4EUPH

The complex between tcr jkf6 and human class i mhc hla-a2 presenting the mart-1(27-35)(a27l) peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
241
structure length
241
Chain Sequence
b'KVTQSSRYLVKRTGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSYDVKMKEKGDIPEGYSVSREKKERFSLILASASTDQTSMYLCASSFLGTGVEQYFGPGTRLTVVEDLNKVFPPEVALFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSEADEWTQDRAKPVTQIVSAEAWGRAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
molecule tags Immune system
source organism Homo sapiens
publication title Structural description of how different MART-1 antigenic peptides influence JKF6 T cell receptor recognition
rcsb
total genus 56
structure length 241
sequence length 241
chains with identical sequence J
ec nomenclature
pdb deposition date 2012-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4eupH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4eupH02
3CMOL 5J9PB 2JELH 4OQTA 3STBA 3MRKA 1WISA 5A1AA 1NLDL 4I5BA 5CEZL 1OB1B 3GO1H 2PTTA 4JFED 4JKPH 4AH2A 1LK3H 5CJQH 5C0RH 4MXQC 1RZFL 3L3GB 5FYKL 4HGKC 4GRMA 4TNVF 4G8GA 4IIQB 2BNQD 4OFPA 4KKNA 1IEAB 5DEGA 4PRNA 4QHNA 4PP1D 1AXSA 3QUMB 4RGNC 2DQGH 1QHOA 4JZOA 3HN3A 3QEQE 4K9EH 5CILL 3BJ91 4BZ1L 1TCRB 3NFPA 3BO8A 4TSBL 5DS8A 4ELMB 3MLZL 1UADC 2ARJB 1IJ9A 1FL6B 2HN7B 3VXOA 3BRGC 3ZE1F 2YA2A 4XXCA 2XTJD 5EOQH 1H8SA 5KSBA 5E8NA 1T89C 2X4RB 3VD3A 4HEME 4XBPB 1JCKA 3SY0B 4Y4HC 5IESL 1F3JB 5H35A 1QBLL 5FM5M 2W1NA 1D5MB 4NO2A 4UTBL 4D0DA 3BQUA 4GG8A 2MQ3A 3WFCL 1UXWA 3H2WA 3T0ED 1JTTA 4LNVA 2PYFB 2P5ED 5K9KA 4X9IA 3NACH 5AWNL 4IRJC 2B2XH 1VKXA 4U6TA 3H9SE 1A4JB 3MRIA 4V1DE 2VDNH 3WNNA 4GG8B 4NZDA 4POZC 4XTRD 1RZJL 4P5TA 4IIQA 2CK0L 5IJVA 4R97C 1IZJA 5E03A 4H0HB 3UTOA 35C8L 1V7NL 3O3AB 5F7HA 5MEND 3CMOH 5F8RC 3OPZL 3ARDD 4P23B 2DYPB 1TJIH 2LVCA 4JM4H 1WZ1L 5IK3A 5EU5A 1I1YA 3WS6A 3C8KB 5I1LB 5DS8B 3WHXA 5JW5A 4HQQH 2W9EL 3V0WH 4LSSH 5I74C 2DIAA 3LPGA 3F58H 3WIIH 2XWBA 3CFJB 2BNQE 2CK0H 3PIQB 4XTRC 1ZGLP 3GDBA 3NIDE 3UYRL 3WFHB 4JZJA 3OKKA 2ILLA 1U8IA 1DN0B 4OB5L 1JHKH 1KLGA 3SQOL 4WI7A 3MLZH 4FQXC 3V7MA 2W65A 2AJ3B 4Y4HB 2PTTB 3REWA 5JOFA 1X44A 3D87B 4FQ1L 4PRAA 3W5NA 5FGRA 2YD3A 1JF5A 3HPJA 5E8PB 2P42B 3G5ZA 3D1MC 3BQUC 2I9LB 4NM8H 1FQ9C 1S9VB 3ARGB 4R4BB 1RZ7L 3S34H 1D5IL 4GS7B 1RI8A 1UH4A 4ONOA 5D1QB 2AJZB 2IPUK 3D18A 3UZVB 3WHXB 3ARUA 4R96B 4ZO8A 3HPLB 5EU5B 3B9DA 4Y5YC 1FVDB 1K4DB 5FKAB 2DYPA 4P5TC 3P77B 3VFNB 2DLGA 3U0TA 4C56E 1UB6A 1ZT7A 4KRMB 4X9GA 4ZO6A 2XKSA 1F02I 2FH8A 3H7BB 1JI2A 3GSWB 5FYJU 1HYSC 5HYJA 2OTWA 2N4IA 2OYPA 3PIQA 4MVBC 2Y25A 3L5XH 4QRPE 5FO7B 5HYJD 1FAIH 4Z0BH 4OZIB 3MRIB 2H32H 2C3VB 1Z5LA 5L2KD 4NM4L 3VD4A 3UTQA 3B6SB 3TZVD 3VXRB 5EU6D 1CLZH 5T33H 3B9VA 4CNIA 3D85B 3O6MH 3DUSA 4NQUA 5C9JB 1NGYA 3KPPA 4JM2F 4WVRA 2Y7QA 5ALCH 5FUOL 1R5VB 2EKSA 2Y4SA 4WFFE 4GRWF 1J1XL 5IMKB 5TQ0L 4MA8L 2OBGA 1JHKL 2DMKA 3SQOH 3NCEB 1GVIA 3TLRA 2GEEA 4BZ2H 5C9KA 3S35X 2VLMD 5FKPA 4KTYA 2DBLL 4K3EL 4P57B 1CLZL 4U6YA 5T33L 3K4ZA 3O6ML 4W4OA 4F8TA 5L6YL 1FNHA 3VWKA 5IWLA 4NM8L 1FH5H 3QDJD 3TCLB 3QUKA 4Q58C 1HQRA 1CK0L 1FCGA 1S7QB 5E5RB 1N6QH 3RBGA 5HHPB 4KPHH 3EJYC 4IMLA 2BNRB 4QF1A 1VPOH 2VLME 4JVUA 3CFEA 2J7LA 4PJ9B 1KTKE 3RIFF 4U7MA 4XAKD 3BEWB 1LO2L 1WGOA 2WUBH 1UKQA 3IU3B 3CC5B 4LHUA 3SDDA 4R90L 1C8PA 2QADC 5FF6B 2NX5D 5E8DL 2H3NB 3J8F7 4KK9C 3IYLW 5L2KE 5H2BA 3ES6A 4QHNB 1A7QH 1TVHA 1G7HA 3N1FC 3O6KH 3OF6D 4YO0B 1I85A 3QFDA 3ZO0A 5GRJH 1FAIL 3BRDA 1MUJA 4HDIA 4MAYD 4KJQC 1IT9L 5T5FL 5AUMA 3T8XA 4XMPL 3PHOA 5JXEA 2C9AA 2J8UF 3EFDL 1Q9WA 3HCVA 4JY5H 3FO2A 1E4KA 1NC2A 5C2UB 3M17B 1EMTH 4V2BA 3LN9A 3DOSA 2WIIA 5FUOH 3X11B 3WS3A 3H6JA 5LG1A 1FN4B 3X12B 1FAKT 1JHTA 2ZUYA 3IT8D 4PJGA 4FZEL 4PJ7F 2EDRA 3Q5OA 4RNRB 2Y36H 2EDXA 4M6AA 2E7HA 4OUOA 2EO1A 5DLML 5D7LE 3FONA 3RY6C 3TH3T 5DVKA 1ORQB 2J8HA 2BVPA 3MBEC 4L3AA 4X7TB 5ESAA 4HX1B 5SWZE 2PO6A 2HVKB 5EU7C 4JFFD 5JPMB 5FO8A 3NCBB 3BDYL 1AGCA 4HFWB 5BS0B 3HZKB 1IBGL 2AJYL 2RFXA 5D5MB 2YN3A 5GS1A 1Z3GL 4ZOBA 2P8LB 2CGRL 4WHTB 4R2GD 4OLWH 3QEHB 1M4KA 3OAUL 3BE1L 4Z77A 1PKQE 2C1OB 3ZE2F 4PJIE 5IMLA 3LS5L 1BBJA 2YA0A 1CLCA 3TNNA 4GT7A 4PJBA 4R90H 1FRGL 5DUML 5DO2D 5E8DH 3FKUS 3L7EB 4NQSA 2B0SL 5IHZA 1WUNT 5ADOL 1NGZB 1CGSH 2AJYH 4O9HL 5HGGS 3RWIA 3KWWA 3SKNA 4DZBA 2VIRB 4H5SA 1OAXH 2A6JA 1JF6A 2EE6A 1Q1JH 1KSRA 1IAII 2EXYD 2GCYB 1OGTA 5C08D 5AZEL 3PJSB 2DWEB 3BH8A 2QADD 4RMVA 2I07B 4F7MA 4HJGB 3QUML 1B0RA 3S96A 3OKYA 4NC0B 4OTXH 2X42A 5HHOE 3GSQA 4E41D 4ODVH 3CK0L 1HXMA 4Z7UB 4ZXBB 2C3WA 2G60L 1J18A 2YD2A 2DWDA 4UOW1 3BH9A 5I15H 4X83A 1IL1B 3HNTH 2B5IB 4ZDHB 4JFDB 2NCMA 4NO0A 1QBAA 1TLKA 3E2HB 4HJGA 3BZEB 2B20A 1CDCA 1XH3B 2YZ1A 3V6BR 2YD1A 3RPIB 1BVKA 1S9WB 1ZVSB 4KQ3H 4PGDB 1XCTB 1U8NB 3MCG1 4W4NA 4OFVA 5FK9A 4AM0A 3RWIB 1FG2B 1FPTL 3R0NA 4KJQD 4NN5C 4I8DA 5IHZB 3QDMA 5F1NB 5C08A 1M05B 1K8DA 1N59B 2ZOKB 5IB2B 1D9KB 4KROD 5D2NE 3RL2B 3GHEH 1HXYB 5DUPH 5H37H 3QNXB 1MRDH 3QDGA 5DJYB 1UWEL 2ZCHL 2PYED 2XTLA 1U8HB 1JGDA 4EN3B 4XCYA 1IKNC 4HUKB 4ODTH 4HFUH 3TV3H 3MMEB 4OZ4A 3GNMH 3TVMB 3A6BH 1RMFL 3OHXB 1IGML 2VXSL 5TE7H 5L8LB 1CXKA 5DUPL 2XQYK 