4EVCA

Crystal structure hp-nap from strain ys39 cadmium loaded (cocrystallization 50mm)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
143
structure length
143
Chain Sequence
KTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEGFADMFDDLAERIAQLGHHPLVTLSEALKLTRVKEETKTSFHSKDIFKEILEDYKHLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil-activating protein
publication title Crystal structure of Helicobacter pylori neutrophil-activating protein with a di-nuclear ferroxidase center in a zinc or cadmium-bound form
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Metal transport
total genus 65
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4evcA00
3F32A 4CYAA 5JKMG 1Z6OA 4TO9A 3PWQC 4M34A 5GN8A 2GYQA 4DE6A 3U90A 3AK9A 4TOEA 3T9JA 4RC7A 4QUWA 5HJFA 5ERJA 5HJHA 3GE4A 2HTNA 3QZ3A 1TKOA 2IU2A 1JTSA 5D8QA 2Y3QA 1LB3A 2YW6A 1XZ3A 4ITTA 1YUXA 3Q4QA 1TK6A 5JKMA 4DZ0A 3EZ0A 5GOUA 1OTKA 3IQ1A 2C2FA 2G4HA 3ISEA 2V2NA 3AK8A 3F38A 4IWKA 4XKSA 1XZ1A 2WTLA 5J8SA 3BVKA 3RE7A 3SE1A 4XKTA 2Z5RA 3SIDA 1TKPA 3BKNA 3BVEA 4DYZA 5D8OA 3A68A 3PW1B 1SOFA 2CEIA 3KX9A 2FHAA 1O9IA 4PGIA 2FG8A 1O9RA 3KA6A 1AEWA 3FVBA 2JD80 4ZTTA 1NF4A 4II4B 3PVYA 3PWQA 4TOGA 4ZMCA 1SQ3A 2GS4A 3E1PA 2CF7A 4EVEA 2IB0A 4KVRA 1F30A 2XJNA 1VLGA 5GU3X 1L8IA 3ISFA 1EUMA 3AF8X 3IS7A 2OH3A 2F7NA 3HL1A 1JKUA 2V2RA 3BVFA 5JKLG 3E1OA 4PG1A 4ITWA 2YW7A 5LS9A 3PZAA 3R2MA 4MN9A 4RC5A 2QQYA 1JIGA 1JGCA 3E1JA 3E6RA 3PVTB 3WVUA 4ERUA 2ZA6A 3O7SA 1JI5A 1MFRA 3RD0A 5D8RA 1VJXA 3QD8A 4LPNA 1KRQA 3AF9X 3ERZA 3AF7X 5C6FA 2FKZA 3KA9A 3UOIA 3WVWA 1DATA 2FFXJ 1HRSA 3OGHA 3F34A 3R2OA 5JKLA 4CVTA 4KVQA 5GN8B 3NP0X 4LQJA 5D8YA 2V2LA 3QHBA 4RC6A 5LG8A 3KWOA 4DYUA 4LYXA 4RC7B 4CMYA 4M33A 3O7RA 4MJYA 4TW3A 5GU2X 4DYXA 3PVRA 2C41A 2VXXA 1S30A 4MY7A 3KA4A 1LKMA 5J8WA 5GU1X 2BW1A 2XGWA 4RC8A 3R2RA 2Z5PA 3GVYA 5CMQA 4XKUA 4E6KA 2V2MA 2V2SA 1JI4A 3HIUA 4DASA 2VXIA 5D8XA 2XKQA 5HQOA 1J30A 2OC5A 5D8SA 4TOFA 4TOAA 2C2UA 1L8HA 3E1NA 3SHXA 1H96A 3E2CA 4CVSA 1GWGA 1RCIA 4OYNA 2FJCA 4ZL5A 3RAVA 4IXKA 4ZJKA 1LKOA 2JD60 1YUZA 5I4JA 3UNOA 1RCCA 5K53A 4MUDA 2W0OA 1VEIA 3PWFA 3R2SA 2ZG7X 4TODA 3PVYB 2CHPA 5FFEA 1RCDA 2ZA8A 3F33A 4PGKA 3E1MA 2XJMA 4A25A 2FL0A 3NP2X 3WVVA 3BT5A 1R03A 4ZKHA 2V2OA 1DPSA 1IERA 2CLBA 5ERKA 2ZURX 5J93A 