB6B 3C8KB 3FMGH 1HYRC 3MNWB 1CIDA 5FECA 5EB9A 5F72S 1NAMH 2CJUL 4KTEL 4YXKH 2MPAH 3O81A 3MV8B 3QFJE 4KJQD 3MLSH 3HC3H 5DJCB 1CE1H 3BE1H 4HWZB 4XCEB 1AGCA 3T0EA 4N1HB 3U48A 4FFYL 2IGFH 5HJ3B 3BH8A 4LQFL 4M6MH 2V2TA 1KT2A 1FYTB 4IM8A 4U1MB 4FXKB 1YA5A 1RV6X 1YMME 5H2BA 4NQDD 3TNNB 2OQJB 3VXSD 4H0IA 4MJ4A 1A47A 2UZXB 1URLA 3GGWA 2HKHH 1DUYB 5FXCH 3QDJD 2CRYA 2XQYG 3UDWA 2D31A 4U49A 3S5LA 4PJ5B 1D5XB 4IIQB 3ROOA 2AEWA 2CD0A 5ID0B 4HD9A 3P0YL 2X9XA 3BJLA 3VD4A 2IBZX 4HF5H 3ZDXF 5DVLA 4GAYB 3RTQC 1WEJH 3L3OB 3GSXA 5GQBA 2JELL 2V5YA 4F7TB 4XP9H 1L4IA 1CFSB 1CGWA 4TVPH 5C0DB 3RDTD 3F5WB 2B1HL 2E8YA 3FT2A 5KSUA 2EDNA 4HKZA 4KPHL 5L2KA 1E4KA 3EYSL 2LTQB 1TCRB 4KJYA 4OD3H 4Y1AB 3OKLA 1EVTC 2AABH 4MQSB 1LO5A 5EPMA 3FRUB 3GMPB 4LSUL 1PLGH 3QEQE 4B50A 1E6OH 1FNEB 1BJ8A 3IB4A 2HTLC 1PSKL 2X4SA 1W2KT 1CL7L 5GPRA 2CDGA 4Y16D 3WXVL 2ADGA 4ZS6C 4HWUA 4PJAA 2VKXA 3QZWB 4C56A 4JDZB 4Y4KB 2FO4A 4RFEA 2X4TA 4WW1A 3MRBB 3RNKA 3WNNA 1JF1A 1DQDH 2UYLB 3DVNB 4TRPL 4Y16B 3WL9B 1GYAA 2V2WB 4S1RH 1NAML 2CJUH 4YXKL 4BSWA 3PUCA 4KROC 4ZXBA 1W0WA 4ZAKC 3C5ZC 2GK0B 2E7LC 1S7WA 2A9MH 5GGSB 2QQQA 3GRWA 3WIHA 2H2PD 1EK3A 1BPVA 1LO3H 1WC7A 1GRWA 1MQ8A 5FCUH 5ISZB 3QEQA 4DZ8B 4LFHG 2A6IA 3K4ZA 2H1PL 2F5BL 1U95B 4UIMA 4OCNC 3PHSA 5LQBH 4PJGA 5CEZD 1AIFA 2ITCA 3MQIA 1AGEB 3TV3H 1RURH 5F3BB 3QBTB 4G8GD 4GQPH 3P77B 4R6UA 3PNWA 2EXWD 5ICZB 5BRZD 1U8IB 1IL1B 1EVUA 5T5NF 5F9DC 4X80H 4ZFZA 5LGJB 1KIPA 5KSBA 4M4RA 1BVLA 4X7TA 3LKQB 3QHTC 1NEZB 4KI5E 1RUAH 2YA2A 1T21A 1F4XH 4CDHA 5GS1B 4JM2B 2BJMH 3U7YH 1AR1C 1IJ9A 5FOJA 3PWPE 3IAQA 2D0HA 3C6LA 4PS4L 5D6CB 5CZXC 2NXYC 2VABB 4DKAA 3OX8B 2ZNXA 4LSVL 1CLZH 4LEXL 2I07B 4KQ4L 4HZAA 2XOTA 2AKRA 5CD3B 2VXTH 4XNZC 3IVKB 3AAZA 4K3HA 5B39A 3L3OA 4HFWA 1EO8L 3WS6A 3KJ6H 1T3FB 4GMSH 3VFSA 1S7QB 4DCQB 4YDIH 4H8WH 2EE6A 3T08A 2YSSB 2Z93A 2ADIA 5T1LD 3X17A 5DT1L 1NCTA 5E6ID 4DGVL 4W4OC 4PBWD 1JPTH 4FFWC 1FAKT 3TT1H 1OGTB 1QBMH 4OIBA 3RVUC 4LLYA 2W9EH 2DQIL 2IMNA 4M93B 3B8YA 3KPMB 3L3JB 3QUXC 4X8JB 1J8HB 5JPMA 2BC4B 2VITA 2YXMA 5DJCA 3M17B 3TWCH 5CJQL 4PY8I 2OJEA 4Q9BA 4P48A 4D9RD 5L2KD 3EO9H 4IOFC 2MFNA 3A6BL 4Y88A 4R2GB 2A9NL 2EDEA 3GKZA 1SMAA 4XPFH 5E9DB 4UZGA 2X4OA 4O2FB 3VFWA 5FDWA 1T1XA 4MAYA 4HGWB 3ZKMC 4JHAL 4L8SC 3MUZ1 1IAKA 2PYEB 3B5GA 1MF2L 5KTEH 1QNZH 4AG4H 1FVEB 3FONB 3HN3A 3VGEA 3QQNA 1X5LA 1G7PA 2AJSL 2CIKB 4HSQA 3UEZA 1KV3A 3OGCA 3QH3B 4XX1E 2GY7B 1CFBA 2V7NB 2HT2D 1MLBB 2Z92A 2COQA 5ANME 4R4FH 1A6TB 3KPRA 4J6RH 4WO4B 1SY6A 3V6OA 4LRNH 1LK2A 5JW4M 4OGAC 3SE8L 1FZJB 3SKJL 3SJVB 4PJDB 2DI7A 3VG0L 3QUZB 5LGKA 3LN5B 3VFTB 1NDMA 4DKEH 1GZQB 2P8MA 3HR5B 1MCPH 5E99H 3LPWA 2GT9A 4PJ7B 1OAQH 3IU3A 1BIIA 4LCWD 5HGAA 3DPBA 2EKSA 3KPPA 1S7RB 3IYLW 3QQ4A 4M02A 2L7UA 2EDOA 2X9WA 1MFCH 5DYOB 1G9NL 1MJUL 2QHRH 4Z5RA 3MLYH 4R26L 5HGGS 5KSVA 1U92A 5CGYD 2BMKA 1WGOA 2DMCA 4LVOB 5E03A 3GJEA 1KCKA 4NFDA 4KTDH 1AXTL 2N7BA 4G43A 5CFHA 1WAAA 3FT4A 4PJCE 1CCZA 1EO5A 1U6AL 4GAGH 5I8EB 3RBSA 3K0WA 3RWGA 4P46B 1F4WH 1BJMA 3BX7C 4QHKJ 4N0RA 3VXPB 3REWA 2R29L 4XPTH 1XF1A 4OTXL 3S36L 1N0XH 2DD8H 2H2PC 4ZUTA 3TESA 4WWKD 1FCCA 3MOBL 2ENSA 5FHAH 1MRCH 4L4VB 3V6ZA 2NXZB 1OM3H 1K5NA 4PLNC 3QI9A 3SY0A 5HYQB 2A6JA 2VR5A 3WJLA 5A43C 1CDGA 2PN5A 5GS0D 2SEBA 4HUKB 1D6VH 4R8WL 1IM9D 3HE6D 1TZHA 2CKBB 1GZPA 4P2YA 1ETZA 1I9EA 1VFMA 5EBGA 4PG2C 2YPLE 4LSSH 3UBXB 5JOPD 2QLVB 5HHMB 1BD2B 3N9GH 2F54A 4J3WA 4BZ1L 1TJHH 4PLOB 2HA1A 5ITFB 1QVOA 4M1DL 5JW5B 5C0NC 5DYOA 1UXSA 1QLRB 4G80B 3PWLA 5CZXD 1BD2D 4N5ED 4Z18A 1QSVA 1X3DA 4D9QE 4KKBC 4U7KA 3SDAB 5TDNB 4EQ3A 4GRLC 3SJVE 3TT1L 4N0YH 4NM8L 4I3RH 5EU6B 4F57L 1S9WA 3QNYA 4OCWH 5CLTA 5EULV 4JR9H 5CEXB 5BMFH 5JOFB 4YX2L 5IBTL 4BJLA 4K7PH 2GUOA 1T3FA 3DTXA 4KV5E 4MQTB 3P9MB 4WO4A 4PGCB 4MCZA 1AD9B 3STLA 5TGBB 1EO8H 2D03L 1RUML 2CIIB 2CLRB 4QRRA 5EZOL 4OLUH 3DV4A 3QULA 2I9TA 2EC8A 2P8PA 1T0NB 4ZUUA 2KZ1B 4HJJH 4CBPA 1NGYB 3O2VH 1NMAL 1T1YA 4MA7L 3Q3GA 5HHNB 3CFEB 4PGEA 3QPXL 5ESQA 4Y19B 4JPIA 1TITA 1CBVH 1UYWH 4TNVK 4H20H 4W81A 5DEFB 4I18A 3BUTA 2PW2B 3N9GL 1QSFB 5CUSL 4GRMA 4NCC2 5D72H 3T4YB 5LBSL 5E8OA 2ATKA 2CH8A 3NCYP 2FYYA 5KSAA 5LKNA 2CKBL 2Z31D 5C0FA 4OF5A 1WT5C 4NJAH 5ANMB 3I85A 4HMDA 4JQXC 2NLJA 