5EUKB 1E27A 1HDMA 3QUMH 1BFTA 1EHLH 2OSLB 3TBYB 5IEKB 2BSRA 3T2NL 4L3ED 2EC9T 3IRZA 3BI9X 4P2QA 4M6NH 3PP3H 1RMFH 2VXSH 5I8EB 2HRPL 4HWUA 3O3BA 3A67L 5TE7L 3BGAA 2A0LC 4HT1L 4ZUWB 3VFVA 1BQSA 1ZS8B 4L8SA 4BA8A 2A73B 3MV01 4JY6A 4YIQA 5D7IB 5EO9A 3UYOD 2QSTA 3EJYD 5E70A 2CRIA 1ZHKB 2J12B 2XTJE 3V52L 2HP4A 1D6EA 3QUYD 3T1FA 4PP1C 3A6CH 2V7NB 1ITBB 1TPXB 3VGAB 5BW7A 5C0FB 4J1UB 1CD1B 1P4BH 1H3TA 3FN3A 5FYJD 3O2WH 4Z7NF 2AV1A 2XKUA 1GSMA 5GGUA 3LSOA 4K3HA 5D6DA 5JHDE 4FP8L 1MAJA 2IC2A 2D0HA 1RJLA 5GGRA 2R0LL 1S9XB 1S8DB 4L9DA 5KZCB 3QI9B 4QO1A 3EO0A 4TUJB 1G84A 5KANG 4ODSL 3MV7B 1U92B 5L2JB 1NANI 5C0IB 4Z7VF 2NX5A 1YDPA 4PJIA 4GXUM 4WW1B 3U4EB 1N5AA 4JJ5A 2ZP0T 5MI0C 2X44D 4DZ8A 3DRQB 4O00A 1CG9A 2FO4B 1L0XA 3TBWA 1XGTA 4FABL 2NY1C 1XR8A 4HJJH 4ZFZB 1D5ZA 5EZJB 5DXWA 3QJFB 4M1CD 3CD4A 1BM3H 4GMTH 4OLXL 5EC1A 5IVXE 2R0LH 4YQXL 3K8KA 2N7BA 3RBSA 5IVXB 1DQJB 1GC1H 2NNAA 3PNWA 1JUFA 1MEXH 1MHCB 1O7SA 2C5DC 3ZHDA 5DMGC 2PUQT 4HUXA 5D1XC 3BZFB 2ED9A 1AXTL 4N8VA 2H26B 3TBWB 4X0KB 1D6VH 1UZ8B 2XN9A 1KG0B 1CFNA 2GFBB 4KJYB 3MBXH 3DTXA 3E1F1 4LNRA 5GRVL 1A9BA 3VXPA 3VXRA 1KN2H 4TPRH 4XVJL 5HDQH 2EIDA 4WEBL 1MVFA 4I77L 1U8MA 5INCB 4FFWC 5E5UB 3OR7A 4BUGA 2VXUH 4RWYH 4P3WA 1ETZB 5D93B 1KNOA 4PJXE 5EUOF 3H9YA 2LU3A 1WC7A 3VG0L 1I9RH 3IFOB 5HPOA 4MZ3A 4ZO7A 2NTFB 3QPXH 5D71L 2RJMA 4HS8H 3T65B 2IAND 2K9UA 2DB8A 2R2CA 3FMGH 5D2LE 1YPZA 4NYLA 2IG2H 3MYJB 3ULUH 1A7PH 3WV0A 2FIKB 3QO0A 4HHAB 1BHGA 3OB0H 1D7FA 4R4ND 1V3JA 1DUZB 2BVOB 3MCLH 1I3VA 2V5MA 5HDLA 3AS2A 2Y5EA 2N1KA 4HMDA 1MY5A 1UEYA 4J3OC 3G5ZB 4XNQB 4AEIH 3HAEG 2CD0A 3A6OA 1U8OB 2QL1A 5DURB 3P4NA 1JZ7A 4LIQE 4O02H 2OSLA 3TBYA 3WMSA 5KW9H 5J11B 3BMWA 4D0BA 5DRXA 5DTFA 3C2AH 3SE8H 2W0KA 3LN5B 4JFQA 2Y07L 4POUB 4PB9H 7FABH 4LGPB 2AXGB 4FHBD 4UOW0 3WHE0 1MVUA 2DICA 5K93A 4LSTL 2NX5E 4LNRB 1PW3A 4HAFA 3B3IA 4JFEB 4OKDA 3WFZA 2IGFH 3IDMA 4MNHA 3TCXA 1UZ8A 2XN9B 5C6TL 1OSZB 3U46A 3C8DA 1N3NB 3GJFK 5M7QA 2H6PA 1H8NA 5A2FA 3NAAH 3WXWL 4XP6L 3WNMA 5IB5A 3CFKB 4FA8A 3AFLA 2R1WA 1DBBH 4OF7A 5IB3A 3VFTA 3MSPA 4MD5A 5INCA 3PF2A 5EU7E 3DROB 1HOCA 2P8MA 4X6BB 4PRIE 1ADQH 4RSVA 3QPXL 5D71H 4CVUA 5I73B 2FGWL 5T3XH 2KPNA 4WW2B 3N1MC 1WFNA 2CRYA 5F7UA 3SE3C 2OI9C 3QFJA 4H1LG 3QUXA 5EZLB 3QA3B 4PTTB 3TN0A 3BHBB 2VLJD 4LGRB 3HZYB 2Z8RA 1NL0L 3HRPA 4U1KA 1MLBA 1CDHA 4QY8A 5DMJB 5C70A 4R8WH 5A2LH 3MCLL 2PTUA 4I2XA 3KNBB 4ZFZA 2GJ6A 3DX6B 1AD0A 2NY5L 3FTGA 1ITCA 3KHOA 5SWSA 3D2UA 4DZ8B 4UTAL 4ZS6D 3AXLB 2R8SL 2AW2A 1YDPB 1FL6A 2F58L 3TH2T 2DLEA 1FZKA 3DI3B 3HG1D 3FL7A 2CSPA 1FE8L 4PB9L 7FABL 4PRPB 1TITA 5BRZA 4JHAL 4JZOB 2AJUH 4BYHA 4HBCH 4M93C 5E2TL 1BX2A 5MENB 3RWCB 2MHAB 2JJWA 4PRNB 2MQCA 4YPGA 5GPRA 2X1XR 3W9EA 4ZG1A 4G8GB 4RIRA 1NCDL 3KWWB 5DYOA 1BQUA 2VR4A 1AR1D 4WO4D 3IGAA 3SBWA 1RUML 4QTIL 2CUIA 1D9KC 5BJTA 4J3VA 1ZV5A 3UTTA 4MZ2A 4ZYKA 3QIWB 2BY2A 4ZSOA 2Z4QB 3WIFA 3ORJA 3HB3C 1K3IA 2F53E 2AXHA 2CKBB 3VDAA 3D69A 3MRPB 4ZD3H 2VZ1A 2PO6D 2RB8A 1X5FA 3SDXF 1JPTH 3O4OC 4FQ2H 1U91B 5J3HC 2PXYA 2X4SA 1OL0A 1ADQL 3FB8A 3GMQB 5TDPA 4NQCA 2C26A 1JGEB 2Y06H 5IQ7L 3LPFA 3RUGB 4U31A 3KHQA 4HV8A 1A6UH 2VZUA 3R4DA 5D7LB 1JWSA 3LVEA 3S98A 1T5XA 5CZKA 2CIIA 3GSNH 3BKYL 4ZXBC 2X40A 4G7VL 1EVTC 3U4BL 1R0AL 2EXYC 3NN8A 5EFIA 4HUMB 4ONFH 1S7XB 2WBJD 2ZOKA 1QBBA 5HYJE 2C7UB 4KGJA 4ZNEE 3TT1H 4CDGC 3ULVC 4AZ8A 1SVCP 4JGJA 1JTPA 4UTAH 4ZNEA 5I6XB 5HYEA 1T2JA 3V4UL 4DGVL 3NIGF 2EH7L 2CR6A 4J23A 4K8RH 3VWJD 3SPVB 1LEKA 1QD0A 4ZPVA 2Z4QA 5BS0D 4EKXA 3EHBC 4JE4B 2IBZX 1DFBH 2X4PB 1BEYL 5FYLD 5GZNC 2PKDA 3OKEA 3SDDD 3QNXA 3CPLA 3SBWC 3VFRA 4FXKA 4ONFL 5E95B 1D9KA 2BHYA 3LDBB 4HKZB 5IOPA 3TT1L 1S3KL 1RVFL 3QEQA 3QI9D 5ITBL 4FXLA 4FTVE 4WUUA 1IZKA 3QIBC 3BZDA 3QXDB 5EU6B 1ONQB 5EWIL 2SEBA 1V5JA 3V4UH 4DGVH 5FF6A 1I3RB 1WWAX 3GK8L 3LKNA 3NVQA 1MCWW 4GKZA 3HMXH 4OAWB 4M6ML 2DLTA 1Y0LA 1WSST 2VLKB 4NQEB 2VRAA 4MJIE 3BPCA 2R4RL 1MRFH 2NZIA 1OTSD 4YC2B 5IQ9A 4MJIA 4H5SB 3TVMC 4GFTB 3MNVB 2A77L 3BIKB 4P59H 5DD1L 3VJ6A 1AR2A 1F6AA 2B1AL 5SX4H 3QQ4A 1VADB 3V6FA 4YHYB 2Q8AH 5ITBH 4WI5A 4J3TA 4Y16A 5A3IC 4IOIA 2X7LA 1MLBB 2DQEL 5DK2B 3UAJC 1WFUA 2E7LC 3WLBB 2E7CA 3QA3A 3HZVB 1HH6A 3CDGA 4HJ0D 4OZFG 4TSAL 1WF5A 1RUAH 3TZVA 3RA7L 5DMYA 4X7EC 1KYOK 1IGCL 1IC5H 2X9WA 1K4CB 2B1AH 2VQTA 4DGIH 3PQYE 5IOPB 1UWGL 3O6LL 3MXVH 1K3ZA 1NBVH 4EI6A 5F7YC 4JCMA 4UUJA 5IHLB 2A1WL 1QFUL 1A6PA 5C0JB 5HHMB 2BY3A 1LK2B 4BFBD 4DN4L 5SX5H 4IRSD 2DQEH 4N0FB 2WBJC 3PWJB 3TNNB 1L9MA 4OAWA 2ZSVB 1IM9D 2HFGH 3D3VA 3SDXA 5CEZH 3VI3F 4LQ1A 3RFZC 2FJHB 4WTXA 3ZSTA 4MNHB 3GM0A 1LK3L 5DC4B 4FTVD 5E99H 1OARH 3QIBA 2C7UA 3EHBD 1FCCA 3GB7A 2GQHA 2PYEB 1H5BA 3ESVF 4IJ3B 3FT2A 1FV1B 3M17A 1QFUH 3FN0H 4WGVB 4ZUUA 2H2PD 1MHEB 1YJDC 2FD6L 5CP7B 1FSKB 1II4E 1HHJB 3LH2H 1CF8L 4IHOB 1UCBH 5CP3H 2VL5A 3O45B 4U4BA 4F37F 1I8KA 4ZFGL 1HN1A 4TOYH 2ADIB 3RUGA 1FZMB 4Y16C 3SGJA 3HG1E 3QCTL 3OXRA 3V6OC 3DPBA 4GBXB 3MA7B 1TVHB 2EDJA 3LRSB 1F6FB 1WZLA 4HUWB 4FQIL 5HI5D 3LN4B 1XF5B 5MI0B 1A3LL 1X5AA 4G9DA 5BZDA 2BC4B 4HGWA 4M02A 5AG9A 1YEEL 2FZ3A 1F4HA 4MLIA 3S4SA 2XA8H 3OBAA 3GO1L 4TSAH 3BEWA 1T1YA 3QIWA 4JRYA 3D48R 4Q0XH 5HHQB 1QR4A 1IC5L 