4LYUA 2IY4A 3Q4NA 4M35A 3R2HA 1IESA 4PG0A 1LKPA 5FFCA 3GHQA 3E1QA 1FHAA 4RC5B 4ML5A 4ZKXA 1N1QA 2BK6A 1S3QA 2CLUA 3QHCA 4Z3BA 1S2ZA 4AM4A 3TA8A 4ZKWA 4EVDA 3MPSA 3EGMA 4DYYA 4ISPA 1YV1A 3AJQA 1UMNA 5FFDA 4TOBA 4LQVA 2HR5A 2FG4A 2CN7A 3RGDA 4RC6B 5J9VA 2WLAA 5E1UA 5CMRA 5FEJA 3WNWA 2V2IA 3R2LA 4R42A 5CZUA 4Y08A 3FSEA 1QYBA 1BCFA 3PVRB 4CVPA 5FFAA 1UVHA 3AJOA 5IX6A 3KA8A 5JACA 1Z4AA 4Z5SA 4ZL6A 2QF9A 1BG7A 2UX1A 3ES3A 2ITBA 2CIHA 2VZBA 3F36A 1F33A 4ISMA 2V2JA 2Z6MA 2ZG8X 5E2DA 4LPJA 2Z5QA 1B71A 1RCEA 3OJ5A 4YKHA 3QVDA 3VNXA 3F35A 4U3GA 3H7GA 1RCGA 5LG2A 4XGSA 2C6RA 1DVBA 3AJPA 3KXUA 1JREA 3PW8C 5GU0X 4LQNA 2X170 4MKUA 2RBDA 1Z6OM 3QB9A 4AM5A 5LBHA 2CHIA 3E6SA 2ZG9X 4M32A 4KVSA 1BFRA 4ZLWA 1TJOA 4CY9A 1QGHA 4P18A 3NOZX 3E1LA 3PW1A 1NNQA 4CMYV 1JYBA 3Q4OA 3R2KA 1VEQA 4CYBA 2V2PA 1ZS3A 2PYBA 3EZUA 4TOHA 1RYTA 1ZUJA 4II4A 2CN6A 2WLUA 2D5KA 2YJJA 3A9QA 3BVLA 4LQHA 4TOCA 3KA3A 4IWJA 4AM2A 1NFVA 4EVBA 3SH6A 5K52A 1VELA 4ETRA 2C2JA 3FI6A 3RBCA 2BKCA 1JKVA 2BJYA 2ZA7A 3BVIA 4REUA 2XJOA 2V15A 3UOFA 1NF6A 3PVTA 5D8PA 2Z90A 2FZFA 3F37A 3PW8A 3Q4RA 4CVRA 4DI0A 2JD70 5AXSA 5FFBA 4EVCA 2YJKA 1MOJA 3IS8A 4LPMA 2GYDA 3F39A
chains in the Genus database with same CATH superfamily
3F32A 4CYAA 5JKMG 1Z6OA 4TO9A 3PWQC 4M34A 3GGZA 5GN8A 2GYQA 4DE6A 3U90A 3AK9A 4TOEA 3T9JA 4RC7A 4QUWA 5HJFA 5ERJA 5HJHA 3GE4A 2HTNA 3QZ3A 1TKOA 2IU2A 1JTSA 5D8QA 2Y3QA 1LB3A 2YW6A 1XZ3A 4ITTA 1YUXA 3Q4QA 1TK6A 4YVZA 5JKMA 4DZ0A 3EZ0A 5GOUA 1OTKA 3KDQA 3IQ1A 2C2FA 2G4HA 3ISEA 2V2NA 3AK8A 3F38A 4IWKA 4XKSA 1XZ1A 2WTLA 5J8SA 3BVKA 5HU6D 3RE7A 3SE1A 4XKTA 2Z5RA 3SIDA 1TKPA 5JDOB 3BKNA 3BVEA 4DYZA 5D8OA 3A68A 3PW1B 1SOFA 2CEIA 3KX9A 2FHAA 1O9IA 4PGIA 2FG8A 1O9RA 3KA6A 1AEWA 3DBYA 3FVBA 2JD80 4ZTTA 3LKDA 1NF4A 2Y44A 4II4B 3PVYA 3PWQA 4TOGA 4ZMCA 1SQ3A 2GS4A 3E1PA 2CF7A 4EVEA 2IB0A 1F30A 4KVRA 2XJNA 1VLGA 5GU3X 1L8IA 3ISFA 1EUMA 3AF8X 3IS7A 2OH3A 2F7NA 3HL1A 1JKUA 4YXMA 2V2RA 3BVFA 5JKLG 3E1OA 4PG1A 4ITWA 2YW7A 5LS9A 3PZAA 3R2MA 4MN9A 4RC5A 2QQYA 1JIGA 1JGCA 3E1JA 2MGYA 3KHKA 3E6RA 3PVTB 3WVUA 4ERUA 2ZA6A 3O7SA 1JI5A 1MFRA 3RD0A 5D8RA 1VJXA 3QD8A 4LPNA 2V8UA 1KRQA 3AF9X 3ERZA 3AF7X 5C6FA 3VV9A 2FKZA 3KA9A 3UOIA 3WVWA 1DATA 2FFXJ 1HRSA 3C21A 3OGHA 2WWXB 3F34A 3R2OA 5JKLA 4CVTA 4KVQA 5GN8B 3NP0X 3VVAA 4LQJA 