1OM3L 2APXA 4MXWH 2VL4A 1VB9A 4UTBH 3TPKA 4JCMA 3NACH 5FKAB 2CRZA 3RL1B 2L7JA 5FO9A 4G6ML 5I1JL 4GW1A 4JLRA 1AHWC 2H1PH 2FHFA 4L8SB 4O51A 3OAZH 4YIQA 1K3IA 4APQB 1K8DA 1I7UA 2AXGB 3U6RB 4IHOB 2Z93B 3W0WE 5J6GB 3ARFD 3MLYL 3SN6N 1BD2A 3CSBA 1ORSB 1Z3GH 4E0RA 5K93A 4IS6B 3HZMA 4P2RA 3ZZ1A 4M7LT 2P1YA 2EDTA 1ZXQA 4XBGB 2DTSA 3NPSC 4NO0D 3HE7A 4PJEA 3W2DH 4H26A 4PP1C 5C9KA 3HI1B 3H3BC 2P24A 5E08L 5F1OB 3BWAA 4TULH 1P1ZB 4MGXA 4LHUG 1YMHB 4WHYG 1O7VA 3QUXD 5L7XL 1T20A 2VDRH 3TYGH 3NTCL 3HFML 1UADC 4K2UL 1FL3A 1PGRB 1QBML 2HT3C 4OLXL 1KEML 4G3YH 3QDAA 3N85L 1FO0L 4XPGL 4KPHH 3CVIH 4W6WB 2BHYA 5D1ZD 1NFDE 3CIQA 1BZ7A 3PDOB 1P5UA 5DFVC 3SKUD 4XWGL 2ZCHH 1XGTA 2NY6B 4NCC1 3G5YB 3F58L 1G6RH 3DRQB 4U6XA 2DM7A 4YHLH 4I18B 3CFJA 4LIQH 3H9SA 1I85C 3VH8G 5CEZL 1BMGA 5DJYA 1T66C 5KOVC 1VGKA 2EDXA 2EYTA 4JVUA 3J8F7 3EO9L 5E4EB 3UTSA 3U36B 1T83C 3EYOA 3WV0A 4PS4H 3TWCL 1AD9A 3STLB 3P30L 3QWQB 3HR6A 4M6ML 5B38A 1S7TB 1EJOL 4TRPH 4GKNA 4EDXA 4I0PD 4F7PA 4YDLB 4DQOL 2DQEL 1FNAA 4GKSA 5T3ZE 3LIZL 3TN0A 1JPTL 3JWOH 1CL7H 3UPRB 4TTGA 1UA6H 5FA3B 4DOHB 1RHHB 3QISA 1UJ3B 4YQXL 3SE3C 1NDGB 1VADA 5EOCL 3FCTB 3MJ6A 4GFTB 2CGRH 1B4JH 2A83B 1QBLL 3MUY1 15C8L 2VXQH 4MAYB 3OR7B 1ZVSA 4OFYA 4J3SA 1DLHB 3DGGA 2NXZD 2DTMH 3QPQD 4YDJA 3OB8A 3G5ZB 2Q86B 2FX9H 4MAYD 2VR4A 2CLZB 3FZUC 3K81A 2G2RA 4IMKC 4ODWA 3BRGC 3G9AB 3ULUD 2CIIA 4GXVL 2JB5H 3MXWL 5DJDB 2XIDA 3IFOB 3RWEB 1DEEA 4OZIF 3B9KD 2DLHA 1DL7L 5D7KE 1HXMA 2DJ4A 3ZMRA 1JWSA 3W5MA 4O5LL 5IQ9B 2NZIA 4LLAA 2EDRA 4MD0B 1XF2B 4ETYA 1MCOH 5ESAB 5DJ6B 1XIWB 3RWDB 1MJ8L 4WV1A 2OI9C 1GSMA 1T2JA 2FECI 3WUZA 3JWOL 1A7OH 1U41A 3LPFA 4U2ZA 3EYSH 4X9IA 3RDTA 3QJHB 1YQVL 3MOQA 4C54A 1OP9A 3H9SD 3T3PF 3BISA 4PUBH 5FA4A 5EU4B 2FEDC 1UVQB 5EBWA 2JLLA 2R8SH 1NFDF 1RIUH 4JO2H 1T04B 4QRUB 5SV3A 1KC5L 3QZWG 1XGUB 5JIPA 1E27A 5TE4H 4HS6A 3K8KA 3VGHA 1JGVH 2W65A 3CSPA 3EO1B 3WS3A 3CJJA 4NN7B 1EV2E 3WLWD 4OB5L 4NYLB 3OAZK 1EHXA 5DJXB 1A7PH 4HV8A 1FNLA 3SJVA 1FYTD 32C2B 3GKWH 3O2WL 3REWB 2QQKL 2WBJD 4E41D 4O2CB 3V6FA 1HSAB 2Y6SD 4KJWC 2WW8A 4S2SB 4I2XB 2JIXD 3L7EA 3VU2A 4I48B 2ZCHL 3VFRA 4EXPX 4WTZA 2E9BA 1UGNA 2HN7A 4Y8DC 1BM3H 4JFDB 4POUB 2V5SA 5CSBA 3UAJC 1IC5H 4PJCA 1D5BA 5IFJB 1CE6B 1GHFH 1H3VA 3BZ4A 2LVCA 2AJ3B 4ZFOB 2JJWA 1I7UB 4ZOBA 1EAJA 2MQ3A 2NMSA 1SMOA 4NQEB 4D0DB 2DWDA 4KKAD 3C09B 3T0BA 3BSZH 4L4TA 1HOCA 4F33B 1U58A 4I18C 4I0PA 4J4PA 3HMXL 2H26B 5E94A 3UO1L 5E9DD 4JEGB 3O6KL 4UQ3A 4ZXBB 1F58L 3BW9A 3RPIB 4CVUA 3BXNA 1TTGA 4NSKA 1BAFL 2FBJL 4WW1B 1JNNH 2VITB 1CK0L 1U3JA 3ULVF 4NP4L 4HG4K 1HILB 2NW2B 4OZFB 4HAFA 5E8DH 1G1YA 5GSVB 5C0IB 1EBPA 3FFCB 3MRNB 1QFWL 43CAB 1IFHH 3PHOA 4XVJH 4XCCH 12E8L 3TN0B 3LKSB 4OFDA 4ELMA 5ACMA 3DO7B 3JWNC 4FFYH 2H41A 3S8WA 4OLVL 2BXYA 1DFBL 1J87A 5EBLA 3RVVD 2HRPH 2Z8RA 3BZFA 1NH6A 2LQRA 4K8RH 3VFSB 1CGVA 4QXWA 3ZTNH 2VAAA 3CFBA 4Y4HD 1S8DB 4QOKD 3O3AB 4XP1H 2XFXB 4L4TB 5GRWA 5HPMB 5E2WH 3QG6B 2PYFA 3O6MH 4PFEA 3RQ3A 4R4NC 2EYRB 2VDLL 3GJFB 4JAMB 1MCWW 4X8JA 4LVNC 5GZOD 2VL5B 1S7XA 2ICES 4Y5VC 3REVB 2VLRE 5BVPL 4RISL 1PYWB 5DQ9B 1JZ7A 1YEJH 4HIJA 3G5YA 4NO0A 3CXDL 4XP5L 2P5EE 3RU8H 2AJUL 3QIBB 2H9GA 3GMQB 3E3QE 3O2VL 3O4LB 4MMXC 3HAEB 1DQQA 4ZPVB 3KYKH 8FABA 3V7AE 4NO2B 1OW0C 1BZ7B 5D2LF 4U0RC 5JW5A 3GBLA 4MVBC 1UXSB 2NY7L 5AYQA 2YSSA 2X4NB 3SPVA 4GG8B 4P99A 4CDGC 2AEQL 4PJ8B 5B39G 1AFVH 1AO7D 3BJ91 5CIPH 1I8MA 4P2QD 3PP4L 4MA1B 2QQNL 1NLDH 3OKOA 4Y1AD 4ALAL 5HVHC 2K7QA 4ENED 1ZGLP 1E4WL 5D1QC 2ZKHL 5C71A 2OS7A 1G84A 2DI9A 2W38A 4ZUTB 4QXUL 4HK0A 2AJYL 3NCFB 2FLRT 4AYFA 5JTWA 4P4KB 1FZOA 3HHRB 6FABL 3MRQB 4NJ9H 1LVEA 4X6CF 1UEYA 3OBAA 2J8UE 3SDAD 5HHME 3F7RA 3MV7D 2BMKB 1N8ZA 2AXGA 3KYAA 3HAEA 4JZOB 4ZNEE 1KIPB 5J6GA 5IJKC 4JPKL 3LEXA 1QLEL 4ZUSB 1CR9L 1OGAE 3SGDI 2IF7A 4U7MA 5J13B 4HHAB 5C1MB 3WNKA 4U3HA 5T1MA 4MXVE 1YEIH 1Q0YL 3MRLA 3LV3A 5GGUB 4K8RC 2ED9A 2IAMB 3MRHA 2Y6SC 3KXFB 5HGHB 4NFCA 4UT6H 4P49A 4G8EB 1JJUA 5DMIH 2EDWA 3O3DA 1ZA3A 1O7SA 4PJIA 1LK3L 4P9HL 4FN0A 4OJFH 3VE0B 3MJ8B 1CI5A 4OIAA 4WHTA 2W9DH 4MJIE 4NHUA 2G75B 2NNAB 4XNYH 1MFCL 1X4YA 3UTQA 5GGRY 2OK0L 2FX7H 3DX8A 5HD8D 2NW3B 3TBWA 4KY1H 1ZLSH 3OPZH 1FNEA 4WUKL 4M61A 3EFFB 4WO4D 3VXRB 4JZNB 1INEL 