4S10A 3X13A 4XCNB 2D7QA 2Z91B 1SMAA 3PV6A 1IQWL 3RWCA 2R2BA 3GJEA 2DL9A 3EYFB 3S36L 4NOFA 3FFDB 4PRPA 2H3NA 4PJDB 5A2KH 2HKFH 3OR7B 4XMKH 3ZKMC 2CKBA 3IJHB 4PJBF 4PG2C 4NQVA 1RIHL 1S5IH 4UZGA 2OP4L 1U2CA 1BJ1H 2VDRL 2ZUVA 4ZSOB 2JJVA 1WV7T 2UVEA 4PJ9A 1RV6X 3IKCB 4XMLL 4MDJB 3ULUC 3QCVL 3L1OL 3GKZA 5E56A 1KCVH 3KPSA 2AXFB 4CVZB 3PQYA 4QCIA 4K8RC 1IQWH 4NNYA 4Y19A 4UT7H 4LRIC 1A0QL 1EEYA 1KJVB 5I18L 4MB4A 1FJ1A 2F8VA 2JJSC 2X4OA 5F7MC 3C08H 1QACA 2ZOLB 4KDTC 5J4MA 1NLDH 3SGJC 5T3ZD 4MD0B 3MYZA 4JKPL 4TOYL 2XACC 4ZUVB 4OZIA 4HWBL 1AE6H 2FRGP 5SX4I 5FGBC 4BZYA 4M48L 1U8KA 5TE6H 3U2SA 3QCTH 5E6IB 1I1FB 3N1QC 4FQXB 3RI5K 1XF4A 1M71B 4UT7L 3RIAK 5L2JA 3JTSB 1ZT7B 3BN9C 4MD5B 3D85A 1RJYA 4YR6B 4GXVL 4NO5B 2R1WB 3JVGC 2YZ8A 4GH7B 5IW1B 5I16A 4U1SB 1HILB 3KPSD 4EN3C 4DOHE 3FB6A 3QFJB 4HQQL 1AXIB 3DSFL 2VE6B 4JFEA 1AXSB 4YLQT 5CUSH 3RWDA 1RSFA 1DQMH 3JTTB 4UTBH 4G6MH 3VD7A 4HKBB 4PJEF 1K2DB 4KKLC 1BFSA 2J8OA 1BZ7B 3QHTC 1TCMA 4QHLA 4H8WL 2VL4A 4ZS7H 2VDRH 2ZUQB 3W39A 1T03H 3D39E 2AK4D 1C5BL 4G9FA 1YY9D 2BHUA 4OQTL 1GL4B 5F7DB 5L88L 4XMLH 4LPTA 3T3ME 3GSOA 3DXAA 3IAGC 3DSFH 4LRIA 3PGDA 4YFDB 5KSAD 5CUSL 4H25A 2HT4C 2CKBL 2FGZA 3AS0A 1PYWB 4JY4A 5CZVL 4HS6B 4BQCA 1BD2D 3C60A 4XWOD 1NEZA 2IAMA 1KTDB 3C08L 2Q8BH 4DN3L 1QLEH 5HJ3A 3WKML 4WI2A 4JQVA 2WBKA 1EX0A 4NC1E 1CE1H 3ALXA 4QRPA 5A3ID 2YK1H 2JCCB 5C86A 1DQDH 2CO6B 4OGYL 3DGGB 5IFJB 3QQ9D 4R7DA 5AEAA 1EGJL 5KS9E 1T80A 4KRPD 4IRZL 1KIPA 1KNOB 1U58A 2EXWD 3GSUA 1SJVA 3WJJA 4MA3A 4YXKH 3SN6N 4BQ6A 3VWJC 2D7PA 1UWXK 3L3JA 3GSNA 3RVXD 2IH1A 1LO2H 3FZUC 4Z7WA 4JPIA 4B5EA 5I16B 2CLRB 2P5EE 1A9BB 1GOFA 3UDWC 4KJPC 3V6OE 5DMKB 1EFXB 3BQUB 3F12A 5FCUH 1OTTC 3C09C 5HYIA 4N9OB 3NIFE 2EDTA 4G6AD 1HIMH 1KPVB 3TC9A 5SV4A 4MCZB 4DVRH 2FHCA 3FOLA 4QRPD 1Z9LA 4LLWA 4Y4FB 1KF9B 5TQ0H 4KK5D 4OM1L 1BPVA 4Y5XA 5DFVC 1F8TL 2ATPB 4EIGB 1IAMA 3QXAB 4NO0B 3BO8B 3K81A 1WBYA 1RZGA 4G6FD 4KH2A 4NC2B 1ROWA 3C60C 2EDNA 4NJAH 4O2EA 3TBTB 1E4JA 4GKSA 4G6KH 1EH9A 1Z0MA 5CZVH 1FH5L 4D0DB 2O5YL 3MUGA 3VFWA 3IS1X 4I4WA 3BD3A 4G9FD 1XGRA 5KG9B 4KPHL 4XXDB 3PHQB 4Y16D 2Z92B 1OGTB 3FB7B 2WP3O 3WKMH 1ZHLB 4RFNB 3GMOA 4WFGE 1MCJA 4JCLA 1B0GB 2HN7A 3BW9B 3L6FA 5HI5C 4QRTB 4WEUD 4NQVB 5BQ7B 5JMRA 1DQDL 1WFOA 2AV1B 1N0XL 4V1DD 4ZS6C 1OY3B 4HLZH 1E0OB 5FDYA 2V7NA 1N5AB 2Y72A 4N0CC 1F4XL 4PJAB 3MRFB 1Z3GH 4R7NB 3K1DA 1OWRM 4OLWL 3F7RA 4J8RA 4WO4B 3MRLA 4QOKB 3EBAA 4NRZA 1S9XA 4HWNA 5CINL 5J57B 2H1PL 43CAB 1NMAH 4P9HC 1TQCC 4ZUWA 1AR1C 4WO4C 4OD3H 4LP5A 2QQLH 2DBLH 4K3EH 1AGFB 3ZT7A 3OTTA 3AAZA 1F4YH 2CLZA 1R24B 1ZT4A 4NKOA 3WD5L 3NFSL 3BIBX 2DQDL 1C5DA 1WLHA 4P4KD 1NDGA 2CDGB 4W70A 1RZKH 2NY1D 3CX5K 1IGYB 3HNVL 3PDDA 4U2YA 5EOTB 2UWEE 4APQB 1QG3A 3VA2C 3H0TB 4KK6C 3RWGA 2VXTL 4NKMB 4LLYA 5J3HD 3MJ7A 1INQA 1S5HA 1R3KB 1UJ3C 2J8UE 4P2RD 5CINH 2Q6WB 5GGQH 1QSFA 2BFVL 4WY7L 3QAZB 3IXTB 4WV1C 1LO4H 2Q3ZA 3W2DH 3KPQB 3S4SG 1YMHB 3QEQD 2DRUA 4LFHG 3ZKNC 2DS4A 1A7QL 5HHOD 4HLZG 3DX7B 4CW1B 3DARA 1MCSA 2E9JA 3HNVH 3PGFH 4OZFH 3H9HB 4WI6A 2G75A 5IBLC 4YAQB 5TDOA 1T5WA 3V5DA 2FJHA 2DD8H 1EIBA 4XMPH 1JPSH 2P8PB 4O51A 5HPMB 4PRPD 4UBDD 4BFIB 2YKLH 4R2GB 1LO5A 4HPYH 4JY5L 4KUZH 3MRCB 2APTA 1FVEA 3ZDYE 3EIFA 2VUYA 3FRPA 5E2JA 1CE6B 4YZFE 4Y4FC 4A6YA 1U8LB 5F7EH 3IFPA 4UDTA 5IMOA 4FRWA 2MPAL 3FQNA 1HK6A 5ALBH 3GI8L 2M1KA 3QIWD 3PGFL 4ZODA 5IVNA 5FUCC 3EOTH 3IDXL 1Q1JL 3OMZA 1RFDH 3EJJX 1U2HA 4WO4A 4PJIF 4KI5D 2GSIA 5D4QA 1OLLA 3U6RB 4NNXB 1CICA 3KXFB 2P44B 4PV9B 4LU5H 1HINH 1Q9OB 3HRZB 2E8YA 5HY9A 1IGJA 3VCLA 3CK0H 3LZFH 1OW0A 2DWDB 1VGKA 1Q94B 4LPXA 3SDAA 2DQDH 4S11A 1IGTB 4U6VL 3RTQB 3T77A 3IU4H 3ILQD 3CZFA 2F8XC 2VISA 2FX7L 4GMSL 2G9HB 4CAGA 1S7VB 4JRXA 1RIVH 3RDTA 1SYVA 4XGZB 4MJ5B 4WY7H 4OCRH 5F3HA 5L8JB 3FOMA 5L8KB 3UTTD 2VWEC 4M7LT 2Y7QB 4YNYB 1LO4L 1HKLL 3RTQA 3QDGE 3CCHB 1U8LA 1M7DB 3HMWL 3O2VH 4P99A 3W0WA 1SY6L 1X5ZA 3ZYZA 2XNAA 4JB9H 3UJTH 4L4VD 1Z2KA 1FFNB 5GRUL 3D25B 3QFJD 4BFIA 4HT1H 1JPFB 2F5BH 3E3QE 3F7YA 1T6VN 1NSNH 4LLWB 4KZEH 5TF1L 4DFIA 4RBPK 4HW6A 2DQTH 3D0LA 4ZTOL 3QDME 1Q38A 4Q6IC 1RUKH 3BIAX 1JNLH 2IADA 2X41A 2ZSWB 3P11L 5K9JH 3QIUB 2UUDK 5F88B 5CBAA 3HNTL 1U8QB 4YXHH 3FQWB 1QFWM 3BD5A 1VGEH 5ERWB 1NH6A 1NCAH 4GRLA 1QHPA 3IDXH 1EERB 1JZ2A 2KH2B 3U4AA 4WDIB 1G7PB 2DM7A 3B2VL 1ZGLB 1BD2E 3ZKND 3KPRB 4NQED 3EW3B 3GJFH 1BD2B 2ITDB 1T5XB 5LBSL 4XWGH 3SDAC 4M7ZC 4PP2B 3UC0H 3WXVL 2VR9A 2AEPL 1MCLA 1U8QA 2PTVA 4V2CB 1A9EA 1JPGB 3CH8A 3QIUA 1P1ZB 3LQZB 4M6NL 3RZCD 4NRYB 3SGEH 1NGXA 1UKTA 2HRPH 1KEML 3LKPB 4JO2H 3A67H 4PRAB 4TVPE 1J87A 4H88L 2ENYA 1DE4B 3MRLB 4KK9D 4Z7QE 1BM3L 4OLXH 5AUMB 3T8XB 5HHXH 4K8RD 1OQOA 1UWEH 1DSFL 3KPSE 5KAQF 4MDIB 1WWBX 2ADGA 3AREC 8FABA 4PREB 4CJ0A 5GSVB 2A38A 1NEZB 1KGCD 5IFAH 4LF3A 1AXTH 3HC3H 5H2BB 1RZKC 4XPGL 1NGQH 1EZVY 1A14L 1MJJA 1SY6H 4KRNA 3S5LB 1OWWA 5FA4B 2CK2A 3D39B 4IIQC 2DDQH 3FO2B 5F8QC 4H20H 3C8KA 1CTNA 2Y5TA 4IOFC 4YPGB 2VABB 1TTGA 2V2TA 4QHLB 3R8QA 3K4AA 5FYKU 1J8HA 1AFVL 3MV8E 3TP4A 1BOYA 4Z8FL 1DEDA 4LBEB 5CS7A 5F9JB 4P3DA 4U6HA 3WDHA 4ZMAT 4AG4L 2QHLA 4NT6A 4NQXB 3W11D 2AERT 3S5LG 1RUKL 5FA3A 3U0PA 3X14B 1RZIA 3QDAA 3LEXA 5IT2L 