5D8YA 2V2LA 3QHBA 4RC6A 5LG8A 3KWOA 4DYUA 4LYXA 4RC7B 4CMYA 4M33A 3O7RA 4MJYA 4TW3A 4W4KB 5GU2X 4DYXA 3PVRA 2C41A 2VXXA 1S30A 4MY7A 3KA4A 1LKMA 5J8WA 5GU1X 2BW1A 2XGWA 4RC8A 4WJG4 3R2RA 2Z5PA 3GVYA 5CMQA 4XKUA 3M6JA 4E6KA 2V2MA 2V2SA 1JI4A 3HIUA 4DASA 2VXIA 5D8XA 2XKQA 5HQOA 1J30A 2OC5A 4X0JA 5D8SA 4TOFA 4TOAA 2C2UA 1L8HA 3E1NA 3SHXA 1H96A 3E2CA 4CVSA 1GWGA 1RCIA 4OYNA 3C1YA 2FJCA 4ZL5A 3RAVA 4IXKA 2CWLA 4ZJKA 3L0MA 3JZAB 1LKOA 2JD60 1YUZA 5I4JA 3UNOA 1RCCA 5K53A 4MUDA 3PWFA 1VEIA 2W0OA 3R2SA 2ZG7X 4TODA 3PVYB 2CHPA 5FFEA 1RCDA 2ZA8A 3F33A 4PGKA 3E1MA 2XJMA 4A25A 3C23A 2FL0A 3NP2X 3WVVA 3BT5A 3W54A 1R03A 4ZKHA 3C1ZA 2V2OA 4E40A 1DPSA 1IERA 2CLBA 5ERKA 2ZURX 5J93A 4LYUA 2IY4A 3Q4NA 3R2HA 4M35A 1IESA 4PG0A 1LKPA 5FFCA 3GHQA 3E1QA 1FHAA 4RC5B 2OKCA 4W4LB 4ML5A 4ZKXA 1N1QA 2BK6A 1S3QA 2CLUA 3QHCA 3V3KB 4Z3BA 1S2ZA 4AM4A 3TA8A 4ZKWA 4EVDA 3MPSA 3EGMA 4DYYA 4ISPA 1YV1A 3AJQA 1UMNA 5FFDA 4TOBA 4LQVA 2HR5A 2FG4A 2CN7A 3RGDA 4RC6B 5J9VA 2WLAA 5E1UA 5CMRA 5FEJA 3WNWA 2V2IA 3D19A 3R2LA 4R42A 5CZUA 3FRRA 4Y08A 3FSEA 1QYBA 1BCFA 3PVRB 4CVPA 5FFAA 1UVHA 3AJOA 5IX6A 3KA8A 5JACA 1Z4AA 4Z5SA 4ZL6A 2QF9A 1BG7A 2UX1A 3ES3A 2ITBA 2CIHA 2VZBA 3F36A 1F33A 4ISMA 2V2JA 2Z6MA 2ZG8X 5E2DA 4LPJA 2Z5QA 1B71A 1RCEA 3OJ5A 4YKHA 3QVDA 3VNXA 3F35A 4U3GA 3H7GA 1RCGA 5LG2A 4XGSA 2C6RA 1DVBA 3AJPA 3KXUA 1JREA 3PW8C 5GU0X 4LQNA 2X170 4MKUA 2RBDA 1Z6OM 3QB9A 4AM5A 5LBHA 2CHIA 2N02A 3E6SA 2ZG9X 4M32A 4KVSA 1BFRA 4ZLWA 1TJOA 4CY9A 2V8TA 3FRSA 1QGHA 4YXJA 5JDOA 3GGYA 4P18A 3NOZX 3E1LA 3PW1A 1NNQA 4CMYV 1JYBA 3Q4OA 3R2KA 1VEQA 4CYBA 2V2PA 1ZS3A 3JZ9A 3N6OA 2PYBA 3EZUA 3UFBA 4KXRB 4TOHA 1RYTA 1ZUJA 4II4A 2CN6A 2WLUA 2D5KA 2YJJA 3A9QA 3BVLA 4LQHA 4TOCA 3KA3A 4IWJA 4AM2A 1NFVA 4EVBA 3SH6A 5K52A 1VELA 4ETRA 2C2JA 3FI6A 3RBCA 2BKCA 1JKVA 2BJYA 2ZA7A 3BVIA 4REUA 2AR0A 2XJOA 2V15A 2G38B 3UOFA 1NF6A 3PVTA 5D8PA 2Z90A 2FZFA 3F37A 3PW8A 3Q4RA 4CVRA 4DI0A 2JD70 5AXSA 5FFBA 4EVCA 2YJKA 1MOJA 4MXPA 3IS8A 4LPMA 2GYDA 3F39A
chains in the Genus database with same CATH topology