2YPVH 3CFEA 4PGEB 4NWUH 1DN2A 3KLDA 3HI5H 1CGSL 5BQ7A 1ZEAH 1DCLA 2VAJA 1CDYA 3WJJA 1AGCB 4KK8C 3SE8H 5IFAH 4NKMA 1Y6KR 2CK2A 3PV6B 2H3NB 3QIUB 3V79C 1CFNB 1G9MH 4QHNA 5E2VL 1GOGA 5EU6A 1BFOA 3TP4A 3M17A 3TBYB 3VXSB 4QTIL 2Y06H 5F1NA 1CG9B 1H15B 1HNFA 2NY2D 1HZHH 3TA3B 3MACL 1NAMB 2BERA 4QRSA 3EYUH 1ZA6B 5HI3D 3Q48A 1UB5A 3SDAA 5IVXF 4JFOB 4U1KB 4L9DA 2ZSWA 3V5KB 3FZUD 2VDML 4NQED 3R8QA 2D4DA 1P7QA 4DK6A 4KAQH 2F19L 2P46B 1AQKH 2F58H 4LARL 4H1LG 2R1XB 3ECBB 1TQBC 1QSED 1KT2B 3UX9B 3RVXC 5GGVH 5J9PA 3B83A 1MPAH 4UIKL 5I9QB 4JQXA 2R0KH 3W9EA 3TNMA 5DJ2B 4PJHF 1OLLA 4B41A 3SE3A 1GL4B 1YEJL 1DDHA 2FWOB 3BWAB 4HUMB 2NY5H 3RKDD 3T4AB 3X3FL 2X6MA 5DXWA 4XAKD 2K1MA 3QA3A 5D1QA 4QWWD 4G5ZH 3BIAX 4QY8A 1X5AA 4DGVH 3QHFL 2VDLH 3T8XA 3DXAB 4QRTA 5C0RL 3TVMB 5BJTA 5HVGB 5FYLL 5KVDH 3T65B 2Y1VA 3B8SA 1RK1A 2X4NA 5TE7H 4TSCH 4EI5B 4M48L 1D9KD 3U4BL 3CH1B 2DQGL 4BFGA 1GC1L 1DSFL 1F11A 3NBNA 3SDXB 4U6HB 1VFBB 4K8RL 4XC3L 5D2LE 4G9FA 3VD7A 5LCVL 4Z5RB 2QJDA 2BVOB 3NIFE 5AG9A 4L3AA 1F3RB 2DLFL 2ZJSH 2PNDA 4K7FA 4KFZC 5A16A 2A6IB 2UY7A 1F90H 3PWUB 3P3YA 4WI9A 2J12B 1YECL 3U0WL 1IQWH 1WFUA 3NFPB 4CVZB 4XVSL 4AQOA 5FUOH 2UVEA 5F8RC 4UV7L 2Q7YB 4S0TD 2AK1H 2HP4A 3HRZB 4LU5H 3S96B 5GS0C 2V2WA 3E8UH 4BSWB 3TZVB 2E7BA 3ULVL 1N26A 3WLBB 3O4OB 2IFGA 4PP2B 5I2IB 1RZ8B 4QRQA 5DMGD 3EDFA 4X98B 2ORBH 1FLRL 3PXJA 2QR0B 4QGYA 2X40A 3FO1B 1MCCA 5SWZB 3BPCA 4L1HA 2P8PB 1OB1A 4NN7C 2PUQT 4JFXA 1I1AA 5DZOA 2XXMB 3BEWB 5EO9A 4IRSD 4CVXA 4YDVB 3UC0L 2FJFA 2LE9A 1KF9B 4Q6IB 1VADB 1ROWA 2EIZB 4HIEB 4EN3D 4LOUC 4JPIB 3AS3A 3QXWA 1FP5A 1BREA 4BH7A 3QUMH 1QEWB 4G7YL 1GXEA 3UBXG 3MRHB 3MJ7B 5D70H 5I1KH 5HPOA 2B1AL 3WHXA 1DBAL 3ZKXB 2RIKA 5KJRL 1Z9SA 3MRGB 5JZ7C 5DRWB 3FB5B 3TBSA 1KELH 1FVCA 3FJTA 1VGKB 4OLWH 4HHAA 2NX5A 1R3JA 5DMJB 3S5LB 5D7IE 3NAAL 4JGJA 4PJ5A 3EYOB 4F7MB 1OAUH 3H9SB 3LH2L 4KZDH 5ITFA 3MRRB 4I4WA 3L5XL 5C8JA 3LVEA 2DKSA 4EUPB 3GMRB 4D3CL 4Y1AE 1NFIA 4Z7WA 1W8OA 5D71L 4I2XA 1EEYA 5CLWA 4M7ZB 3GO1L 4HLZG 1S5IL 5FO7A 4GRWE 3P4NA 1XGTB 2P45B 3O8XB 2VDNH 4HBCL 2CO7B 2EEBA 3EHBC 2W0LA 4P46D 1BOGA 1FFNB 2Z91A 4LPCA 3PWJB 5IHZA 2R2EB 1G9EA 5F96L 2QADB 2YD7A 2A6JB 3SCMD 2CMRH 2NY6D 2FSEA 1KCLA 4OCLC 3JTSB 1OGAD 1QSEA 2HFFA 5L0QC 1KCSH 3CPLA 3IDIB 4TNWK 5K9QG 2IALA 3X12A 3TCXA 2WUBL 4WCYL 1L6ZA 2Y72A 2M2DA 3Q5TA 5I1GH 4PJBF 4XVUC 3G6JE 4XB7A 5D71H 2CRIA 2EKSB 5HYJB 4KKNA 2D7PA 4K71B 1ZHKB 4PJBB 4M6AA 4YAQB 2Z8SA 4YIQB 5CBAB 1U92B 1NDMB 1AGEA 4OZGB 4YHNB 4ELMF 3MV8E 4HWEH 4OZFH 1QOKA 4PV9A 5I30L 1NQBA 3KNBA 1EZVX 4A6YB 3RL1A 3INUL 4B53A 1KELL 5LVEA 3H6JA 5MP6L 5DJDA 4N90D 1QO3B 1MLBA 2Z92B 4GO6B 5F1SA 1C5DA 5F89A 1B3JA 4NT6A 3G5ZA 4MWFB 5F7DA 4JY4A 1DUZB 2VYRE 3MRJB 4XCFH 3ARVA 4NO2A 1K4DA 4KMTH 1FO0A 1HYSC 4HKXB 3RPKA 4PR5B 4DVRL 3MBXL 4YNYB 4BSJA 5B3JE 4JO3H 5KSAD 4NDMA 5CCKH 43C9B 2Z8VC 3TF7C 2VDNL 2ZOLB 4N5UA 3HC0B 5D5MB 2IPTH 4G6JH 3QCTH 5D7LA 5DLML 5F9WB 1CN4A 5J11B 4GLRI 3D3VA 5C9JA 3R4DA 1EEYB 5C0BB 2YD2A 3O0RL 4WW2F 5E2VH 1JL8A 4YHOL 1G9ML 5BOZG 1I7TA 2Z4QA 2IAMA 4D0DA 3MNVA 5ADOL 5GHWL 4KDVA 1JIBA 3TYFA 3DUSA 1ORQB 4MS8D 3L5HA 1J1XH 3BZ4B 2F74B 2HLAB 4OGYL 3ZKXC 4XNUH 3S3JA 1OQOA 4U6XB 3DYMA 2PXYC 1D6EB 1DQJA 3I9GH 1OSPH 1A6UL 4HUWB 4KKBD 3K8MA 4JZOA 3GSQA 1K6QL 3GK8H 3Q6GH 4X6CA 3NIDE 1AQKL 4FQXB 2YKLL 4G8FB 4Q9CA 5IT2L 1YMMD 2NY1C 2HMID 1JV5B 3AREA 3IS1X 4RQQB 1TQCB 4NSKB 3MLUL 3C6SB 1J1PH 3UTTE 2VRAA 3GSWB 4EXKA 3WXWL 1G1CA 1NC4D 5FYKL 5I71B 4YPGB 4S1SL 25C8H 2VXUH 1V7NH 2NY3B 4HS6B 3HCVB 3T2NL 2YR3A 3HE6A 5IEHA 3LMJH 4H26B 4MCYA 5GRVL 5KANG 4L8DB 4UTBL 1IILE 1I8MB 3E6FB 1EHNA 5EIIA 3HZMB 4PJIF 1MHEA 2DYPA 5TH2B 2R2HB 4NHCH 1GC1C 1Q72L 2A1WH 3GUTA 1J10A 1DZBA 4PGJA 2NYYD 5GZND 2JTDA 3HUJE 4IHOA 4S2SA 5FDYA 5CS7A 4ZO7A 3KPOA 5D7LE 1IQWL 3O4LA 5E8PB 2E8ZA 1FE8H 3AY4C 4Q0XL 1NC2B 1Q0XL 2XQBL 4L8SA 4O51B 3VXRE 4WJ5A 5ERWA 1HHKB 5HBBA 3MUHL 4LCCA 3VFUA 5A3ID 1HXMB 1L9MA 4MQXC 3F7VB 2CLVB 5FOBA 3MV9E 4OLUL 4LSDA 1LK3H 4JKWA 5IOPA 4QOKA 4ZFFA 5JQHC 3I3EA 4UT6L 3K80A 1L9NA 3V7AG 5GGSA 3LKNA 1RAMA 3C60A 5C0JA 5D7LD 2APFA 4MNGA 1IBGL 4YE4L 4TVPD 5GGRB 1MVUA 3W82A 4FTVB 4YGAB 3ZO0A 4WVRA 1MHEB 2VC2L 2EDYA 2N1KA 3OL2A 1HHHA 1IGTB 3EBAA 5CEZE 