3TA3C 5I8KH 4PB0H 4OBRA 4QRUB 1DR9A 3KXFA 3NZHL 2W0PA 4RISL 1SJXA 4JZJC 3OJ2C 5IF0B 3DNKA 3KXFE 4JDVA 4LCWB 1XAUA 4MXVE 3G04A 1ZWIB 1Y6NR 4Z8FH 1Q0XH 3C9NB 3MO1B 4OJFH 9CGTA 1NDMA 4MHHG 3T0BA 3UC0L 1P53A 4MCZA 4NKIL 1R5VA 2EKSB 3LAFA 5HHPA 3U1SL 1T1ZA 3IFPB 2FR4A 5GGRY 3UPRB 3QWOB 4LCCC 1OGAB 2VR5A 4WW2A 5AD0A 4NSKB 3QP3A 2BCKB 1Y6MR 4JPIB 1LO0L 4X7FC 3QQ3A 2AK1H 4LVNC 3UTQB 1HSAA 2X1PA 3VFTB 2JK5B 3CH1A 3B9KB 3C2AL 1VHPA 4JDZB 4KKAD 1KJVA 1PY9A 5E2UL 3DX7A 4CW1A 3O0RL 4R0LA 2DM4A 2DTSA 2F19L 2N7AA 3GJFB 3T3PE 3KG5A 2NXYB 2GITB 1A14H 3TBSA 3IKCA 1XIWD 3BT2L 4M93B 3B3IB 2DKSA 1UVQA 3U7WL 3QXTA 4PJCA 1EJ6A 2EC8A 2R0KL 3B6SA 4HS3B 3UO1H 3I3DA 4U1JA 5BOZG 1MCCA 2YBRA 3WXWH 4YQXH 3B9KC 4DCQB 2APVA 4F3FB 1U0QA 1BF8A 2D7OA 3OWEA 3VMNA 3EYFA 1DTUA 1FGVL 3WDIA 5ADPH 5ENWA 1YC7A 1KUMA 4XCCH 4YDVA 2UWEB 4Y1AE 2VH5H 1LNUA 1WBZA 4DK3A 1S7SA 4GW1A 1I8LA 3HLAA 4P46B 3NZ8B 1DVFA 5CLWA 1DBKH 3H9SD 5ISZA 4PGCA 3NPSC 4NFBA 2J5LC 1QVOA 3MUJA 4XVJH 5J6HA 5JOFB 3EYVB 1UZ6F 2I26N 5KW9L 4HHAA 2J88H 4P5KA 4OBSA 3QUXD 1C5CH 4HF5L 1LP9F 1DN0A 4MXWH 4C83A 4CVWA 1K6QH 1T0NB 3MGTB 3W5MA 4LCCA 1K2DA 1ZHNB 4QNPE 4WW2C 4HUWA 3RGVD 5EA0L 3VFGH 2I9TA 4RDQF 3DX9A 4PJEB 1RJZB 3RJQB 2EYTA 1OP5K 3T0EE 1DBKL 3PGDB 4KUCD 2IGFL 1LQSR 1M6OB 5I30H 4DCQA 1R3IL 3P4MB 2R2EB 3BVNA 1G9ML 1XGQB 5E8OB 4X6CB 4U1JB 3W39B 3BW9A 3L6FB 5F9WC 3ULUL 2E8ZA 4JO1H 4XRCB 5B3JF 4R0LC 4KXZI 3U9UA 4HF5H 4MXWL 4RMWA 1NFDE 2FDBP 2J4WH 5E2UH 2FL5A 4RAUA 1XGRB 3GBLA 4KDVA 43C9A 3CVHL 4KI5E 4MAYC 3V4PH 1L0YA 4RGMB 1P4LA 3P9LA 1V3KA 3QIBB 5KVMC 2Q1EA 4QRSA 2ED8A 1LP9A 4J3XA 4K2UL 1P7HL 3UO1L 1CIUA 3CUPA 4PPTA 3MUY1 5F7FA 1DJSA 3OG4B 4X5XB 4F7PB 3SO3B 5I1IH 5I8OH 3MRJB 2FIRT 3SDCA 1KIRA 2C4XA 4HUUA 4XHJD 3OR6A 1ZOXA 1YN6A 4M4PA 3FOLB 2LTQB 5T3XD 4XCCL 2WWKO 3J7HA 3N1PC 3TWCL 4BUHA 3PQYB 1JPTL 4HIXH 4NO2B 3V4PL 4OCNC 2YUXA 3GBNH 3PDOA 4L3CB 2HJFB 5H35B 1TQCB 1AO7A 3L5HA 1CG9B 3MJ8B 4U2ZA 1L7IH 1OPGH 4QHKI 4M61B 4JREC 3TO4A 2J88L 1QPXA 3P0YL 3ARWA 1RPQA 3EO0B 4Y4KA 3HI1A 3PP3K 5IIEB 1DBML 3H9SA 5ISZD 1U58B 1LEGB 4R4FH 1MI5E 4KQ4L 2PO6C 3QBTB 3UX9B 2MCPH 4XPBH 1NCDH 1A22B 4KRPB 3DVFA 3X13B 1JNHA 4YDLC 4MJIB 2VLKE 3LQAL 1MCIA 2NY2B 5KSUB 1B2WL 1J0YA 2MTPA 5GGTH 4EZMA 3DJ9A 3PGCB 3V6ZA 3P0YH 2WQRA 1BWWA 4U0RB 3L5WB 3M8OH 1CT8B 1CQKA 5B3NA 5T1LB 5HVGB 2EDKA 5CD3A 4YBQD 4L4VA 5BRZE 4KQ4H 1OF2A 4XPBL 2MCPL 1RVFH 2ADIA 5FHAL 1KCRL 3WEXB 1FBIL 3TPUA 1OSPH 4K2UH 4TTGA 1FNGB 2PNDA 2ZUXA 5BXFA 5J12B 1MCOH 4H1LH 5LCVL 3GUTB 2F53D 3M8OL 1BZ7A 2NY1B 2NXZB 4M6MH 3KYAA 1FE8H 2XT1B 2VAAA 4JPKH 2YEZB 3OX8B 1IGFL 5KJRH 4OD1L 2BRRL 1M1SA 3ZTNH 3TFKD 5IFHL 3OXRB 2CLVA 1B88A 1H0DB 3KDMB 4HWZA 2YWYA 5ID1B 4P9HH 1CICD 1MCOL 4NQDB 4P2CG 5C0BE 4DOHB 4N0FA 25C8H 2PW2B 4FQLH 4OUUB 1CR9L 1FZJA 1MHEA 3AB0C 4OCSH 1RJYB 1AY1H 1S7WB 1KLUA 1IGFH 2C4FT 4M62L 1FL5A 1T2QH 3NH7L 2LU7A 3GMQA 5JXED 1K4CA 1U8PA 3Q5TA 3ZSSA 5GZOD 3VRLF 2BVEA 2R69L 4JFHE 5C09D 3O9WA 5FB8B 3NA4A 5CCKL 2BMKB 3OKLB 4EQ2A 4FFYH 4YHPA 2X1OA 4JFYB 1U3HB 1P7QD 5I1GH 2HA1A 3ARPA 3O2DA 2BZDA 5DQJA 4HWBA 4QYOB 4JLRB 3K1KC 1FFPA 1JMZA 3U4BH 1FP5A 3MLWL 1R0AH 5E4EC 4M62H 3DVNA 2QQKH 4Z78B 5E99L 2X4UA 3VD9A 3T09A 4ZDHA 4I48A 3EGSA 3KXFD 4E5XA 4XWOC 3RVWC 1OSPL 2AI0L 4PUBH 5CHNA 2R9HD 3EYOA 1N8ZA 1CXEA 2YMXL 4G42B 5EU3A 1RD6A 4JLRA 3GSQB 4DKEH 4U3CA 1EXUA 1B0RB 2FD6H 1TNMA 1UJ3B 1UM6L 2EDOA 4YFLF 2G5BB 3U79A 1RUPL 4PJDA 3MNZA 5L0QB 4YDJA 4NUJB 1BVZA 2XIDA 4W6XB 2BRRH 5GGVH 4PJDE 5J11C 5I1EL 5JR1L 4P4KA 3KLAA 4D3CH 1DL7H 4HKZA 4DZBB 1P2CB 2ORBH 1G6RB 3O6LH 4YDIL 1B4RA 3VFRB 1AGEB 4NNXA 3O6FC 4HBQA 5JW4R 1B9ZA 1AO7E 1OAKH 1X5XA 4XNYL 4NCDA 4DKEL 12E8H 4NQEA 2EDHA 4FQCH 3ZLQC 5I2IA 4GUPB 1T4KB 2FB4L 3WIHH 1CIDA 4HH9A 3FQNB 2P49B 2R4RH 3ARFB 5EBWB 1CFSA 1RAMA 3H9ZA 3GMRB 4RZCA 4AL8L 4B0MM 2A77H 4P59L 3QDMD 5DD1H 1DL7L 3IDNA 3O9WC 2FHBA 2YXMA 1W0WB 1MI5A 1Q0YH 2L7JA 3CSYB 4XNUH 2GK0A 2XV6B 3HTLX 5EN2B 1FZJB 2OJZL 5JDJA 3QIUD 1TENA 3RZCA 3CFKA 4KKAC 2BVPB 2VNCA 3IDIA 5CJ5A 5D93C 3NBNA 1JNJA 4EDXB 2DMBA 4RFNC 4NO0D 1RK0B 1CN4A 1KJ2H 4R3SA 4TULL 3G6DH 4ERSH 4PYGA 4ZXBD 4RX4D 3HC0B 3ARBD 1SVZA 1A7NH 2X9XA 5HI3D 5D7SL 1CS6A 2VDMH 3CFIC 3GB7B 1P7KA 4KVNH 1A1MA 4P48A 4EBQH 3D69B 1YUHB 5ESQA 5DQ9A 5B39G 4BH8A 3WIFB 4APQA 2CIIB 4HZAA 5D1QD 4TSBH 3LHPH 2XA8L 3OZ9L 3ETBF 4Z6AT 4AK1A 4ZYKB 3UTTB 3MLRH 1R6VA 2W07A 3AAZB 4UUJB 1CVRA 4M48H 5TE6L 4GW4A 1OHQA 3V5KB 4WI3A 1QSEE 2ZUUA 3FN0L 4QOKA 5C6WH 3HI1B 1CT8A 2DYPD 4KK8D 5D96C 5FV1L 2DBJA 5BO1L 1ND0B 5DRZB 5JOPD 2AEQH 2YOCA 3QEUB 2APXA 3LHPL 1M7IA 2BVQA 5FGCB 4NWTL 2RQ8A 3FFCB 2ZUTA 1T7YA 4JRXD 1P84K 3S3JA 1ES0A 3LQMA 1PZ5B 3NGBB 3FTGB 2XZCH 2EE3A 2DQUL 5FYKH 3UJJL 5BQ7A 4G6ML 5DRNB 1ZT1B 1URLA 2A0LD 2IH3A 4TUKL 3HZYA 2XQYG 4ZO9A 1BQHA 3EDJA 1EJOL 4ONGL 1WZ1H 4YHIB 4TULH 1CGVA 5CAYB 4LHUG 3I75A 1JIBA 3WN5C 2B4CC 5HHOA 4BK4A 1A7NL 1BZ9B 5FXCH 3V0WL 2DQUH 1MIMH 1C16A 5IESH 1BP3B 3DXAD 4ODXA 5E00B 5I1JL 1JUFB 3PNWB 4Y5XB 1DQLL 1FFPB 4AT6A 2Q8BL 1QR1A 1G0DA 2GJ6E 1T83C 3GRWL 3PL6D 1PSKL 3GIVA 1CFVH 2APWA 2XY2A 1Z5LB 4TUOA 5AWNH 3MLRL 1U95B 3ZE1E 1I3GL 1FYTE 4Q9CA 3S37H 4HIIB 4URTB 5F9OH 