3F32A 4CYAA 5JKMG 1Z6OA 4TO9A 3PWQC 4M34A 3GGZA 5GN8A 2GYQA 4DE6A 3U90A 3AK9A 4TOEA 3T9JA 4RC7A 4QUWA 5HJFA 5ERJA 5HJHA 3GE4A 2HTNA 3QZ3A 1TKOA 2IU2A 1JTSA 5D8QA 2Y3QA 1LB3A 2YW6A 1XZ3A 4ITTA 1YUXA 3Q4QA 1TK6A 4YVZA 5JKMA 4DZ0A 3EZ0A 5GOUA 1OTKA 3KDQA 3IQ1A 2C2FA 2G4HA 3ISEA 2V2NA 3AK8A 3F38A 4IWKA 4XKSA 1XZ1A 2WTLA 5J8SA 3BVKA 5HU6D 3RE7A 3SE1A 4XKTA 2Z5RA 3SIDA 1TKPA 5JDOB 3BKNA 3BVEA 4DYZA 5D8OA 3A68A 3PW1B 1SOFA 2CEIA 3KX9A 2FHAA 1O9IA 4PGIA 2FG8A 1O9RA 3KA6A 1AEWA 3DBYA 3FVBA 2JD80 4ZTTA 3LKDA 1NF4A 2Y44A 4II4B 3PVYA 3PWQA 4TOGA 4ZMCA 1SQ3A 2GS4A 3E1PA 2CF7A 4EVEA 2IB0A 1F30A 4KVRA 2XJNA 1VLGA 5GU3X 1L8IA 3ISFA 1EUMA 3AF8X 3IS7A 2OH3A 2F7NA 3HL1A 1JKUA 4YXMA 2V2RA 3BVFA 5JKLG 3E1OA 4PG1A 4ITWA 2YW7A 5LS9A 3PZAA 3R2MA 4MN9A 4RC5A 2QQYA 1JIGA 1JGCA 3E1JA 2MGYA 3KHKA 3E6RA 3PVTB 3WVUA 4ERUA 2ZA6A 3O7SA 1JI5A 1MFRA 3RD0A 5D8RA 1VJXA 3QD8A 4LPNA 2V8UA 1KRQA 3AF9X 3ERZA 3AF7X 5C6FA 3VV9A 2FKZA 3KA9A 3UOIA 3WVWA 1DATA 2FFXJ 1HRSA 3C21A 3OGHA 2WWXB 3F34A 3R2OA 5JKLA 4CVTA 4KVQA 5GN8B 3NP0X 3VVAA 4LQJA 5D8YA 2V2LA 3QHBA 4RC6A 5LG8A 3KWOA 4DYUA 4LYXA 4RC7B 4CMYA 4M33A 3O7RA 4MJYA 4TW3A 4W4KB 5GU2X 4DYXA 3PVRA 2C41A 2VXXA 1S30A 4MY7A 3KA4A 1LKMA 5J8WA 5GU1X 2BW1A 2XGWA 4RC8A 4WJG4 3R2RA 2Z5PA 3GVYA 5CMQA 4XKUA 3M6JA 4E6KA 2V2MA 2V2SA 1JI4A 3HIUA 4DASA 2VXIA 5D8XA 2XKQA 5HQOA 1J30A 2OC5A 4X0JA 5D8SA 4TOFA 4TOAA 2C2UA 1L8HA 3E1NA 3SHXA 1H96A 3E2CA 4CVSA 1GWGA 1RCIA 4OYNA 3C1YA 2FJCA 4ZL5A 3RAVA 4IXKA 2CWLA 4ZJKA 3L0MA 3JZAB 1LKOA 2JD60 1YUZA 5I4JA 3UNOA 1RCCA 5K53A 4MUDA 3PWFA 1VEIA 2W0OA 3R2SA 2ZG7X 4TODA 3PVYB 2CHPA 5FFEA 1RCDA 2ZA8A 3F33A 4PGKA 3E1MA 2XJMA 4A25A 3C23A 2FL0A 3NP2X 3WVVA 3BT5A 3W54A 1R03A 4ZKHA 3C1ZA 2V2OA 4E40A 1DPSA 1IERA 2CLBA 5ERKA 2ZURX 5J93A 4LYUA 2IY4A 3Q4NA 3R2HA 4M35A 1IESA 4PG0A 1LKPA 5FFCA 3GHQA 3E1QA 1FHAA 4RC5B 2OKCA 4W4LB 4ML5A 4ZKXA 1N1QA 2BK6A 1S3QA 2CLUA 3QHCA 3V3KB 4Z3BA 1S2ZA 4AM4A 3TA8A 4ZKWA 4EVDA 3MPSA 3EGMA 4DYYA 4ISPA 1YV1A 3AJQA 1UMNA 5FFDA 4TOBA 4LQVA 2HR5A 2FG4A 2CN7A 3RGDA 4RC6B 5J9VA 2WLAA 5E1UA 5CMRA 5FEJA 3WNWA 2V2IA 3D19A 3R2LA 4R42A 5CZUA 3FRRA 4Y08A 3FSEA 1QYBA 1BCFA 3PVRB 4CVPA 5FFAA 1UVHA 3AJOA 5IX6A 3KA8A 5JACA 1Z4AA 4Z5SA 4ZL6A 2QF9A 1BG7A 2UX1A 3ES3A 2ITBA 2CIHA 2VZBA 3F36A 1F33A 4ISMA 2V2JA 2Z6MA 2ZG8X 5E2DA 4LPJA 2Z5QA 1B71A 1RCEA 3OJ5A 4YKHA 3QVDA 3VNXA 3F35A 4U3GA 3H7GA 1RCGA 5LG2A 4XGSA 2C6RA 1DVBA 3AJPA 3KXUA 1JREA 3PW8C 5GU0X 4LQNA 2X170 4MKUA 2RBDA 1Z6OM 3QB9A 4AM5A 5LBHA 2CHIA 2N02A 3E6SA 2ZG9X 4M32A 4KVSA 1BFRA 4ZLWA 1TJOA 