4JFEB 2WSKA 4WUKH 3WKML 2GCYA 1ZLSL 4GBXA 4LLMB 1KJ3H 4MAUH 3VD9A 1I7RB 1HINL 4JRWA 4M7JL 4PJ7F 4DFHA 1U0QA 5DSCA 4GOSA 5J8OA 3MLXL 4XWOD 3IJHB 1LE9A 5DJZB 1AI1H 2VDQL 5CIPA 3P0VH 3TNMB 5JOEA 4TVPE 5EFIA 1B6DA 4JFEE 5E9DA 1JNHA 5EORL 4PY8J 4FQIH 5F7EL 1T1ZA 4LLVA 5JO5B 3RDTC 4TVSa 1NGQH 1MIMH 1MFEL 1S9WB 4ODSH 1NJ9A 4DAGH 5DJYB 4FTVE 3V6BR 1AE6H 4LPVA 3EYUL 3T77B 2DDQL 2A0LC 5FV2A 1LHZA 5TFSL 1ZHLA 3EOTL 3QHZH 4ZAKD 1Z0NA 4Y4FA 3TA3A 1JF5A 4IBLT 1HH6A 1R3LA 3SGDH 3PHQB 4G8IA 3X13B 2APTA 1BFOB 3MV9B 5EDXA 5F7DB 3VFNA 3WFZA 3DIFB 3U7AA 1OW0A 1J18A 1MREH 3VFRB 5BS0E 4IMKA 2C1OA 4NWTH 5INDA 4K94L 3GSOA 4PJ9C 4Z6AT 4O2CA 2OTWB 3TH2T 3DSNA 4PV8A 3GHEH 4HC1H 1EFXD 5DGQA 3X11B 4DKFH 1R24B 3L7FB 4XCYB 3NCJL 1ZT1A 5D1XD 3H0TB 5C07E 4NZRL 1BGXL 1HHGA 2EXYD 1K85A 4XH2B 3ARZA 5JUEH 2C1PB 3HZKA 2FLBT 3LN9A 1ZHNB 1F4YL 1LILA 2XTJE 4FXGB 4O2EA 5IG7B 3LN4B 4HJGB 2W9DL 1K4DB 1WWAX 4UTAL 3ARED 1T7VA 5LGHH 1UWEH 4YO0A 4R7DA 4ONHA 1P4BL 2B2XH 4ZOAA 4CNIB 2MTPA 4ZSOA 3QG7L 1U8JB 1P7HL 2VOTA 3QUYB 3M1BB 3LQAC 1UEMA 1EPFA 5EZIL 3ARRA 3QQ4B 4APQA 4Z7QE 5C07D 2AJXL 1INDH 4JPVL 2AV1A 4HIJB 1K4CA 3NH7H 1KCVL 1H8NA 1GZQA 3HG1E 2XTJD 5DFTA 4OF8A 2RGSA 1FIGH 4RMUA 4WY7H 3VDCA 2JJSC 3SJVD 4OV5A 4ZUSA 3U4EA 1OARL 4NOBA 2P42B 4GG6E 5J7CC 5IIEB 5EOTB 2EEDA 2WLZA 1Z5LB 3MRCA 3V0WL 3G5XA 2P5WB 5GGQL 4G6AD 2DQUL 3LQZA 6FABH 4L3CA 1XAUA 2BOBA 4YHKH 5I1LB 5DK3A 4IRZL 1RIUL 3MRMB 4M9OA 3WIFB 1WBZA 3AU1A 3FL7A 4KHTL 4NN5B 4X8XA 3EFDL 2ZUQB 1A6AB 4HT1H 3KLHC 3WNLA 1MAMH 2MCG1 1NLBL 4QHLB 2E5EA 3WJJC 5ADPH 2J2ZA 4NQCB 4HWBL 2GEEA 1H3GA 4NQTA 3RVWC 3MJ7A 2WBJB 4JJ5B 2W60A 3ZKMD 2ZUYA 4HGKC 4NP4H 1VESA 4X99A 1KPVB 3IJSB 3QQ3B 4PJ8A 4N8VG 4M1CD 4POZC 4ODUA 5BZWA 4GQ9H 1UZ8B 1W0VA 4KUCD 3VXME 1I1AD 1JN6A 1KTKE 1X5HA 3G6JB 4NGHL 2KBGA 1MRDL 3U36A 3MGOB 5GRJL 5A2JH 4MAYC 1RHFA 4HMEA 3UTTD 1QRNB 1C8PA 1LO2H 1TIUA 5K9KB 1JRHI 4L3EB 3WNMA 3L9RA 5FGBC 3IDMA 5I2IA 2DLTA 3C5ZB 3LS4H 1HE7A 2NW3A 4PUBL 2AXFA 3BIKB 4K7PY 5EFIB 4GH7B 3QULB 3S6CA 3PP3K 1TZHB 4WFGD 2XY1A 4DTGH 1A1MA 4GAJL 4NUJB 1CICC 2PO6B 1LEKA 5HGDA 4P3DB 5DJZA 3ZTNL 3WFDH 4HUVB 3WSQL 2X1WL 3VH8A 2PXYB 3ZYZA 1RU9L 1EA9C 2BY0A 3IT8D 3B6SA 2PO6C 4GXUN 4AY0A 3ZTJG 2X4RA 1IRAY 4IMLB 4JZJC 1R3IL 5MP6H 2X42A 1QHOA 2L0DA 4HUUB 4PJAF 4O5LH 3RL2A 5EU7E 2Z35A 3RX8A 1ADQA 3BO8A 1UCBH 2FB4H 2WINA 4X9HA 3O45B 4NQVA 4N8VA 4RMVA 4C83A 4EVNB 4FNLH 5AUMB 5B21A 1NEZA 2R8SL 1CK0H 4S1RL 1J8KA 3JV4B 2XZQL 1XMWA 5F9WC 2X4UB 5M7QA 4PGZA 4HPYH 5MENE 4JDTH 1DN0A 4U1HB 1O0VA 5EA0L 2H45A 5D1QD 2B7DT 4ALAH 3BZEA 4PJ9D 3SQOH 2ZWLT 3GBNH 3M45A 3VGDA 4QCIB 2VISA 3QDJB 1OCWH 4ETQA 1HHGB 2ZUXA 3VFTA 5IB2B 1N3NA 3Q5OA 4DOHE 2X70B 3FTGB 1TJGH 1S7WB 2VERN 3O8XC 3QIBD 4TUKH 1NBYB 5JW4R 1JF1B 4FNLL 4WW2A 4NN5C 1T22A 1SEBA 4I9WD 5D96B 5GGSY 2FB4L 3F8UB 4OQTA 1IEBA 2C3VB 3V4VL 5I8CB 3GNMH 3VWJC 3VW3H 4ZSOE 1WBYA 3SDYH 5IBUB 4JO4L 4ORGB 3JBG7 4D3CH 5F1KC 3SDYL 3OKYA 5DDHB 4RNRB 5GJSH 2MOVA 3TVMA 1IGCH 5BJTB 3O6LH 1T4KB 3TN0D 1T1XB 1WBXB 3TBYA 1LP9B 2ICWI 4GRWF 3VXSA 1Z2KA 1MAML 5C92A 3CD4A 3D0LB 3MCG1 3UYPA 5KS9A 2BNQA 2N7AA 3HPLB 1LP9F 2AK4A 3HS0A 1A6VL 3THML 4F7TA 1ZT1B 4P9HC 4CMHC 4KI5D 1XGYL 5ECJE 1A1MB 1EX0A 5E1AA 3DX6A 4FQHB 5IB4A 3U0TB 3KPSE 4RX4D 3ROLB 4TUKL 3KPNA 4NQDB 4Q58C 1X5FA 3HZVB 1CD1A 3SDXE 3ZDYE 1H5BB 1I9IL 5HHQB 4PLKC 3PL6B 1F6AB 1G7IA 1AKJB 4L3EA 2FECL 5JXED 5JHDA 1MRDH 4HS8L 4IDJL 2CIKA 1QR1B 3SQOL 3MNVB 1YY8B 4WI4A 2F15A 2QSTA 3DXAE 2DMKA 1B6UA 3JTTA 1N4XL 4NHUB 4H20L 3LOWA 2J5LB 3LQAL 2ORBL 1ZA3B 2DN7A 4OCYL 4MS8C 5DURD 3PGDB 3NPSB 4LNRB 3HRPA 4NWTL 1P84K 2NX5E 2EXWC 5DJ0B 3C87A 3TZVD 4LU5L 3B9AA 1VGEL 2WAHA 3BD3A 4NDMB 5ALCH 1A3QA 2OSLB 4UV7H 4UV4L 3RVUD 1PFCA 3OX8A 3S4SA 4KRPD 3MYJB 3CLFH 3VXQB 1HXYB 3L3HA 1U42A 3NACL 4JRXE 4NKIL 4YXHH 1XZ0A 4YHML 4TNVF 2QSQA 4DTGL 3IXAA 3P9LA 4HT1L 3PWVB 4MQ7B 1MHPL 4XT1C 3ULUL 3EZ8A 4X7EC 2ESVA 3U9PL 3OR6A 3RVXD 1HHHB 5ID1A 4JY5L 3PP3H 2HT2C 5TH2A 1D9KB 1TPXC 4YC2C 4AM0A 4WHTB 1UQSB 3DLQR 1XGPB 3D2UA 3OXRB 1T89C 5E6IB 4Z78B 4O00A 3VGFA 3P0VL 3LRGA 5CMAB 2VLJB 3NH7L 3L3GA 1JGLL 4LLDA 1MSPA 1Q9KA 3TA3D 1FFRA 5HGAB 4QOKB 2GT9B 4PJ7A 3ZE0F 1FJ1B 2YZ1A 5L88H 3LDBB 1YYLH 4Z7UB 