1ZGLM 4ZUSA 1T22B 3QCVH 5KSBE 4P5TD 4DEPB 1H3UA 2CLRA 2W0LA 1MJ8H 4OCWL 5E8EA 3S34L 3RGHA 5IGXL 1D5IH 3JV0A 4PY7B 1KB9K 4XC3H 1TVBA 4MJ2A 2AJSH 3HE6C 1MFAH 1NANH 5EUOA 2PW2A 1FFOA 2F74A 4L9LB 4IRSC 3SCMA 5DQDH 5JHDB 4H8WH 5JDSA 2NR6D 1G7IB 5LQBL 3OXSA 1U8OA 1M6OA 2EICA 3HE6B 4HWBH 4OQTH 3L7FA 3N85L 4MHHI 4LSSL 4H1LB 1MNUL 5HGAB 4V1DA 3RUGE 2YRZA 2DKMA 3UJJH 1JL8A 3ULVE 2AK4B 1D6EB 1S9VA 3ARGA 3BDXA 1MVUB 4NFCA 5E6IC 1HH9B 4LASL 1HWHB 3QO0B 5D7IE 5KSAB 4MD4B 4FQQB 2FHFA 1MWAL 2WMPA 3Q6FA 1FIGL 3IRPX 1SJEA 3TBVA 3DO7B 4L8SB 1W8OA 2HJKA 3WYRA 2YK1L 4PJCB 4PGCB 2YWZA 5BJTB 2YRLA 1R3JA 1MPAL 1OP5H 1UWXH 3ARQA 1HEZA 4OGYH 1CD0A 4LLDB 4AMKH 3PWLA 4PGEA 1A1OB 4KJWC 5J6GB 1P69B 4L4VB 4GG6B 1T83A 4NJ9H 5GGSY 2HFEA 2V9RA 5EUOB 2BDNH 5JA8B 3L5WA 5D72L 1TVBB 5FECB 3DGCR 2D0GA 4PRDB 3D9AL 4JN2B 4PJFE 2D9QB 1FO0A 2A83A 1E6JH 2NYYC 3WNPA 4XNXH 5IV2B 4N5UA 1T22A 1KTRL 4H1LA 5HGAA 1T21B 1JNHB 4OZGE 4AMKL 1P84J 4O58L 3STLA 2ICWB 3WFDL 1W72B 3HE6A 3MODL 1MJ8L 3IAQA 4OCWH 5GRZA 3EDKA 1HIML 5DD0H 1G7MA 1I1AD 5JHDA 1EFXD 1EUTA 1MELA 1S7UB 1E4XL 4NOBA 1NFKA 4PJHF 5GS0D 1AP2B 3O8XC 1CXLA 1A4JA 3VMOA 5DQDL 1F8TH 4NM4H 4WU5A 3ARGC 4OD3L 3IFLH 1KJ2A 2PXYC 1J8HE 1F4YL 3CX2A 3KPTA 1IKFL 1A7RL 3HUJE 1YNTA 3GMLA 4LASH 1Z0NA 1F97A 4M9PA 5C0IA 4OFKA 4U7SA 1FGNL 2X4RA 1F58H 1YY8B 5DJXA 3ZE0F 1T7XA 1FIGH 2VDPL 5JLZB 5L7XL 4K3DL 2JB6A 2V2TB 3LRHA 4JFDE 3BJLA 1I4FB 3LSOB 4CVZA 2DN7A 4Q97A 4E42A 3IFLL 3MLTA 1T21A 2BSED 1ZLSH 3QNYB 1ZSDB 2XN9E 5HHOB 1N0XH 3L3IB 3ALWA 1KLFA 4Y5VB 1I1CA 3OGCB 2V5RA 4NT6B 2NX5B 3IFNL 1VPOL 4P23C 4X5LA 3SE4A 2ATKB 4P2OD 4JFPB 4I0PD 5J0BA 2ARWA 3DURB 3VRIA 2NY5C 4G3YH 3V5KA 4OD2B 4G8EA 2IF7A 1R3LB 3MGOB 3BDYH 5K9OB 5I66A 5EBMB 4NCC2 1TETL 2UZYB 4PP2A 1M7IB 2OM5A 2H41A 5HHVL 2GTWA 4LQFH 4QRQA 3QYCA 5GRJL 3FJTA 3JV6B 1BFOB 1I7UA 2YD7A 2QADB 3BE1H 4WDIA 4PJ5B 2OTPA 3LN4A 4YIQB 4WNQA 4XH2A 3IF1A 4LAJH 3VXTA 4JO4H 5GGQL 3LS5H 2AK4A 4LU5L 3TIDA 1IM3A 4UQ3B 4JKMA 5CBAB 2AK4E 4J6RL 3W2DL 4NPYA 4OQ1A 1CDYA 1FIEA 3U48A 3LZFL 1A9EB 1JPGA 4KGLA 1TETH 1JP5A 5JMOC 4EDXA 4KV5E 1BJMA 4JG1L 4N8VG 4OCYH 1F58L 3ARGD 4Y1AA 4YC2C 5CP7A 3UXFA 4CN6A 3NGBC 1HXYA 3QG7L 3QUZD 3NCYP 5GGSB 3CVHB 3MNWA 1FFNA 1RIVL 4HCRH 4RGNB 4GRLB 4S1DC 3FT2B 3CXHK 4M8QA 5D7JB 3NIGE 5CEZE 3IDNB 3ULUE 1KJ3H 3X11A 1OQXA 3O4LB 4CKVX 4KVCL 1QNZL 5C0AD 4JEGB 1U95A 1JNNL 1FLRL 1OTTD 1CBVH 2MPAH 3LDBC 4OZHF 3IFNH 4JG1H 3LKOB 3EUUA 3MRQB 4AT6B 1S9WA 5D9SB 1XR9A 2NY3B 3BKJH 3FQTA 3BZEA 2DQHL 2Y9RT 1X5LA 4HCRL 1NSNL 3RVXC 1WK0A 4XAWH 5L2KB 1HHIA 5HYFA 5A2IH 4NHUB 2VC2H 4F9LA 3EYUH 3P11H 5K9JL 1FFRA 2FEEL 4HH9B 4UT6H 4AIXA 5HHVH 4RDQG 5C6PB 4PLJD 1AKJB 1EUUA 2W92A 1EBPA 4Y19D 3BN9D 3RDTB 3PJSA 1ZVSA 1JHLL 3JWDH 3MV7E 3BKJL 3TESA 4JFDD 5GGRB 1JPSL 2ZNWA 2VDOL 3CFEB 5DFVD 4KI1A 4OCRL 4HPYL 2C3HA 4ETQA 3UBXA 3RGVB 5EU4B 2V2XB 3I6KA 3W9DA 2VC2L 3NCFB 3MV8D 4ODWB 2G60H 4GQPH 5T1DL 2C1PA 4KHTH 3T2OA 4KZDL 3HMWH 3O2VL 4MNQB 3GHBL 2QSCH 3QQNA 4MQXD 4OCYL 4PRBA 1VA9A 3QDJB 3V79C 4XPAL 5FGCE 1X5YA 3QEUA 5HPMA 2OR7A 1RFDL 2F5BL 2VZTA 1E4WL 2JLLA 4M7KH 1N8ZB 2BNRD 2VDOH 5C8JA 2NY6D 1NEZG 2VABA 4KZEL 5FDWA 5TF1H 1ZLWH 1EFQA 1RHHA 2G2RA 3QIWC 4GW4B 3HNSH 1NBZA 2DQTL 4ZTOH 3UTSB 3WLWC 4KZDH 3VXRE 2HVKA 5GZOC 4ONHA 4YUEL 2F54D 2RHEA 3W0WE 4GAJL 4YHKH 3OKOA 3BP4B 3UTTE 4XCFL 4AJ0A 3MNWB 3FONB 2ITCB 4PG9B 1HDMB 1YEFH 5FCSH 4GXUN 4MSWA 4CJ1A 5DEFB 5EUKA 4U0RC 5CSZA 3OKMB 1FORH 4PG2A 5ANMB 5L0QC 4PJGB 1C5DB 4AG4H 4G43B 4HFUL 3TV3L 3WS3B 4XXCC 2RFXB 5D5MA 5D7KD 3K8LA 3V52H 4JKLA 3R0MA 4LSRH 3RP1A 1P1ZA 3WNOA 1M7XA 2GJ6D 4R97B 5GSRB 3ZE2E 5GGTA 1KEMH 5ESAB 4L3EB 4PB0L 5GRUH 1K4DA 3MOBH 3IJSB 4KMQA 3REVB 3JWDL 1FNGA 2NY4D 5A2JH 3C2SA 1VSCA 1J1OL 2VKXA 2DJ4A 1MCEA 1Q0XL 4Q7DA 4JREB 2FX9L 5IBTH 3HR5A 3T0VA 5D2NB 3U7YL 2VLLB 2VXQH 3T2NH 3EAKA 4OCXL 3S3PA 3U1SH 1JNLL 3HC3L 1YEJL 1XGUB 2W60A 5DRWB 1I9IH 3E6HA 4UIMB 3MRPA 1N0LA 1WBXB 2IPKB 2IQ9L 4NZRL 4X80L 5AZ2L 43CAA 4LLUB 3MC0A 2VZOA 1PEZA 1A5FH 1GCFA 4ZPTA 5IBLD 2JF1A 2WM0A 5H37G 5F72S 5C7XL 4YE4H 3WS6C 4M00A 5CFHA 3WXVH 1MEXL 5DVOA 3HNSL 1IL1A 2D4FA 3L3IA 2YPVH 1RU9L 3WCYA 2I5YL 3FQUA 3QWQB 1TTUA 1G0XA 5IEHB 1CGWA 3OQ3B 3FB5A 5LWYL 3MREA 5ECJE 3WDJA 4JO2L 4PGBA 4MAYB 4Z7VA 3KPOA 4Z7UE 2R0KH 1ZLWK 4F7MB 5DD6A 2IFFH 2HVJB 1G7LA 4JPVL 5HGHA 2VXUL 3QPQD 2FEEI 1KPVA 5ADPL 3MLYH 4I4WB 1G6RL 3NMEA 1X7QA 1VFAB 4WU7A 2FECL 1NGYB 1RU9H 3KPPB 4I2XB 3TCLA 5JTWA 3CFCH 2HAZA 3ARZA 1YN6B 4M5YH 5DURD 3H9SB 3Q2CA 4O5LH 3ROOB 4MNQE 1LDPL 1UXSB 1ZLUH 3ZDXE 4H20L 4QXUH 3VG9B 1VKXB 3MOBL 2AK1L 4JFYA 1CICB 5DMIH 2ATPA 3EOYG 1N7MH 2GJZA 5FB8A 2GSIB 1J1OH 4F2MA 2ERJB 2BXZA 1XGPB 2YSSB 3LIZH 2F5AH 4JPVH 1UXWB 2D4DA 4NP4H 4X98B 4M7LH 5LGJA 4NN5B 1OLZA 2CJUH 5I1DA 3U7YH 4CVXB 3MLYL 2OX5A 1IE5A 1NBYB 3O3DA 5C0ND 2F19H 4XZUA 1P7QA 1SJHA 1YEJH 2AQ2A 1RQ5A 4M5YL 5F3BA 2L4OA 2RCSH 3FO0H 4LEOA 5I8CB 4YX2H 5IVZA 5C08E 1YN7A 2A9NL 1ZEAH 5C3LD 2CR3A 1WCBA 2W9LA 2H6PB 1J9CT 2O5XL 3CUPB 4WEBH 5ILTL 2DM2A 4I0PC 1UB5A 4NQDE 4J4PA 4MB3A 3AS3A 3D18B 4JG0H 4M7LL 4RNRA 3DUUB 2FEDD 4GQ9H 3T3PF 3VG0H 3UDWA 4EN3D 4OLZH 2NY4C 3D0VA 5EDXA 3WL9A 3CLFL 3LD8B 