4CY9A 2V8TA 3FRSA 1QGHA 4YXJA 5JDOA 3GGYA 4P18A 3NOZX 3E1LA 3PW1A 1NNQA 4CMYV 1JYBA 3Q4OA 3R2KA 1VEQA 4CYBA 2V2PA 1ZS3A 3JZ9A 3N6OA 2PYBA 3EZUA 3UFBA 4KXRB 4TOHA 1RYTA 1ZUJA 4II4A 2CN6A 2WLUA 2D5KA 2YJJA 3A9QA 3BVLA 4LQHA 4TOCA 3KA3A 4IWJA 4AM2A 1NFVA 4EVBA 3SH6A 5K52A 1VELA 4ETRA 2C2JA 3FI6A 3RBCA 2BKCA 1JKVA 2BJYA 2ZA7A 3BVIA 4REUA 2AR0A 2XJOA 2V15A 2G38B 3UOFA 1NF6A 3PVTA 5D8PA 2Z90A 2FZFA 3F37A 3PW8A 3Q4RA 4CVRA 4DI0A 2JD70 5AXSA 5FFBA 4EVCA 2YJKA 1MOJA 4MXPA 3IS8A 4LPMA 2GYDA 3F39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F32 A;  4CYA A;  5JKM G;  1Z6O A;  4TO9 A;  3PWQ C;  4M34 A;  5GN8 A;  2GYQ A;  4DE6 A;  3U90 A;  3AK9 A;  4TOE A;  3T9J A;  4RC7 A;  4QUW A;  5HJF A;  5ERJ A;  5HJH A;  3GE4 A;  2HTN A;  3QZ3 A;  1TKO A;  2IU2 A;  1JTS A;  5D8Q A;  2Y3Q A;  1LB3 A;  2YW6 A;  1XZ3 A;  4ITT A;  1YUX A;  3Q4Q A;  1TK6 A;  5JKM A;  4DZ0 A;  3EZ0 A;  5GOU A;  1OTK A;  3IQ1 A;  2C2F A;  2G4H A;  3ISE A;  2V2N A;  3AK8 A;  3F38 A;  4IWK A;  4XKS A;  1XZ1 A;  2WTL A;  5J8S A;  3BVK A;  3RE7 A;  3SE1 A;  4XKT A;  2Z5R A;  3SID A;  1TKP A;  3BKN A;  3BVE A;  4DYZ A;  5D8O A;  3A68 A;  3PW1 B;  1SOF A;  2CEI A;  3KX9 A;  2FHA A;  1O9I A;  4PGI A;  2FG8 A;  1O9R A;  3KA6 A;  1AEW A;  3FVB A;  2JD8 0;  4ZTT A;  1NF4 A;  4II4 B;  3PVY A;  3PWQ A;  4TOG A;  4ZMC A;  1SQ3 A;  2GS4 A;  3E1P A;  2CF7 A;  4EVE A;  2IB0 A;  4KVR A;  1F30 A;  2XJN A;  1VLG A;  5GU3 X;  1L8I A;  3ISF A;  1EUM A;  3AF8 X;  3IS7 A;  2OH3 A;  2F7N A;  3HL1 A;  1JKU A;  2V2R A;  3BVF A;  5JKL G;  3E1O A;  4PG1 A;  4ITW A;  2YW7 A;  5LS9 A;  3PZA A;  3R2M A;  4MN9 A;  4RC5 A;  2QQY A;  1JIG A;  1JGC A;  3E1J A;  3E6R A;  3PVT B;  3WVU A;  4ERU A;  2ZA6 A;  3O7S A;  1JI5 A;  1MFR A;  3RD0 A;  5D8R A;  1VJX A;  3QD8 A;  4LPN A;  1KRQ A;  3AF9 X;  3ERZ A;  3AF7 X;  5C6F A;  2FKZ A;  3KA9 A;  3UOI A;  3WVW A;  1DAT A;  2FFX J;  1HRS A;  3OGH A;  3F34 A;  3R2O A;  5JKL A;  4CVT A;  4KVQ A;  5GN8 B;  3NP0 X;  4LQJ A;  5D8Y A;  2V2L A;  3QHB A;  4RC6 A;  5LG8 A;  3KWO A;  4DYU A;  4LYX A;  4RC7 B;  4CMY A;  4M33 A;  3O7R A;  4MJY A;  4TW3 A;  5GU2 X;  4DYX A;  3PVR A;  2C41 A;  2VXX A;  1S30 A;  4MY7 A;  3KA4 A;  1LKM A;  5J8W A;  5GU1 X;  2BW1 A;  2XGW A;  4RC8 A;  3R2R A;  2Z5P A;  