3V0VA 4HKJA 3A6CH 3DUUA 5JHLL 1ZV5A 2AVGA 4O02L 4HLJA 4PBXA 2NY3C 2KQMA 3PGFH 2HJFA 3HZYB 3O3BA 1JHTB 5KAQF 1XGUA 1SBBA 5CZVL 4JHBA 1HIMH 4EVNA 1UM6H 1UVQA 1YJDH 5EBWB 4YHPB 4C58B 5HHXH 1FFPB 1C5CL 1TQCC 2A6KB 1RK1B 4NNXB 4NUGH 4LASH 1RJZA 3FFDA 4XCNB 3V0VB 1P69B 5JOPE 2Z35B 2GAZB 3VFGH 1MOEA 4CU6A 5SV4A 3A67H 1BQUA 2VLKE 3EZJB 3DXAA 4QRTB 1B2WL 1JI2A 1NUGA 4JAMA 4ORZC 5DD1H 3H42H 3O8XA 1RPQA 1N2RB 1XIWA 4NQSB 4Z8FL 5E08H 2O5ZL 2DQUH 2Z8WC 3HE6B 1B0GA 4ETQB 5FUCC 5GISH 1OGAB 4NRZB 4WTZG 5HGDB 5TGBA 3UZEA 3WEXA 1WIOA 1CLYL 1A4KB 1BVZA 1I1RA 4LNVA 5IBTH 4YX2H 4Z7VB 4OLEA 1IM9A 5JOFA 5FO8B 4NZUL 3LKSA 2YA1A 4NFBA 2OMBA 3SO5A 3ARXA 1L7TL 1BVKA 3CFDB 4NWUL 2P49B 4NKDB 5H8DA 1U3HC 1LO5B 2HWZH 4K3JH 2OL3A 4DKDC 2AW2A 5E8EA 4KTDL 1P4BH 2B2XL 4MB5A 3SEPA 3H42L 3TT3H 1CQKA 3JWOC 5F7MC 5IHUL 1FE8L 4NOFA 2YPLD 4WRLA 2XACC 1NGQL 2P43B 4WU5B 1SYSB 3MLXH 2JCCB 4OSUH 4L8BA 3UROR 4I13B 3QI9D 5SX5H 3BN3B 3AY4A 1BD2E 4NZRH 3PGDA 5FIEA 1OGAA 4XI5D 4DN3H 2DWDB 5CZVH 3NCJH 2J4WL 2FGZA 4P2QE 4PJ7E 1FNGA 4GRMB 1KN2L 3U7WH 3LDBC 1Y18B 1IGTA 4JVPA 3QRFM 3OHXB 4BQ8A 4Y7MA 2VABA 2IFFH 1ACZA 4NZUH 1RIVH 2K7PA 2V2XA 1LEIA 2ATPB 3S37X 1QLEH 4JPKH 1FNFA 4QKXB 4BKLB 1P9MA 4MNGB 4JM2A 4ZO8A 1KB5H 2BFVH 1G7HA 2BDNL 1HHJA 1FAIL 1MFDH 2X1OA 2GITB 5I6XB 4X7SL 5F88B 1PDKA 2BVYA 1T6VN 3BP4B 3JTSA 9CGTA 5CINH 2NY1D 1G7QA 4HIIB 5CBEA 3KJ6L 1RULH 5I1EH 1N59A 3QPQC 3WDIA 1KGCD 1MCFA 1OAQL 3BHBA 1RUPL 1MIML 4WFED 2E9JA 3IXTA 1MHPH 3C09C 3SGEI 2EO1A 4RIRA 3PWLB 2AXHA 1U8QB 2VZSA 1RJLB 2VIRA 3QEHB 2GK0A 2GJZA 3ES6B 5C0CA 4BFEA 3DBXA 2VLRB 4RMWA 2OZ4A 5I73B 4OCRL 2VLJE 1A6TA 3LMJL 1RZFL 4L3CB 1FQ9C 4N9GB 1Q72H 2P48B 2YWYA 3O6FD 3SDDD 3K2MC 3N0PB 4E0RB 5F97E 1I8LC 2AJSH 2I25N 3HUJA 1QFHA 4S1SH 4LAQH 2GW5A 4I4WB 5SWSE 4HEPG 5FHAL 4HK0B 4P3CH 2JJUA 2ADFH 4XCYA 5I0DA 2PYEA 3LEVH 4NO3B 4FA8A 1FZMB 4ODTH 4FG6C 5E8PA 1DBKL 5IVXB 3RHWF 3DSFL 3TC9A 3S88L 4OZ4A 5FCUL 1H9VA 5C0DA 5I76A 2DKUA 5DJ0A 2YN3A 3PIQA 5FYKD 1JRHL 3D2UB 2KQNA 3DIFA 1UM5L 3RWHB 5I1GL 3L3IB 3TBVB 5CKGA 3P4NB 3PWNA 5I1DB 4IEFB 1XGQB 1OF2A 1E6JH 1YZZA 1X5ZA 3S36X 3TN0C 4FP8H 4YZFF 5GS2D 1FRGL 2YUXA 5EZLA 4ZYKB 3TO4A 4NQVB 4KHXH 3OKEB 4FXGA 4O2EB 1XZ0B 4URTB 4LCYB 1EUTA 1AD0B 5I1CL 1XIWC 4U2YA 5LXGL 1T0MA 4XVJL 1LQSR 3VG0H 1E6OL 3PF2A 1IFHL 5ENWA 1SYSA 2H8PB 2IBGA 2AI0H 4JG0H 1JNLH 4FQ2L 3MV7E 5GHWH 5F9JB 5MEOB 2JE8A 3QUMA 1AGFB 2GHWB 1OAZH 2H2SC 4YHOH 3UTSD 5I19L 4P3DA 1BAFH 2FBJH 4F2MA 4FQ1H 3VXOA 1V7NL 2WQ8A 3ILQC 1FL5A 4M61B 2J5LC 2Q86A 5DRNA 1KCUL 2PCPA 4WU5A 3ULUE 4N5EC 3BKML 3C5ZA 3OGCB 4RWHA 1D5MB 4MZ2A 3L5XH 4HKXA 1QNZL 2E27L 4JHAH 1I9IH 1IAKB 3MJ8A 1UJ3C 3RP1A 1RHHA 1F6AA 5FGBA 4YUEL 5JMRA 3PDOA 2X10A 3LKNB 4G6FB 3PJSB 4PJXB 4HAGA 4LCWE 3VMOA 5CJQH 1QFUL 3FQTA 4WUUB 4QTHA 3MO1A 4LHUD 1PLGL 4QT5B 1N6QL 5HHMD 4O58H 5ETUB 2Q3ZA 4LLYB 3UC0H 4ELME 4HBQA 1FVDA 1A6WH 1NKRA 4CU8A 5IW6B 1C1EH 5I0ZA 4YHZH 4JFHD 3BKJL 3CDCA 3OJMB 4Y5XC 4XPHH 1N0LA 3SGJA 4Z95H 3FN0H 3RHWK 3V4VH 3AXLB 5DJ2A 4WHYH 3P11L 1G0YR 2GSIA 4Y2OA 3JSSA 4OZGF 1KCRH 4RBPH 2AJVL 5JR1H 3WUWG 4KRNA 1KJMA 1I3GL 2O61B 1DE4A 1I9JH 2VIRB 3MODL 5DJAB 3I6GA 5L0QB 4NQCD 3G5XB 4TYUA 1NGZA 3WSQH 4DVRH 2HFGH 3MTRA 1CLOL 4OAWA 3EYQD 4N8VB 4GAJH 1IC4H 1UENA 4M00A 5DVKA 1L0YA 3F7YB 4YR6B 2IWGA 4PJXE 4QRSB 3F7QA 4UT7L 3G6DL 1XGPA 1HQ4B 4QTHB 4W70A 3CK0H 2ZNWA 2K9UA 3RX7A 1LO2L 1M05B 4KDWA 1F4XL 1T7XA 4RQQA 3HC3L 2PXYA 2IBBA 1LEGB 5DHVH 1B88A 4E9LA 2G5RA 4BFBD 1J86A 3WNOA 3RUGB 4PRNB 2R2BB 3ZKQD 2JK5A 5D5MF 4KZDL 5J3HD 1OAUL 2WUCL 2MQCA 2PW2A 3CAFA 4UQ2A 5DVMA 5TDOA 5ID1B 2Y5EA 4GBXD 4JRYA 1FCGA 3BH9A 4XI5C 1B4JL 4YJZL 3S3SA 2FO1A 3ZL4H 1S5HB 4ESKA 1Z9LA 4G5ZL 2ATPA 3ZDZE 1BIHA 5IEHB 5D70L 2OQJA 4CL7A 3CNKA 2XWBA 1EHLH 5T1KA 2KH2B 5CSZA 4OLWL 4APQD 3FQXA 5D1XA 4PRPE 4N8CH 4UB0H 5C08D 2D9QB 4P5TC 4P2RD 3X3GH 5EBLB 4J8RB 1FGNH 1TZGL 2V17L 4UOW0 2D7TH 1VACA 4Q6IC 4M48H 3VI4E 1FL6A 3GMRA 2R56L 3UYRH 1JYVA 5TE7L 4QRPD 1KENL 3EIFA 3D48R 4XPBH 3G04B 4F9LC 1G0XA 1ZANH 2PTTA 3F6IA 3O6FB 2AABL 1HDMA 3O41B 3FO1A 3OQ3B 4QRPB 5DEFA 4M1GL 3KPNB 1KJ2L 1TVBA 1NFDB 1ZVYA 2FD6H 3K2UH 3VXRA 3MLZL 5DRWA 1KN4L 2AQ2A 3WO4B 3UBXA 3BPOC 3BMWA 3MCKA 4PY7A 4FOMA 3BW9B 