2EEAA 1S9YA 1OP9A 1XF3B 3QJHA 1Z9OA 1IGIH 4AH2B 2JCCA 2VLJB 3T3MF 2VDQH 1X5IA 2I25N 4D0BB 2IMNA 1FLTX 3KS0H 4FXGA 1OB1A 5ETUB 1IAIL 1INQB 3PHOB 3OJDB 5DC9B 2Q6WA 2HKHH 3WSQL 4XHJC 1DBJL 4DAGL 4ZTPH 3VGFA 1H9VA 4P46A 1KTDA 2IAMB 3UEZA 2EYTB 4YHML 5EBGA 3O0RH 2FH6A 5E6ID 3VXMB 2VB5A 2UWEA 4HIXL 2Z8SA 3GBNL 1PEWA 5I76B 1F6LL 2P48B 3DMMB 5H8DA 3QUZB 3DXAB 1XZ0B 4UMGA 2WNGA 2WW8A 2X4NB 4G8IA 4AEIL 3QWRA 4EUPA 2P46B 5I30L 1WCBB 2ICEB 2YRPA 2CMRL 5J6HB 1QLRA 1LP9E 3ZT6A 3SE8L 1NL0H 2P7TB 1AI1H 3TBSB 3FRUB 5FOBA 3O3DB 3CVHH 5IJVB 2BNRE 1KEGL 3QUKB 3OKDA 1PGRB 2NY3D 3SJVE 4X8JB 3FO0L 1GOHA 3NCMA 2NY5H 3GKWL 2X70B 4ZUSB 2HLAA 3SGKC 4BSWA 1BBDL 4P57A 4U6YB 5DHYB 3T4AA 4NKDA 3BYTA 4S1QL 2VLRA 2O61B 5IBUG 1LDSA 1B2WH 3GMMA 5C0NC 5JO5A 4ZFFB 1BGXH 4XP6H 1JFQH 3L3DB 5I1IL 3FT4A 5I8OL 4QXWA 5TH2A 2MFNA 1K5NB 4NWUH 4RA3A 1DBBL 1K6QL 1T0MB 3QEGL 4LPVA 1I7ZB 3WNKA 5KG9A 1WFTA 3ARBC 2R9HC 3T4YB 3VA6A 1M71A 5FM4A 4CRPA 3LB6C 3MUGB 1KTLA 2HT2C 3SY0A 1MRCL 4KFZC 2OK0L 5IVOA 3KJ6H 4XVTH 1RK1A 3SE9H 3BPOB 1U8KB 2GY7B 5HSFA 2HVJA 1J0IA 2EDWA 3G04B 4ZUVA 3CH1B 1KCRH 3MRJA 1G9MH 1RZGB 1TFHA 4P46C 1BGXL 3KPOB 4K7PY 2IH3B 4NWUL 5EIIA 3QEGH 3RY6A 2B1HL 3I6LD 1HYRC 4R8WL 4YHMH 4OZIE 1RK1B 1Y18A 3MBEA 1EAPB 5C0AE 5BV7H 4M1CC 2X89A 1AQKH 4RAUB 3T1WA 2FYYB 5I1AA 2WWMD 1HQ4B 5AAMA 4OF6A 3HUJB 4ZPTB 2ZJSL 1J8HB 1QUNA 3CXDL 3UROR 5IQ7H 1ZWIA 3P77A 1KB5B 4MNGE 3ULVH 3C5ZC 4HH8A 5IF0A 4WCYH 1J86A 2OXGA 5JUEL 2F54A 3QH3A 2GYSA 3DV4B 5JZ7C 3QDGD 3ZDZF 2R56H 3VFMB 5DRWA 3P73B 3JUZA 1V3LA 4JHAH 3SGKA 3TWCH 1JN6A 4WGWB 4F80A 2P43B 1U8JA 5DK0B 5DR5H 4I0PB 2JKXA 5C0EB 3FRUA 2OR8A 4BH7A 4ZUTB 5INDA 3DGGA 1G7QA 1L7IL 4XP1H 4OZGB 2HTLD 3BGMA 1IAIM 1T89A 3NIDF 3SKOB 2V9TA 2VKWA 3ARBA 3QG6A 1BOGB 1HHHA 4PJFB 3LKPA 4CMHC 2DLHA 1DVFB 3NZ8A 2UWEF 3HE7C 4RFEB 2NY0B 5EO1A 4N1HB 3ARSA 4UB0H 4NCC1 4OD1H 2OK0H 4CMMA 4XP5L 1WIOA 1CL7L 1L0QA 5GSVA 4P5MA 1IARB 3CMGA 3OKMA 4F3FA 5F7DA 2V2WA 1G7PA 3ZKQD 4LPYA 4P9HL 1JV5B 2NLJA 4XC1L 3HI5H 4PJCE 5C3TA 1N26A 25C8L 1UM6H 2BSTA 1KIQB 2DI9A 4XCEB 3EYSL 5JQHC 4OCSL 3Q3GB 5IR1B 4G6AC 5FGSA 1T2QL 4LDLB 4XVUC 3T0DA 4P5TB 3RTQC 3C5ZA 5EZOL 1JWUA 4OLYH 1YYML 5I1CL 2A74A 3GBMH 4XBEH 4TNWK 2VSDA 4YH6A 4JZNA 5D7JC 3F5WA 2H9GB 1I8IB 5IW6A 2BOCB 4P2OB 5BZWB 5CCKH 12E8L 5CLTA 5K9KB 4L4TA 1JGVH 4P9ML 5MP6H 2Z0BA 1CZ8H 4U7KA 4XX1E 3MRBB 5I75C 3UTSA 4X5WB 1IKNA 2VN4A 1P7QB 1SJHB 1VADA 3V6FB 4OI7A 2ICWI 4EI6B 4FQXA 2WV3A 5IFHH 1F6AB 4YHNA 1VB9A 1XCTA 4XBPA 5C8JB 2VAJA 3I3BA 4XP1L 5KSBB 5EWIH 4XNUL 2GJZB 4I9WE 5TF0A 3O6FD 1HH6B 3CDGB 3HZVA 4GRWE 4DN4H 1JGVL 4P9MH 1KB5H 5F9DC 1YJDH 1LD9A 1IGTA 1NMCB 2E9WA 2XNAB 1V7MH 1JVKA 4QGTA 1ZHBA 2OL3B 1WEJH 3CLEH 3MUHL 3QEQB 1D5BB 4JHBA 5ID0B 4U33A 2ESVA 4MMZC 3O8XD 1CL7H 4P2RE 1EPFA 1SYVB 4XGZA 3RNKB 1G7LB 4MCYB 1KCUH 5ESVA 6CGTA 1YEKH 3MV8B 2VLKA 4FFYL 3HI5L 4N0UE 1A6ZB 1WBXA 5J9PA 4L5FL 1A3RH 1CF8H 3BN3B 3GI9H 4ODBD 5EG6C 2DKUA 4PD4J 2O26U 3O4LD 4OZFB 5CJOH 5J1AB 1S7XA 2OCFD 5I0DA 4JFXB 4PJBB 2Z31B 4DWHA 1QOKA 3CVHA 5BZWA 3GBML 4XBEL 5DUBA 2AI0H 4PUBL 4YHLL 5DJ0B 2GT9A 1W8NA 5D6DC 4KY1H 4PJ7B 3ARDC 3QULA 5HI4C 5MP6L 2P8LA 1QFWL 4OLVH 4L5FH 2QKIB 1OM3H 2R2HA 3VXQA 2RIKA 2HFGL 2VQ1B 2YPKA 3G6DL 5K9QG 1H0DA 3KDMA 5BOPA 5I1EH 5JPMA 3PXHA 1J5OH 5D7KE 4WWKD 3FB8B 5TDPB 5D7SH 3VXUE 3PWPD 3MR9B 3PWVB 4YDIH 3VWKD 3LEYL 4PGJA 2GSGA 4LVHB 4NKMA 4YHLH 3TA3A 2IEPA 4W4OC 3GSVA 5KVFH 1YNKH 5IWLC 4EQ3A 3BP4A 3MV9E 5GRVK 1YJDL 1HHGA 2IALB 5EBMA 3U30B 3OZ9H 4ONHB 1IEHA 1UCBL 4ONGH 3MZGB 5HVHC 4XX1G 5CJQL 3HMXA 4MJ6B 5C0RL 5DO2C 3VXNA 3BSZH 5FIEA 4Z7WE 5JOPE 3TIDB 1RHHB 3L1OH 1G1YA 3C6LA 4MNGB 3VRIB 4E41A 1DLHB 1QSFB 4C56A 2H2SC 4PJ5A 5F9AC 3SDDC 1JYVA 1LWRA 1G7QB 2OJZH 3D3VB 3SDXB 1CLYH 4BH7B 2AEQL 5C0AB 1YEEH 1GIGL 4BZ1H 2R23A 3VFSB 4LPUA 1A3RL 2UYLB 1G7HB 3IDYC 5D1ZB 2LU4A 4ERSL 2VDKL 2ENSA 2OL3L 5EOQL 1L7TH 3GMPA 4GOSA 5DHVB 4G8EB 5DYOB 4X4MA 3SDDB 4F15B 1ADQA 1FNSL 5EORL 5DI8B 2F54B 2GJJA 3QH3B 2Q7YA 3V0VB 1FNEB 2HH0H 1TDQA 1WTGT 5C07B 2JE8A 4EUPH 3CZJA 2EDDA 2G9HA 4U1KB 1E4KC 1KCSL 2A6KA 3RVWD 1KELL 3PHQA 3MPCA 1QFWH 3CZFB 1GIGH 3TGXA 1RIHH 1S5IL 5FHBL 4C4KO 4EI5A 2KBGA 2XQBH 3SDCD 4KTEH 1EAPA 5LQBH 1MOEA 1Q94A 5JW4Q 4GKSB 1V3MA 3D2UB 4M3JA 5SWSB 4RWHA 2BJMH 1AO7B 2CH8A 2GKIA 2VDNL 1HHIB 5F44A 1MCNA 5EU4A 3T0EC 3QQ4B 32C2B 5F89B 4E0RB 5CGYC 4U6XB 3VI3E 1MFDL 1DQLH 1ZXQA 3SJVB 1I75A 4UU9A 3VU2A 3G6JB 1WJ3A 3RHWK 4NWTH 3STLB 1LP9B 3O4LA 1AE6L 4HUVB 2BSSA 5L88H 5BVJB 3DVIA 3Q1SL 2E7MA 4N5EC 5IB1B 4L8BB 2X6MA 3LN5A 4JFQB 5T5NG 3RWHB 4AIZB 1FNAA 2ZG1A 2AJSL 4YDKL 3LRGA 4LSVL 4GXVH 3VXME 5B38G 5IKCA 5IG7B 2ZNXA 1EJOH 5F6HI 1YNLH 1MIEL 1IAKA 1CLOH 3GGWA 2Z8WC 1YMHA 4XHQA 4XNXL 1MH5A 4NDMA 5KSBF 2APBA 3OSKA 2DQFB 1FL3A 4J12A 3I02B 3NCJH 1BQHG 1KPRB 4YFEA 3QWRD 4X4ZA 1EGJH 1NGWA 4LHUD 4XPFL 1DVFD 1CVSC 3SE3A 4EI5C 1XT5A 2J8UB 1JYXA 1YMME 4XB7A 5CIPA 3V95A 4U49A 3GRWH 5J13B 1PSKH 5E9DE 3RVUD 2XQBL 2MKWA 4EJ1C 4C54A 3T0EA 1DLFH 1ZLVK 1WQVT 5E9DA 3L7FB 1HEZB 3GSOB 4QWWD 4QRRB 4F7CA 4G9FB 1QRNE 4PJFA 1WC7B 1SYSB 5IGXH 2OR9H 3E6FA 3OF6A 4JANA 4XC3L 4NJ9L 1MFDH 2ATKA 1BQLH 2J8UA 1FGNH 1EHXA 