3GVY A;  5CMQ A;  4XKU A;  4E6K A;  2V2M A;  2V2S A;  1JI4 A;  3HIU A;  4DAS A;  2VXI A;  5D8X A;  2XKQ A;  5HQO A;  1J30 A;  2OC5 A;  5D8S A;  4TOF A;  4TOA A;  2C2U A;  1L8H A;  3E1N A;  3SHX A;  1H96 A;  3E2C A;  4CVS A;  1GWG A;  1RCI A;  4OYN A;  2FJC A;  4ZL5 A;  3RAV A;  4IXK A;  4ZJK A;  1LKO A;  2JD6 0;  1YUZ A;  5I4J A;  3UNO A;  1RCC A;  5K53 A;  4MUD A;  2W0O A;  1VEI A;  3PWF A;  3R2S A;  2ZG7 X;  4TOD A;  3PVY B;  2CHP A;  5FFE A;  1RCD A;  2ZA8 A;  3F33 A;  4PGK A;  3E1M A;  2XJM A;  4A25 A;  2FL0 A;  3NP2 X;  3WVV A;  3BT5 A;  1R03 A;  4ZKH A;  2V2O A;  1DPS A;  1IER A;  2CLB A;  5ERK A;  2ZUR X;  5J93 A;  4LYU A;  2IY4 A;  3Q4N A;  4M35 A;  3R2H A;  1IES A;  4PG0 A;  1LKP A;  5FFC A;  3GHQ A;  3E1Q A;  1FHA A;  4RC5 B;  4ML5 A;  4ZKX A;  1N1Q A;  2BK6 A;  1S3Q A;  2CLU A;  3QHC A;  4Z3B A;  1S2Z A;  4AM4 A;  3TA8 A;  4ZKW A;  4EVD A;  3MPS A;  3EGM A;  4DYY A;  4ISP A;  1YV1 A;  3AJQ A;  1UMN A;  5FFD A;  4TOB A;  4LQV A;  2HR5 A;  2FG4 A;  2CN7 A;  3RGD A;  4RC6 B;  5J9V A;  2WLA A;  5E1U A;  5CMR A;  5FEJ A;  3WNW A;  2V2I A;  3R2L A;  4R42 A;  5CZU A;  4Y08 A;  3FSE A;  1QYB A;  1BCF A;  3PVR B;  4CVP A;  5FFA A;  1UVH A;  3AJO A;  5IX6 A;  3KA8 A;  5JAC A;  1Z4A A;  4Z5S A;  4ZL6 A;  2QF9 A;  1BG7 A;  2UX1 A;  3ES3 A;  2ITB A;  2CIH A;  2VZB A;  3F36 A;  1F33 A;  4ISM A;  2V2J A;  2Z6M A;  2ZG8 X;  5E2D A;  4LPJ A;  2Z5Q A;  1B71 A;  1RCE A;  3OJ5 A;  4YKH A;  3QVD A;  3VNX A;  3F35 A;  4U3G A;  3H7G A;  1RCG A;  5LG2 A;  4XGS A;  2C6R A;  1DVB A;  3AJP A;  3KXU A;  1JRE A;  3PW8 C;  5GU0 X;  4LQN A;  2X17 0;  4MKU A;  2RBD A;  1Z6O M;  3QB9 A;  4AM5 A;  5LBH A;  2CHI A;  3E6S A;  2ZG9 X;  4M32 A;  4KVS A;  1BFR A;  4ZLW A;  1TJO A;  4CY9 A;  1QGH A;  4P18 A;  3NOZ X;  3E1L A;  3PW1 A;  1NNQ A;  4CMY V;  1JYB A;  3Q4O A;  3R2K A;  1VEQ A;  4CYB A;  2V2P A;  1ZS3 A;  2PYB A;  3EZU A;  4TOH A;  1RYT A;  1ZUJ A;  4II4 A;  2CN6 A;  2WLU A;  2D5K A;  2YJJ A;  3A9Q A;  3BVL A;  4LQH A;  4TOC A;  3KA3 A;  4IWJ A;  4AM2 A;  1NFV A;  4EVB A;  3SH6 A;  5K52 A;  1VEL A;  4ETR A;  2C2J A;  3FI6 A;  3RBC A;  2BKC A;  1JKV A;  2BJY A;  2ZA7 A;  3BVI A;  4REU A;  2XJO A;  2V15 A;  3UOF A;  1NF6 A;  3PVT A;  5D8P A;  2Z90 A;  2FZF A;  3F37 A;  3PW8 A;  3Q4R A;  4CVR A;  4DI0 A;  2JD7 0;  5AXS A;  5FFB A;  4EVC A;  2YJK A;  1MOJ A;  3IS8 A;  4LPM A;  2GYD A;  3F39 A; 