4UBDC 3RPIA 3RNQA 1GGTA 2BNRB 3HS0B 3C5SA 1D3CA 4OCRH 2VLKA 2C7UA 1HI6A 1IM3A 3CSGA 4XWOC 1A7NH 4HEME 2F9BT 4NRXB 5IMLB 1RUQL 3ROOB 4PJIB 3VGAB 1E0OB 2FJFB 3QQ9C 1YEEH 1UWEL 3BKYL 2DAVA 3GMNA 4K9EL 4KHTH 3KYNA 5T3ZH 2BVQB 2QL1A 4FP8L 2Y4SA 3SDAC 1LP9A 1PQZA 1M4KA 4J2XA 1WWBX 1UACH 2F53A 3RWFA 1N6UA 4UNTA 5EO1B 3PQYE 3BH8B 1MHHB 4QRRD 1SM3H 5I1HL 4KTEH 4Z7NF 1NCAL 4Q9QL 3CZFA 2FL5A 2GSGA 2IMMA 1OARH 4J3VA 3ARGA 4PJ8C 3T04D 3N1FC 3BVNA 5FUCE 3LEVL 3EUUA 1J12A 3CLEL 3TJHC 1RVFH 5FYLD 4QT5A 2J8OA 4F8TA 3O8XD 3GJFA 3QIBC 3E8UL 1BFVH 2JIXB 4F3FA 5I8KL 3BGFC 4G6MH 3NA4A 4ZMAT 1QSFD 1UQSA 1A9EB 2F58L 4OIIL 1DBML 2WMPA 4Y19E 2BSRA 1N64L 4XNYL 1IGML 3ZTJH 2DQHH 3KYMB 4DAGL 3NCMA 3VRLF 2Z31B 5AG8A 1KPRA 3S97C 5HHOA 2B4CL 4AM0B 4PB9H 1LEIB 5DMIL 1NBZA 3DJ9A 2RFXA 3VGGA 4G6KH 4LVHB 4OZFG 3SPVB 3R0NA 3KLHD 2DLFH 1AHWA 2FEEL 4LSPL 4CJ1A 2LU4A 4UINH 1A02N 3QDHA 5KS9E 3PWVA 1CWVA 4QRPA 4NBZB 1K8IB 2HG5B 4QXGL 3NCEB 4U1SA 4XC3H 1Z0MA 2I9LA 3IFPB 3S4SG 3BWUC 2X4OB 2R0WH 4O2FA 4M43L 5EIVA 4OV6F 4HS3B 1T5XB 2XG5A 3RWEA 1CQYA 1YDPB 3GMMB 1MRFL 3P4MA 4X7SH 2KZWA 1G7JA 2ZSVA 2NTFA 3AROA 1CXHA 4D0BA 4S0SD 3QO0B 5C0EB 2VKWA 2HJKB 4JPWL 3U46A 4LHJB 2DM2A 3DVIA 5A40E 3KYKL 3VG9C 5IK3A 4X4YA 2CSPA 4OCWL 1A0QL 1A4JA 2FZ3B 3VWKC 1MNUH 4OFVA 5D7KD 4LASL 3UJJH 2DLEA 5TDOB 4XMLH 2W0PA 4FFVC 1AJ7L 4X7DC 5TQ0H 4WDIB 5E2JA 1SYVB 2VZ1A 4QHNB 4YHYC 4PRNA 4GSDL 5ISZD 1Q0XH 3UTZA 3G6JA 3WDJA 4MDIB 4YHIB 1NEUA 4NZJA 1A22B 1RY7B 3BKCL 4M5YL 2NZ9C 3RKPA 3SDCD 3HC0A 1QFWM 5J13C 3GBMH 3OG4B 4BELD 4XP6H 3QFJA 1JZ4A 3KYOA 2ZUSA 4XCCL 5CWSB 4NQCA 5CJXA 1U36A 1DBJH 3MRIB 5IK3B 1F4HA 4RNRA 3GB7A 1JWUB 3EDDA 2UZIH 4QRUA 1A21A 1M7XA 3C08L 3I6KB 1YEDA 3BPNC 4MB3A 5IFHL 4HKBA 5C0AB 3VE0A 4QHMB 4XNMA 4I3SL 2QV2A 3VXUA 4R3SB 5I1HH 5K59E 4YEFA 1PAMA 4OCXL 1R0AH 4U1LB 1ZKAA 1HH9A 2VDOH 2F53B 3QEQD 1J1PL 1I1FB 1JZ3A 3LS5H 4Z8FH 2N56A 3TCLA 1T20B 1NCUA 4QY8B 4WWKC 4RFNB 3QA3B 4XNZB 3KYNB 4U6VH 1IKFH 4U1SB 3UPAA 3BP5B 2QQLL 5F7FA 3O6FC 3WDHA 4P9HH 2RR3A 3MBEA 4P5TD 1PKQE 5E5MB 3OB0K 1OQXA 4ZUWA 1XF5A 1BBJA 4DGIL 3UCRA 1ITBB 2DQHL 2X4UA 5KW9L 4R0LC 1DBMH 4U6HA 3RU8L 2RHEA 5ILTH 5EZJA 5D7JA 5GSRB 5BVPH 4MJ2A 5FA4B 1G6RB 1MI5D 4JG1H 5ELIA 1J05B 3K3QA 5AZ2H 1MWAH 4DK3A 4ZNCD 1HXYA 4DEPB 4BUHA 4XNXL 4F7EB 2QSCL 4JANB 5DLMH 3O45A 4TSAL 1SVZA 4HKZB 2YMXL 5L2KB 3OKOB 1BWWA 3MLTB 3DX9B 5ESVB 5D8JH 4CW1B 4LVHC 5EOQL 3V7MA 1BOGB 4GUPA 3MFFA 1AQDB 1DBBL 4AMKL 4OGAD 3RY6A 1UKSA 4ZTPL 4XPFL 2WK2A 4UOJA 5IMOB 4GAYA 3GMLA 3U9UA 1PZ5A 5JXAH 1F3JB 5ICYA 4RMTA 1DQLH 3U79A 3QUMB 5C3TA 3WFHB 3QEUB 3MRDB 2MCPL 1WCBB 3D39B 4YXHL 1BEYH 1YY8A 3Q3GB 3T0WA 1UH2A 1QBBA 3LQMA 4KRPB 5FV1L 3H9ZA 4M3KB 1RUKL 4JFOA 1S7XB 4OT1L 4U1KA 5F3HB 4FQLH 5C0IA 1WICA 4JO4H 2HT3D 12E8H 3H7BA 1JI1A 2FGWL 5H94B 1X6NA 2NX5B 3TIEB 2VXSH 1OF2B 4IOFD 1WVZA 5DMKA 3NGBC 1WZKA 1PW3A 3HPJA 3RZCD 1F6LL 1IGFL 4GXVH 3VD5A 3FO0H 2AGJH 3MR9B 1WV7T 5D96C 1C08B 2Z9TA 4U6YB 5FUZH 1NUDA 2NY6C 1F58H 5JDSA 3PQYD 1AGBA 1T4KA 2I24N 15C8H 1TJGL 1HWHB 5EU5A 3VXTB 1JE6A 5DDHA 2XY2A 2HAZA 1NMCC 3DROA 3HG1D 1T1WA 3I84A 1A6PA 1U2CA 1II4E 1QPXA 4PJ5D 3NABL 4OZHB 3S34L 4F8QA 1HILA 1MCLA 5J1AA 3KS0J 2KKQA 3V52L 5F1IB 3GJFK 3N1QC 2I60L 1XF4A 2FJHB 5DC9B 1DL7H 3IGAA 5EUKB 1S9VB 2XZCH 3T0EB 4ODHL 3FHAA 4MNHA 5IWLA 1QSEB 2HFFB 4RAVA 2FX9L 5HHOD 4ERSL 1K9TA 5GJSL 3SKOB 4GUPB 3S5LG 4PJ5E 1S5HA 1CGXA 5ETUA 3JUZA 4FMFA 4XHQA 1AR1D 5BVJA 1KLGA 3GI8H 5C09A 4ZTOH 2CXKA 1N59B 5LJYH 1NGXB 3BP7B 4PJAE 4OZIB 3F58H 2AV1B 4P5TB 5F88A 3ESUF 4HK3J 4X0KA 3HI6H 5EU7C 1IC7L 3MX0A 2FX8L 4HDIA 4YO0B 4PJGF 3DWTA 1DQDL 4DQOH 3IAPA 4W68A 3WIHL 4KK5C 4X7TB 4M1CC 3W9DA 1UB6B 5C2BH 3I3BA 4IS6A 2C1PA 5LG1A 3P77A 3D0VA 1ORSA 3H3KA 3FO9A 2ICCA 3LN4A 1QG3A 4YLQT 3OHXA 3OAYH 1YYML 4X6BB 5DD6B 3WIIH 3F7YA 4YR6A 5BRZE 1U8KA 3QXAA 4NGHH 4OZIE 4WUUE 1ZTXH 1WISA 5J11C 4OAWB 3VRIB 4XXCA 4J23A 3HAEG 2G2RB 2CDEA 1RZJC 4TVPL 3ARGD 2HVKB 1Q9LB 4X6EB 4C4KO 2Y36H 1IC7H 4R7NA 1FFQA 3HI6L 1S9YA 3HLAB 4Y5YC 4Z95L 1N5AB 1UCBL 5J6HA 1YEDB 3MMEB 5AYUH 4ZFGL 2CDGB 2IG2H 3KAAA 1XT5A 2R2CA 4NQXB 5LXGH 5C8JB 1OB1B 2ESVD 2ZCKL 5FHBL 2D9CA 4TPRH 1T1WB 2P4AB 4X4MA 1RUKH 2V7HB 4E5XB 1I4FA 3UPRA 