3BWAA 2Y23A 1IMHC 3TO4C 4UV7L 5L7XH 4DW2H 4PJAE 5FYKD 1U8JB 1DLFL 5DK0A 3ZT5A 2FLRT 1MH5B 3N85H 5SX5K 1Q9LA 4JRYE 1ZLSL 4I18C 3HA0A 5B3JE 3H3KA 1FVCA 2C3GA 3OXSB 4WWKC 5T3ZL 2IBGA 5DD5H 3MODH 1T20A 4Q9RH 4GW5B 3V8CA 5IKCB 4YXLL 3BP7A 3SCMB 1ETZA 5T1MB 4YDKH 5BRZB 1E4XH 4AENA 1RURH 4QOKD 1MWAH 2WWMC 5I6XC 3JTSA 1CXHA 1GHFL 2F15A 3FO1B 3L3HA 1HSAB 5EZJA 2B4CL 4D2NA 5ICZA 1CD8A 3CX5J 1QRND 4N0YL 1MSPA 3U2SB 2L7UA 2VE6A 4ETYA 4JJ5B 2IPTL 3OKNA 1KOAA 3I75B 2MJWA 1RZ8A 2YPLB 5FCUL 4PD4K 4CDHA 1WBYB 1SEBA 2FCBA 1BQHB 3QNZA 4NBZB 2JJTA 1MHCA 2JB6B 3AUVA 4PJ5D 4OM1H 3CFBB 3HE7B 5TDNB 4HAGA 2B4CH 3C6LD 3KPMB 1JYWA 5EZLA 1EEZA 3SOBH 3ABZA 1XGTB 1NMAL 3MROB 3TM6A 3EFFA 4L8SC 4MDJA 2X10A 2VZSA 4NJAL 3X14A 3X3FH 4DJMA 4K3JH 1UENA 4OFDA 1J05A 5TH2B 4WU5B 4WI8A 4YHIA 4N90E 1H3GA 4GBXC 2OR9L 3NFSH 1V05A 4X6BA 5DD0L 1ULVA 5FECA 5I9QC 3B5HA 3KPNB 3MUZ1 1MQKH 1MI5D 5BW7C 5IEHA 5T1MA 5C07A 5FYKE 4I18A 4O4YH 4WWKA 5AYQA 3K3QA 2BFVH 2FSEA 4UQ2A 3S97C 5GS0H 3GMPB 5DHVA 3L3GA 3CU1A 1PBYA 1WWWX 2QEJA 4PJXF 3X3FL 2X2YA 1T66C 4L9LC 1A6VH 1B3JA 5EOCL 1QNZH 4QT5A 1EMTL 1ZHKA 4MA1B 3DO7A 4I5BB 2JCCE 1KT2A 2IJ0C 4KXZH 1CGXA 1S9KC 1DE4A 2A73A 1MHHA 3NFNB 3PWPE 3LRSA 5ANME 4ENEC 3K2MC 1PYWA 3P4NB 4JY4B 1F13A 4FFZH 1MHPL 5HVWA 2OTUA 4J6RH 2JJTC 2H45A 4PTUB 1FYTA 2DM3A 3INUH 3TJEL 4JRYB 5MERB 3BP5B 3O2DL 5IEKA 2IAMD 1KULA 5ALBL 1W72L 3RZCB 5J1SC 3UTSE 3KPRA 3EOTL 3T0XA 2DLIA 4ZQKA 3RL2A 1AH1A 4PY7A 4NO3B 4OGXH 2ESVD 1PDKA 3UTZA 4FG6D 3NIFF 4MQ7A 1YEHH 1MHPH 1CTOA 1NFDF 4F8QA 4FQJL 2ZPKH 3DUUA 3RY4A 3PP4L 5IHUL 4K3JL 4IMKC 4JPWL 4KI5F 4UINL 2YA1A 3INUL 1FG2A 4R3SB 3I85A 3RWFB 1JNNH 2R2HB 3QFJE 2RBLA 3GHBH 4P23D 1JGLH 3O6FA 4KJPD 1N2RB 5C09A 3VFUA 2MMXA 2NZ9C 1X5GA 4BFEA 2DQHH 1XGYL 4XT1C 4HK3J 4YHZL 2YKLL 1UC6A 2OQJB 3RAJL 3MACH 3VXPB 5GS0L 1DEEB 3FO9A 3S88H 4OTXL 3HR6A 3BH9B 3BPLC 3S35L 2PW1B 1XGPA 2VQUA 3EYUL 5EOCH 4RMRA 3SGDH 2WLYA 4LARH 2OS7A 2H26A 1VCAA 3WO4B 4JB9L 3G6AB 4JGMA 4FNLL 1EXUB 3QPQC 4GAJH 3FT3A 5EULV 3ET9F 2ZOLA 1I9EA 2FATL 2NXZC 3JWNC 1VEMA 4P4RA 2R1YA 4X6DE 5HGDB 3IDUA 4EOWH 2H8PA 4LKCA 1KFAL 2VZVA 3BPNC 4NZUH 2JTDA 4Y4FD 4C4KT 2HTLC 4NKQB 4E5XB 1BJ1J 4QHMA 3RAJH 1Y6KR 3CDCA 3M1BB 3VFOB 3UAJD 3VH8A 3LY6A 1K8IA 4PRIA 3LMJL 4KVCH 3TJEH 5K59F 1A21A 4YDJB 3RVUC 5B39B 4Y7MA 1TZHA 4YXHL 1U3HA 4ZSOE 2NY0C 3PABB 2NY4B 4D9QE 4Z7VB 5IMLB 3WBDA 4D94A 2DWEA 4EOWL 4LK4A 4LSUH 2OZ4A 6FABH 4GMSH 3NOIA 4NZUL 2VDLL 4B7IA 1CCZA 4IMKA 2ZCKH 2AV7A 5GS2D 2NY2C 4Y19E 4WFED 3PP4H 5IMOB 3B9KD 5IHUH 4NN6C 2VXQL 4OCXH 4KRPC 3U83A 2CO7B 3RPKA 3U82B 2KQMA 5A43C 2YD5A 1P4IH 3UJTL 2DL2A 3FT3B 2DTMH 5HYSA 5C0AA 2FZ3B 4WEMB 5KVGH 2XKNB 3DYOA 4UILL 2V7HB 4JM2B 2SEBB 1XF5A 3UBXI 1DLHA 4OT1L 3MACL 3VFVB 3FO9B 1PJ9A 3BEVB 4LMQI 3JXAA 4PJ5E 5C07E 4NNPH 2F54E 1U3YA 1A4KB 2MNUA 4Y2DA 4Y1AD 2IBZY 2I5YH 2CUMA 1NGQL 1B4JH 2Z35B 5LWYH 2B8OT 3RNQA 2JJSA 2FATH 3BZ4A 5GXBB 1LEKB 4PRHA 1D5XB 2IFFL 3RWGB 3B2VH 1E4WH 4M7KL 1J1PH 3CSYA 1CFQA 3AGVA 1DCLA 1OT2A 1W0WA 2EKJA 2P5WA 2IQAA 5MEPB 2FX9H 3BEVA 5IBTL 4NFDA 1Z9MA 3NFNA 1OGAD 3G9VA 1G6RH 2BY0A 1QO3A 3LMJH 4OI8A 5DVMA 2CDFB 3SKJL 1MCKA 2BERA 4LSPH 3QI9C 4JQXA 5IT2H 4HKJB 4B41A 4QXUL 3BP5A 3F62A 3JVGA 2GT9B 3D39D 5C0JA 4G5ZL 1N6UA 5TPWH 5GQBA 2KDGA 3QFDB 5JIKA 4JFXA 1NC4B 3M07A 1MWAB 1M05A 3DETD 5IMMB 2D9CA 2IPUG 1ERNA 4JDTH 2Z31D 3AC0A 4RQQB 5K9QI 4NUJA 4LSRL 5FOJA 3WFBL 4LSPL 4Y4KB 1UG9A 2RCSL 4JM2A 3ZL4H 3MX0A 4AM0B 3TNMA 5I73C 2EDLA 3PABA 5HDBF 2JIXD 5IP4A 5M94B 4G42A 3EYOB 1RZJC 2X7LB 4KKCC 4N0RA 4QHKJ 4OT1H 4MAUL 3EZ8A 4LPCA 4E42B 4S1RH 3RWJB 2NY0D 3TIEB 1GC1L 3MLUH 3VFWB 4X6CF 4NNPL 3DYPA 4Z78A 4M8VA 4GJTB 1ZE3C 2YR3A 4JDTL 3VH8G 1C7TA 4PJBE 4PJDF 4A2MA 4L29A 4HUUB 2EH8H 5IIEA 4QY8B 2R1YB 4CU6A 2V6HA 4O5LL 3VXSE 1HZHL 2AQ1A 3P40A 1CFTB 2EIEA 3MRMB 4MA7H 4UIKL 3NZHH 4RISH 3DRTB 1BECA 1J1PL 3AXLA 4Z0XA 5A40E 4JHZA 4I77H 3RZWA 4WW2F 3QR2A 4YE4L 3VXMD 1JMXA 2CJUL 5B22A 2HJFA 4NKIH 4JQXC 1F3DJ 3GSWA 3V7AG 2NXYC 1KGCE 3MRBA 4OF3A 1N2RA 4WUUD 1FVDA 3SGDI 2A9NH 4ZPVB 3G6AA 1T20B 5DK3A 2O61A 2CMRH 4MXVF 2H9GA 2EZ0C 1XIWA 5DHYA 3T4AB 5ILTH 3MLXL 4GRWB 4JQIH 3V8OA 2DIBA 1G9NC 1NUFA 3DX9B 3MA9L 4HXAH 4JM2C 4EUPG 1ODAA 5FOBB 43C9B 5EA0H 5HYJB 4X4YB 3DROA 4OLZL 5F1SA 3NN8B 4TNVK 5EFIB 3WFBH 2E5EA 3I6LE 2VAAB 4XCEA 5F7KC 3V2AR 1J11A 1EEUA 4AENB 1CU4L 1MFBL 3KYMB 5ELIA 5JORB 5FKAA 1BAFL 5CKGA 1QLFB 3E2HC 3MRGB 5DDHB 2FJFB 2ERJC 4PGEB 1Q9KB 3ARTA 4ZTPL 3QT2A 5FM8A 2HG5A 1X5KA 1IC7L 4GW1B 1RJZA 2W0FB 2HT2D 1T04A 4YDVB 2E7LA 3IETB 5CD3B 3O41B 1BLNB 4HJ0C 1SJEB 4B50A 3KJ6L 2AJXH 5C0BD 3MCKB 1A1NB 5TGBB 4MD4A 4QRQB 1YEDB 5C6TH 1QVOB 5I66B 1RULH 3NAAL 1FL3B 4XNZB 5ISZB 2IWGA 1FYTB 3VD5A 3OKKB 2VWEE 4YFLI 4OLEA 3CSBA 1IC7H 2B1HH 3HLAB 5F71A 3N0PB 3UTPD 3IFOA 2HT3D 4I18B 1OD9A 3VFGL 5T1KA 4G8GE 3P73A 1J8HD 4XAKE 1FZOB 5T3XL 2UY7A 1IGIL 4L4TE 1U8MB 5I1LA 1OPGL 3AREB 1NGWB 3EO9H 5IK3B 4J3WA 5IW1A 4P23A 1S78C 3U0WH 1JFQL 3SE4C 2R56L 3GM8A 1UCTA 3EYQC 3MA9H 2J4WL 4FFVC 1L6XA 4TUOB 5ABDE 2HFFA 3BISA 3C9NA 1JK8A 1MJ7L 3K46A 1BFVH 5SWSD 4F7PA 3I6GA 3KPRD 32C2A 3EO9L 3MJGX 2F58H 1BZ9A 2ESVE 1EEYB 3QWOA 4PR5A 4WU7B 