#chains in the Genus database with same CATH topology
 3F32 A;  4CYA A;  5JKM G;  1Z6O A;  4TO9 A;  3PWQ C;  4M34 A;  3GGZ A;  5GN8 A;  2GYQ A;  4DE6 A;  3U90 A;  3AK9 A;  4TOE A;  3T9J A;  4RC7 A;  4QUW A;  5HJF A;  5ERJ A;  5HJH A;  3GE4 A;  2HTN A;  3QZ3 A;  1TKO A;  2IU2 A;  1JTS A;  5D8Q A;  2Y3Q A;  1LB3 A;  2YW6 A;  1XZ3 A;  4ITT A;  1YUX A;  3Q4Q A;  1TK6 A;  4YVZ A;  5JKM A;  4DZ0 A;  3EZ0 A;  5GOU A;  1OTK A;  3KDQ A;  3IQ1 A;  2C2F A;  2G4H A;  3ISE A;  2V2N A;  3AK8 A;  3F38 A;  4IWK A;  4XKS A;  1XZ1 A;  2WTL A;  5J8S A;  3BVK A;  5HU6 D;  3RE7 A;  3SE1 A;  4XKT A;  2Z5R A;  3SID A;  1TKP A;  5JDO B;  3BKN A;  3BVE A;  4DYZ A;  5D8O A;  3A68 A;  3PW1 B;  1SOF A;  2CEI A;  3KX9 A;  2FHA A;  1O9I A;  4PGI A;  2FG8 A;  1O9R A;  3KA6 A;  1AEW A;  3DBY A;  3FVB A;  2JD8 0;  4ZTT A;  3LKD A;  1NF4 A;  2Y44 A;  4II4 B;  3PVY A;  3PWQ A;  4TOG A;  4ZMC A;  1SQ3 A;  2GS4 A;  3E1P A;  2CF7 A;  4EVE A;  2IB0 A;  1F30 A;  4KVR A;  2XJN A;  1VLG A;  5GU3 X;  1L8I A;  3ISF A;  1EUM A;  3AF8 X;  3IS7 A;  2OH3 A;  2F7N A;  3HL1 A;  1JKU A;  4YXM A;  2V2R A;  3BVF A;  5JKL G;  3E1O A;  4PG1 A;  4ITW A;  2YW7 A;  5LS9 A;  3PZA A;  3R2M A;  4MN9 A;  4RC5 A;  2QQY A;  1JIG A;  1JGC A;  3E1J A;  2MGY A;  3KHK A;  3E6R A;  3PVT B;  3WVU A;  4ERU A;  2ZA6 A;  3O7S A;  1JI5 A;  1MFR A;  3RD0 A;  5D8R A;  1VJX A;  3QD8 A;  4LPN A;  2V8U A;  1KRQ A;  3AF9 X;  3ERZ A;  3AF7 X;  5C6F A;  3VV9 A;  2FKZ A;  3KA9 A;  3UOI A;  3WVW A;  1DAT A;  2FFX J;  1HRS A;  3C21 A;  3OGH A;  2WWX B;  3F34 A;  3R2O A;  5JKL A;  4CVT A;  4KVQ A;  5GN8 B;  3NP0 X;  3VVA A;  4LQJ A;  5D8Y A;  2V2L A;  3QHB A;  4RC6 A;  5LG8 A;  3KWO A;  4DYU A;  4LYX A;  4RC7 B;  4CMY A;  4M33 A;  3O7R A;  4MJY A;  4TW3 A;  4W4K B;  5GU2 X;  4DYX A;  3PVR A;  2C41 A;  2VXX A;  1S30 A;  4MY7 A;  3KA4 A;  1LKM A;  5J8W A;  5GU1 X;  2BW1 A;  2XGW A;  4RC8 A;  4WJG 4;  3R2R A;  2Z5P A;  3GVY A;  5CMQ A;  4XKU A;  3M6J A;  4E6K A;  2V2M A;  2V2S A;  1JI4 A;  3HIU A;  4DAS A;  2VXI A;  5D8X A;  2XKQ A;  5HQO A;  1J30 A;  2OC5 A;  4X0J A;  5D8S A;  4TOF A;  4TOA A;  2C2U A;  1L8H A;  3E1N