1T7WA 3PGCA 1BLNA 4CRPA 1CGYA 2DIBA 1GGCL 4ERSH 4M62H 2AQ3A 1F90L 4PREA 5HYIA 2YEZB 3I2CL 4GRLB 3BZDA 1F02I 4JFYA 3DUSB 4TULL 5IQ7H 2ENYA 4ZS7H 1CFQB 5MERB 4NZDA 5DEZA 3ARDD 3QYCA 3WYRA 4D9QD 4JFZH 1I7TB 2Z4QB 2ZOLA 1NCWH 4JKKA 3I02A 1JRHH 2VE6B 1JWMB 4LDEB 4HXAL 3KHOA 4OZ4B 5MENA 35C8L 2P8LA 5D7IF 4Y5XB 3ARBB 1MFBL 2YUWA 5FYJE 2ADJA 4AENA 5EUOA 3AS2A 2AEPL 2OMNA 3UZQA 2HTKD 3QRGH 3W39A 3BPCB 4MSWB 4MA7H 4OD2B 3RWJB 3VXMB 2B20A 2GCYB 4NC1E 2K3TA 3MMEA 4OLYH 3H9HA 4WFHE 3L3DA 2UWEB 4Y2DC 2JB6B 1QRKA 5B8CA 3NZHH 2C3WA 4L3ED 2W1NA 1P84J 1XCQA 4ZFFB 4C57C 4I9WE 3HRZA 2F54B 4AIXA 1HEZB 3VRJB 2X2YA 4WI3A 4HWBH 3OGOE 2CKBH 1J1OL 1IGIH 2OP4L 2OJZL 1C5DB 3FO9B 3NFPA 5EC2B 5DO2C 4ONFH 1KG0A 2QQLH 5KN5B 1V3KA 2P8MB 1X5YA 4P9ML 2EDHA 2I9LB 2YC1B 4WFHD 1CBVL 4HC1L 2FATL 4OCSH 5CBEB 2H2SD 4IRZH 2FEEI 2D7NA 4Z78A 2CO6B 4F58L 1CICD 4BZ1H 3GI9H 4F37K 1HHJB 2XWTB 1T6WA 2ITDA 4LQ1A 5GS0L 1FAIH 1MFDL 2ZG1A 3KPSD 1A5FH 4IRSC 3KYMA 2V5RA 3R06B 4GG6F 3W0WB 2J3SA 4WO4C 5C0AE 1NUNB 1TCMA 4AMKH 4TQEH 5I1JH 1CLCA 4NO5B 1FZMA 1FYHB 1KCVH 4TSAH 4LAQL 2BY3A 2NY2B 5I18H 2A73A 1VA9A 4S1DD 1BIIB 5AWNL 5DVOA 4WI8A 5AD0A 1XF4B 2FJHA 3TCLB 1Q94A 5H35B 2EE3A 1NFIB 4XPGH 2ZCLH 2W0FB 3QUZA 1JZ2A 5IROA 3GSWA 3QNZB 2FYYB 1FC1A 5GRYA 3OF6D 5SWQB 3G08B 1JPGA 3HFMH 4K2UH 4LSSL 4JKPL 2DI8A 1KLUB 4NJAL 3IFLL 4KDTA 3CC5B 1IAIM 4JFED 5C7XH 5J1AB 3T09A 3TT3L 4X6CB 2B4CC 4XMLL 1MCRA 4WWKB 3LB6C 1DVFC 1BFSA 4JB9H 3QI9C 3B9KB 4FZ8L 3WN5A 3FB7B 4FQPA 1GIGL 2R1YB 4MA8H 3FQNA 4PRIA 1IM9B 5FK9B 3ZT7A 2V5TA 3SCMB 4KV5F 5T1KD 4NKOB 3ZLQC 4G9FE 2P7TB 3D3VB 1FVCB 3WBDA 5EZOH 3GZKA 3QUZC 1N6VA 1AO7A 2P8LB 4PREB 5I73C 2D03H 5I16A 3T0VA 4MDIA 1J9CT 2D31B 3SCMC 4F57H 1CLYH 4OGZA 3FRPA 4MJIB 1EH9A 3C5SB 2YD6A 5GGTA 2DQTL 2QTEA 2ARJA 2FRGP 1SYVA 3QHZL 4JY6B 4CADA 2C9AA 4ZFOL 1E28A 5F7WC 3KPMA 1TTUA 2DBJA 5EN2B 1FH5L 3AU1B 5KTEL 4N0YL 4NM8H 5BV7B 4JB9L 4YNYA 1WUNT 5IV2A 3S96A 4NUGL 1FNSL 5F6IC 4BSVA 2CDEB 3D39A 5C3LD 1A1NB 2A1WL 3MA7B 1TJHL 3PP4H 5M95B 1SBSH 2EH8H 1U8KB 2J8UB 1IL1A 3RJQB 4CW1A 1MRCL 4Y4HA 1N64H 4A6YL 1GGUA 3CMOL 3MZTA 1K5NB 3UP1A 2HWZL 3MFFB 3QDGD 4N8PA 4YFDB 1TETH 4HZLA 4OZGA 4YHNA 3FB8B 3FAXA 3OWEA 1P1ZA 25C8L 2Q8AH 1QP1A 1AXTH 2VC2H 3CFDA 1K8IA 4XHJC 3DUHA 4LVNB 4M8QB 3RGVD 3HE7B 2OCFD 4EI5A 4IRSB 2J6EA 2V9TA 4F7CA 5SWQA 3EYQC 2PYED 1BBJB 5D1ZB 4YAQA 1QLFB 4FQQA 3RGVA 2Y23A 4MA8L 4MJ5B 3VA6A 1T03L 4AJ0A 4KZEH 3DVGA 1FIEA 5E2WL 1G6VK 1BJ1H 4LHUB 3V6FB 4G9DB 4XAWH 1I3RB 3K8LA 3UTTB 3KPLA 3WFBH 5E5MA 2GFBB 5EOCJ 4KK9C 1U3HB 3FQWA 1H3PL 1KG0B 2I27N 1KJVB 5KN5A 4LAJH 2FATH 4QHUA 3QCUL 3C5ZD 4PJHB 4RDQG 1YC7A 4FS0A 3VRLE 1BQSA 2R2EA 1YEEL 1I1AC 3FT2B 2VLJD 4UAOC 2A6KA 5ISZA 1H5BC 1HKLH 4J1UB 4PJIE 2W0KA 4M4PA 3LEYH 5J56B 3DRTB 2X4PB 1IGMH 5IUSA 4P2RB 1CD9B 2UUDH 4R4FL 5IB1B 5I8KH 2NX5D 4HKJB 2IAND 4H1LH 5F1IA 4C56B 4GS7C 2WP3O 4N1EA 3P4OB 4PD4J 5IB3B 4HGWA 2IANB 2MHAB 4IDJH 4LSVH 1Q38A 1XFPA 2CLRA 1YUHA 1T5WA 4GW4B 4KK8D 1MY7A 4XP1L 4NBYB 5DQJA 1TCRA 5DFVD 1XCQB 1FGNL 1TZGH 2IAMC 3TIEA 1Q9OA 4LEOA 4MX7A 3X3GL 2BNQE 4PRIB 1FSKC 4H1LA 4XVUD 4RSVA 3FO2A 4HQQH 5C09E 1J8HE 43C9A 1IKNA 1SJVA 1PSKH 5E5RB 1PX4A 4YBQC 2CUIA 1IGJB 2V5MA 4Z0XA 1TVBB 2NNAA 2J88L 4H8WL 4WHDA 3O2DH 4YDIL 4KROD 4LRNL 4OFYD 2QBWA 3F6LA 3BAEH 5F3HA 4X4YB 4POZD 3VXNA 2R23B 4WTXA 5C0EA 5E6IC 3G04A 5FB8B 3O0RH 3W5NA 3Q1SL 4ZXBD 4GW5B 3GNML 3QEGH 4LDLB 3OKDA 1CICA 2R69L 1KC5H 3KDMB 1J8HA 5JHDE 2IH1B 3MRPA 4JFPA 5CJOL 3SDCC 1ZTXL 4I8DA 1J0IA 4HMCA 2IPKB 4NYLA 5GJTL 5FF6B 4UT7H 2A9NH 3RBGA 3ARBC 4LSUH 4LCYA 1YN6B 4OM0L 1EEZA 3PWPB 1CZ8H 1XF3B 1NCBL 1BQLL 5GS1C 5C0CD 1S5IH 2W9LA 5C2BL 1JTPA 4LCUB 4JDTL 4Q74A 2W9EL 1OTSD 4XVTH 2YK1H 1WFNA 1MAJA 1ITCA 5HI4C 3NCCB 5FHBH 5E8NB 4LP4A 1FC2D 3MJ9H 2JF1A 3CXHJ 3SQBA 4LVEA 3QEGL 1MCBA 3IU3B 1BX2A 5I30H 4R96B 5JIHA 3FT3B 3RL2B 1LO0L 3IKCB 3DX7A 5HYQA 1VSCA 1I1FA 3BQUC 2O5YH 5IEKB 4JJHA 5FGRA 1UKQA 3C6SA 3ETBF 4S1QH 4MNHB 4R90H 3BVNB 1S9VA 4Q2ZB 1DDHB 2FWOA 2XQYK 1A1OB 4U1GB 1P7KB 5TF1H 4PJEB 1UA6L 1KXTB 1A6ZA 2CLZA 1JHTA 4LQFH 3NOIA 2D7MA 3CZJA 4U3CA 1ZT7A 2IQAB 3IKKA 2YD5A 1ERNA 1JPST 4XVTL 3BGMA 1JZ6A 4YUEH 1LD9A 1OTSC 2NTSP 1E28B 5BVJB 5T3ZD 5E4EC 