4UNTA 4N8VB 1KEGH 4U3HA 4XP5H 1NMBL 3V4VL 4GO6B 2XTJC 3Q6GH 5DRNA 3G5XB 1JZ8A 2Q86A 3F7QA 3GMMB 3ILPB 2FJGA 3DYMA 4PBVC 3ZKSD 4ELMA 1CGYA 2C3VA 5LCVH 1UQSA 4LMQE 4EDWL 4Y0GA 3IDMB 5CGTA 1INDH 5KVDL 2AAVA 3QUMA 4WTZG 1NCBL 1GPOH 2QR0B 3T1FB 4R4FL 2KQNA 3ZTNL 3L3HB 3RKDD 2ADGB 5D5MF 8FABB 5T1LD 1UB6B 5EO0B 5C07D 1HE7A 4HLJA 5KZCD 4XB8A 4PJ9C 15C8L 1QRKA 1MAML 3B2UC 5DI8A 2R2EA 3BVNB 3L5JA 3QXVA 1INDL 3BKYH 4MQSB 1T0PB 1YPZF 2QQNL 2ZG2A 5GIRB 5D1QA 1ACYH 4UDUA 1AY1L 4HWEH 1B6DA 4H0IA 1WIUA 2I9TB 4Q2ZA 4FZ8L 4U1LA 4PJXA 1ORSA 2UYLA 2R0ZL 5T1KD 1ZHNA 1OW0C 3PUCA 1MJ7H 3MGAA 4F9LC 3DX8B 3MRHA 3ARRA 3MGTA 3OV6A 5HVFB 5FHAH 4P46D 2E6QA 2MOVA 2ZG3A 5FGBA 15C8H 2I27N 4JANB 1QKZL 2VMFA 3EYVA 4WCYL 3PWVA 3MR9A 1I1AA 5JUEH 4E41B 4AY0A 5DZNA 1T04B 3QHFL 4KK6D 5F7LB 3QJHB 2DIJA 1MFCH 3KYKH 4F7CB 1O7VA 3UP1A 4NRYA 4A6YL 3EYSH 1J0JA 1V7ML 2QQNH 4N9GB 4EVNA 1IM9A 2A9ML 1GGIH 3S7GA 1IAKB 3MLWH 3O8XB 1LNUB 1WBZB 3Q48A 4JO3H 3OAZH 2KZWA 2R0ZH 1H15B 1JGDB 4EN3A 1NMBH 3V4VH 1DANU 5CSZB 4MXQD 3IDYB 5JW5B 3ULUF 1NC4D 3NPZB 3ZTJG 4ESKA 1KPRA 4TVPL 5FM5O 4F58L 1KPUA 4OGZA 3OHXA 1NCBH 1G9NL 2OJEA 4JKKA 1T1ZB 1XIWB 1BMGA 2JIXB 1T66D 3G6JA 1V8HA 3GIVB 3FFCD 4PGDA 4XCYB 3DBXA 4JRXB 3SKMA 4C59B 1BVKB 3FQRB 2R69H 5EC1B 2HMID 4GRLC 3T08A 1UJTA 3MOQA 4KY1L 1MFEL 3HZMA 5D1QC 5DJ2A 1P6FA 1KB5L 2GTZA 4LCIL 5KN5A 2CDEB 1GH7A 1J10A 3CU7A 5C08B 3K2UH 1ACYL 2OL3A 1U41A 2ZKHL 4ODWA 1WEJL 3CLEL 3U0PB 1RUAL 4HC1A 2G5BA 2QQKL 5EC2A 1H3XA 2FWOB 3HB3D 3MJ6A 1YYMH 5I1CH 2LFGA 5GS2H 3B2UD 5CZXD 2A1WH 5CHNB 4RFOH 4E0RA 1I7TA 1MCBA 2BHZA 5ITFB 3V0VA 2Q7YB 2ARJA 5JNYB 1CZ8L 3TJHC 2NTSP 5J13C 4J2XA 1KJ2L 4NQSB 3WJJC 4MQTB 3FFCA 4UV4L 3PL6B 3C6SA 5CJOL 3VWJA 1OARL 4EI5B 1P9MA 2YUZA 4HIEA 4O51B 2JB5H 2R4SH 3H3BC 3LV3A 5TDOB 4YAQA 4PYHA 3FZUD 4RFOL 4Z77B 1N5YL 4M4RA 3QEHA 3WE6A 3P30H 4TVPD 4WFGD 1FNEA 5HTSA 4HC1H 3X3GH 5GS1B 4MQXC 1NC4A 2JIXA 2FB4H 3WIHL 5BVPH 1G9NH 5FA4A 4X4XA 2WZPD 4R26L 4U1MA 5TFSL 4N8PA 4JM2D 4OIBA 2NW2B 3K0WA 4Y5XC 1LO5B 2CPCA 1AGBB 1YYLL 4NQDA 4OF8A 1KCKA 5CILH 1NMCC 2HH0L 2EZ0D 2HTKC 3OAYK 4CADB 4FN0A 5ID1A 1T5WB 3V5DB 4CU7A 1LE9A 1YEKL 3C5JB 1A3LH 4HWZB 3KPLA 1CQYA 3PWPB 2XY1A 2CIKB 4L3EA 5IM7A 5FFLA 5FHBH 1NGXB 3K2UL 4ODHL 4TQEH 2YPKB 3VRLE 3BUYA 1KIQA 4LCUA 1SMOA 5HHNA 4D8PB 3TO2B 2VDML 2H32A 3WE6B 2DJUA 5ANMA 3T0WA 3KGRA 3AVEA 4OZGA 2QV2A 4OM0L 3HG1B 1BFOA 3THML 4X99A 4X6FA 3X17A 4UNVA 1X4ZA 1A4KA 4XMKL 4YWGL 4OLUL 5ERWA 3VWJB 3C6SB 1EGJA 2OP4H 2XZQL 1VERA 1DUYA 2YXFA 3BMVA 2OL3H 4RBPH 3RU8H 4Z7QF 2V7HA 2VQ1A 3MJ9L 4K94L 3QUYB 3GRWA 2NY2D 3U7AA 1T2XA 1KCVL 1Z9SA 4MS8C 3LEYH 4OM0H 1FO0L 1TVDA 3BGMB 1EZVX 1IBGH 4IDJH 4AQ1B 3LV3B 1JPFA 5B38B 5KVFL 1KELH 5DVLA 3K7UA 3PG2A 3MRFA 4IMLB 1C12A 1GZQB 3G5YB 3ZYOA 1WITA 4K7PL 3HE6D 5BVPL 3UCRA 3KLAB 2HJLB 3MBEB 1JN6B 3RQ3A 2C1PB 3W0WB 1I3GH 4Z7NE 4X9HA 3IAPA 5B4MC 5JPNA 3RU8L 3CCHA 1GJIA 1F4AA 4H26A 5HHME 2XZCL 4ETQB 5A16B 1I4FA 3HS0A 3NCJL 1DVFC 4IEFB 2UVFA 4MJ5A 4DGYL 5I0ZA 4FQPA 3BXNB 2R1XA 5EU3B 1HKFA 2BNUA 2VTFA 3SKMB 5HYQB 2VISB 1CLYL 1MFAL 3RNKA 4XXDA 4RMSA 4LSQL 4Y5YB 3VH8B 1KTLB 3T04D 5KSVA 1OAXL 3EJZC 2ESVB 3WUWB 4GBXD 3QDJE 4X5WA 2G5RA 4H0GA 1G7JA 4AEHH 2WP3T 4A2LA 1TNNA 3PWNB 1FNSH 4ZFFA 1MIML 3Q1SH 1BBJB 3AM8A 4DGYH 5HYSG 5IB3B 3B43A 4YGVA 2RAMA 2PW1A 3VMPA 4Y4FA 4OLUH 2W38A 3R1GH 4IRSB 2ICWJ 4NQEE 5E2VL 3UMTA 4I3SH 3U46B 1OSZA 1MIEH 2V9QA 5D70L 1C5BH 3FQXA 4U1IA 3S37L 3DUSB 5IV2A 1MPAH 1XFPA 5EU6E 4LLQA 1FVEB 4HX1A 1CDBA 4FTVB 4GLRH 5FYJE 3RVVD 3SCMD 3VGGA 5B8CC 2Q87A 4XP4L 1OTUC 4QRRE 3IDJA 2Z31C 5I74B 3QCUL 2VLKD 4IDJL 4EIZC 2XG4A 3QUZA 4HKXB 3ZYIA 4R6UA 1AIFA 4P5MB 4Y1AB 5EOTA 2CLVB 2G75B 3D5OF 5D72H 5T1KB 5I76A 2AS5M 4W68A 1KIPB 1NDGB 2CDGA 1YQVH 1VACA 3GHEL 3MV9A 1CE1L 5DZLA 2E6JA 3PWLB 1JTOA 3ISWA 4NPYB 3UZQA 2P1YA 1R3JB 1MCFA 1IM3B 4UQ3A 5MEQA 2QTEA 2QQQA 3CSPA 1HHKB 3ARBB 3QG6B 3GNML 2BVOA 4BKLB 5MERA 1JV5A 2NLJB 3KLDA 4IRZH 3QCUH 1IGMH 4PTUA 5INDB 5AYUH 4YXKL 3D0VB 3WL9B 4OGAC 3DMMA 3RIAF 4JR9L 2QR0A 1OD7A 1GAFH 4NN7B 4FQXD 1B0WA 2I9LA 3L9RA 1IEBA 4F7EA 1WZKA 2LABA 1LMKA 3ECBA 2FJFA 3HAEA 5T3ZH 1OT1A 4LOUC 1J12A 5IB4A 5ETUA 2EEBA 2E9IA 1ZHLA 1FFQA 2W65B 2WUCH 4J8RB 5L9DH 3EYQD 1XF3A 3JZ7A 3O3AA 2BDNL 1U8IB 4R7NA 4N1EA 3V0AC 3FQXB 1XF4B 3G6JF 3JTTA 1KJMA 3P9WB 3KS0J 4M5ZL 5D70H 1E6JL 3RVTC 4BSJA 5DJAA 3JWOL 4LCWE 3MLTB 4YGVB 3LOWA 4O58H 1LE5A 1JI1A 4MD0A 5MEOB 2APFA 4QTHA 1QR1B 3UJIH 2NNAB 4UI2A 3QQ3B 3LPWA 1WIPA 4U1SA 5SWSE 5L9DL 3O2WL 5TQ2H 5DJXB 5JXEC 3HUJA 2Z92A 2QSQA 4YHOH 2UY6A 2BOBA 3UPRA 3NA9H 4Z95H 2HLFC 2NW3B 5CIPH 4DW2L 4DQOH 2EIZA 1EEZB 5IW3A 3SOBL 4OKVA 5HGHB 4FFZL 5LGJB 5ICXA 5EIIB 1UM4L 4UT9L 5GS0C 4IJ3C 3RHWF 2OZ4L 3L3DA 4HPOH 5DD5L 3KYNA 3DRTA 2D31B 3AREA 3RX8A 1U92A 3MV7A 5EBLA 1JGUL 3DVGA 3L3JB 4M03A 3ZHKA 2M8XA 4JHWL 4BSWB 1MQKL 4QRSB 2VERN 4L29B 3FQUB 1S7TB 4FABH 5DJAB 2HFFB 2VDPH 1PLGL 3PV6B 4K55A 2NY7L 3W81A 1VFBB 4CMHB 3ULVF 4XCNA 4JO4L 3KPSB 4N0YH 1F3JA 4OV5A 2NMSA 3FO1A 4YK4B 5F9JA 4Z7OE 4RRPG 4ENED 5KTEH 1QSFE 3HUJF 3ZKXB 4HPOL 4JPWH 4UINH 4Y4KD 5GS1C 3WUZA 3VXOB 5DGRA 1ZA3A 4Z7WB 2NR6C 3W11C 1JGUH 3OG6B 3HAEB