4RIRB 2NZ9D 5I75B 4RMSA 4Z7WE 1KXQE 5BO1L 3DGCR 4XP4L 4AENB 1BQLH 2X70A 1FYTE 3FTGA 3VXTA 2ZSWB 3V5KA 1KFAL 3CX5J 1FZKA 2DBLL 3MGTA 5C70A 1Q9KB 2JJSA 4NO0B 5J57B 2ZUQC 4GW1B 4JLRB 3QNXB 1IC4L 3T0EE 5DHVB 3HR5A 5GJTH 3QFJB 1KCUH 4OBSA 4X80L 1M1SA 3LN5A 4KKLD 4YGVA 1IAOA 4OZHE 1DN0B 4KVNL 2BY2A 3NFNB 2FO4B 4RFEB 2EICA 1TVHA 4ELMB 3RIAF 5A2KH 5A2IH 1PY4A 3P11H 5J12C 4Y4HC 1JGDB 3IFNH 3QIWD 1HKLL 1RZJH 2VUYA 3BKJH 4JFFA 1SJHA 1YNTB 1YNKH 4YZFE 3C9NB 5LCVH 5BZDB 1W8NA 4R7NB 2EDBA 3VFWB 2D0GA 2OLDA 3FFCA 2EECA 3MRNA 3NN8A 2BOCB 2EO9A 4QRRB 5GIRA 3AMKA 3OB0H 1LEKB 2PO6A 1ZVHA 3B2VL 4GG6A 1GGBH 3W2DL 4OGXL 5JXAL 2JCCA 3KPRD 3I75A 3RUGF 2F53D 3RVTC 3JV6A 3OKNB 4A2MA 1IKNC 5FCSH 5HYSB 3KLAA 3UMTA 5I66B 3D39E 4N0UE 1RFDL 3OJDB 4F37F 5IR1B 1MH5B 1CE6A 1C7TA 4ODXA 4APQC 2H26A 5E94B 3TVMC 1U8MA 1B0RA 2EYSA 1U93A 3HMWH 4LSRH 4L29B 1NBVL 1YEHH 4U05A 5T1MB 3FO0L 1AKJA 2D2OA 4P4RA 1A6ZB 3BD4A 4G42B 1T21B 4K07A 2O5XL 5I1IH 5LWYL 4HIHB 1UCTA 5TDPB 3SKMA 4R0LB 3DHJA 5E2UH 5KSBB 3QG7H 5J1TC 4P4KA 3K7UA 3IJSA 1LMKA 1QQDB 2Y5TB 5F7LB 1JNJA 2HKHL 4MXWL 5F93C 2BNQB 1I8IB 3U0WH 3HZKB 1X4XA 2PETA 4JN2A 1MJ7L 2ARJQ 4EN3C 4BH8A 3Q6FA 4QF1A 1JHKH 1FZKB 2BNUB 3WJLC 1U2HA 3L7FA 4ZQKB 1SJEB 2IGFL 3HG1B 5IB5A 1ZAGA 1OTTC 4X6DB 1X5XA 1J0KA 1MWAA 3MLSL 4O4YH 2OTWA 2DIJA 4YDKL 1B0WA 3W0WA 4NM4L 4POYA 5GGQH 2X4TB 3L3DB 4PRPD 3PWPA 3T0AA 4XAKE 3FOMB 5AZEL 5A1AA 1Y0LA 2H32B 3C8DA 2PR4L 2ATKB 4N9OB 5KSAB 5ALBH 3O9WD 4BSVB 5E8OB 3KR3L 3Q5YA 3AXLA 5EO0A 3V4UH 3OPZL 3IDUA 3CVHL 1FSKB 3CDFA 1EEQA 4P3CL 1PG7L 3CMOH 4FZ8H 5DQ9A 1JMXA 1BX2B 2BVQA 3F5WA 3UTPE 4BM7A 3QG6A 2OR9L 5IBLC 1LWRA 3RWIB 3PXHA 4Z0BL 3MRKB 1OP3H 1ACYH 3JV6B 3OKNA 4FQIL 3OXRA 2X7LB 4HJ0D 2YUVA 4M1DH 1F00I 2VN4A 2IJ0C 4OQTH 1G7HB 3C60C 4NQUA 5CUSH 3E2HC 2HH0L 4U6VL 5HYSG 1YEKL 2R1YA 1FH5H 1G7LA 5F44A 1E4XH 4YWGH 3BRDA 4M7JH 1DJSA 3UTQB 1FNSH 4HUUA 3U83A 4LDOB 1FVEA 3GMOA 1OD9A 4J8RA 4OCXH 2OL3H 5JORA 4MQXD 2VLRD 2LU3A 3MRDA 3CSYB 1NAKH 2DRUA 2A0LD 5B38B 3B9VA 1F3JA 5TPWH 3MBEC 1KTLA 3U9UB 5MEOA 5HSFA 3MLVL 4OZFA 3D9AL 1IEHA 1GAFL 4OLZL 2NY3D 3TBTA 1N5YH 2P7TA 5C0CE 1CXFA 1A2YA 1CGSH 4CN1A 4P2QB 4P5KA 3F7PC 4JREB 5GISL 4PGBA 4B0MM 1TETL 3LRHA 1F6FB 1MJUH 4JDVA 3TO2B 1E4XL 4WGVB 4S11A 3QFDA 3DMMA 4JKPH 1FV1B 4UINL 3P2TA 2Z31C 4G6KL 4I48A 4PGDA 3T3MF 1KEGH 1T03H 1CFTB 2DM3A 3GSUA 1LO4L 4X4ZA 2HN7B 1I3UA 1FORH 1OAKH 3LHPH 3E6FA 3CPLB 3T8XB 2UVFA 1UXWA 3IVKA 4QHLA 4EN3A 2DD8L 2QKIA 5KS9B 3RVVC 1I3RA 5F9OH 1QR4A 2NY2C 4NQSA 1H0DB 2V9QA 2DQTH 5L8KB 1I8IA 2G9HB 2NR6C 1KPUB 4NO5A 1EAPB 1QRND 3AS1A 1CIUA 3HUJB 2CDFA 3QRGL 2CQVA 3D1MC 4QOKE 2G60H 4OUUB 4YE4H 1G7MB 1L0XA 4LLUA 3IGAB 4R2GD 2CR6A 3GSNA 3RZCC 2GSIB 3HUJF 5D4QA 5F6IB 1CTOA 1Q1JH 3RAJL 5CHNB 5IT2H 3T0ED 5AAMA 2R0WL 3UJTL 1P4IH 1SM3L 3Q0HA 4OCSL 1T22B 5C08E 3Q6GL 1K6QH 2VLRA 3FB8A 2JIXA 3OAYK 1UZ6E 4OZIA 2VMFA 1A6UH 3PG2A 5DD3H 5E2TH 5HDQL 5L6YH 3A0OA 2ZOKA 5F6HI 4ONFL 2FJGA 4TOYL 1U8LB 1WZLA 3BD5A 1T83A 1G7QB 1ZE3C 3DETC 3A67L 3DV6B 3DO3A 3CLFL 3M8OH 3STZA 4P9MH 1XCTA 4E42B 5C6PB 1XF2A 4EN3B 4J7RA 2F54E 1AFVL 2J7LA 5CMAA 5IQ9A 3O3AA 1EHAA 2W59A 1KTLB 2IG2L 5DUML 1BFVL 1N7MH 3MV8D 3O6KH 2GJ6B 4ZAKA 5T3XL 1JGEB 1P5VA 3CVHB 5I18L 2JB6A 1ZVSB 1NFDA 2NY4D 2R9HD 4W6YB 4AG4L 3ARFA 4WHCA 1NGYA 4MQ7A 1NCDL 2AAVA 2V7HA 4E5XA 4JO3L 4TQEL 4JHWL 4V1DE 5CCKL 3P4LA 3W39B 4H88L 1I1CA 4M5ZL 1GHFL 1KTRL 4GKZA 3VWKD 2BVUA 3CU7A 1ZGLA 1JGLH 2LABA 3IFLH 3MRFA 3T2OA 5I75C 4YBQD 2P5EA 1D5MA 5CD5C 4NKQB 1Q8MA 4NQEE 1FN4A 3QO1A 5D7IA 3WE6B 2ZCLL 1M7IB 1PVHA 2HVKA 3FQXB 5D1XB 5ENWB 4L8BB 3WN5B 2VZ3A 1QTYT 1S7VA 4DUWA 4OZHF 1A1NA 5T3ZL 2APWA 1MHCA 3JWDL 3QUXB 1OTUC 4JFYB 1A6VH 1ZWIA 5B3JF 1T2QL 1YJDC 1AY1L 2XXCB 2AERT 3TM6A 1CD0A 3RKDC 3UJIH 1RUQH 4X4XA 3PGCB 1QLRA 4G80A 1NCCH 1J05A 4M6OH 1ZT4B 5C86A 1QA9A 4Z7VA 4HXBH 1A3RL 4U1IA 4GMSL 3MGOA 3QJFA 4ZPTA 2XZAH 1KTDA 5C6TL 2WUCH 3VXUD 1S9YB 3HLAA 2YS4A 3LKQA 4LPWA 3LKRB 1HWGB 4Y4KD 5I1DA 2EH7H 3PDGA 2IPTL 1VEOA 4B7LA 4HV8B 5KG9A 4MMZC 3BP5A 2YD8A 1P6FA 3DYOA 3EDJA 3L3KA 5JNYA 2CXGA 5I76B 1B0GB 4LCCC 4N0UB 1MCOL 2VO5A 1PG7W 1KOAA 5T3XD 1OTUD 3B5HA 1RK0A 4PJFF 4PR5A 3ZYIA 4QXTB 4R4ND 4NNYA 4KK5D 3VFOB 4J3OC 3AGVA