A;  3SHX A;  1H96 A;  3E2C A;  4CVS A;  1GWG A;  1RCI A;  4OYN A;  3C1Y A;  2FJC A;  4ZL5 A;  3RAV A;  4IXK A;  2CWL A;  4ZJK A;  3L0M A;  3JZA B;  1LKO A;  2JD6 0;  1YUZ A;  5I4J A;  3UNO A;  1RCC A;  5K53 A;  4MUD A;  3PWF A;  1VEI A;  2W0O A;  3R2S A;  2ZG7 X;  4TOD A;  3PVY B;  2CHP A;  5FFE A;  1RCD A;  2ZA8 A;  3F33 A;  4PGK A;  3E1M A;  2XJM A;  4A25 A;  3C23 A;  2FL0 A;  3NP2 X;  3WVV A;  3BT5 A;  3W54 A;  1R03 A;  4ZKH A;  3C1Z A;  2V2O A;  4E40 A;  1DPS A;  1IER A;  2CLB A;  5ERK A;  2ZUR X;  5J93 A;  4LYU A;  2IY4 A;  3Q4N A;  3R2H A;  4M35 A;  1IES A;  4PG0 A;  1LKP A;  5FFC A;  3GHQ A;  3E1Q A;  1FHA A;  4RC5 B;  2OKC A;  4W4L B;  4ML5 A;  4ZKX A;  1N1Q A;  2BK6 A;  1S3Q A;  2CLU A;  3QHC A;  3V3K B;  4Z3B A;  1S2Z A;  4AM4 A;  3TA8 A;  4ZKW A;  4EVD A;  3MPS A;  3EGM A;  4DYY A;  4ISP A;  1YV1 A;  3AJQ A;  1UMN A;  5FFD A;  4TOB A;  4LQV A;  2HR5 A;  2FG4 A;  2CN7 A;  3RGD A;  4RC6 B;  5J9V A;  2WLA A;  5E1U A;  5CMR A;  5FEJ A;  3WNW A;  2V2I A;  3D19 A;  3R2L A;  4R42 A;  5CZU A;  3FRR A;  4Y08 A;  3FSE A;  1QYB A;  1BCF A;  3PVR B;  4CVP A;  5FFA A;  1UVH A;  3AJO A;  5IX6 A;  3KA8 A;  5JAC A;  1Z4A A;  4Z5S A;  4ZL6 A;  2QF9 A;  1BG7 A;  2UX1 A;  3ES3 A;  2ITB A;  2CIH A;  2VZB A;  3F36 A;  1F33 A;  4ISM A;  2V2J A;  2Z6M A;  2ZG8 X;  5E2D A;  4LPJ A;  2Z5Q A;  1B71 A;  1RCE A;  3OJ5 A;  4YKH A;  3QVD A;  3VNX A;  3F35 A;  4U3G A;  3H7G A;  1RCG A;  5LG2 A;  4XGS A;  2C6R A;  1DVB A;  3AJP A;  3KXU A;  1JRE A;  3PW8 C;  5GU0 X;  4LQN A;  2X17 0;  4MKU A;  2RBD A;  1Z6O M;  3QB9 A;  4AM5 A;  5LBH A;  2CHI A;  2N02 A;  3E6S A;  2ZG9 X;  4M32 A;  4KVS A;  1BFR A;  4ZLW A;  1TJO A;  4CY9 A;  2V8T A;  3FRS A;  1QGH A;  4YXJ A;  5JDO A;  3GGY A;  4P18 A;  3NOZ X;  3E1L A;  3PW1 A;  1NNQ A;  4CMY V;  1JYB A;  3Q4O A;  3R2K A;  1VEQ A;  4CYB A;  2V2P A;  1ZS3 A;  3JZ9 A;  3N6O A;  2PYB A;  3EZU A;  3UFB A;  4KXR B;  4TOH A;  1RYT A;  1ZUJ A;  4II4 A;  2CN6 A;  2WLU A;  2D5K A;  2YJJ A;  3A9Q A;  3BVL A;  4LQH A;  4TOC A;  3KA3 A;  4IWJ A;  4AM2 A;  1NFV A;  4EVB A;  3SH6 A;  5K52 A;  1VEL A;  4ETR A;  2C2J A;  3FI6 A;  3RBC A;  2BKC A;  1JKV A;  2BJY A;  2ZA7 A;  3BVI A;  4REU A;  2AR0 A;  2XJO A;  2V15 A;  2G38 B;  3UOF A;  1NF6 A;  3PVT A;  5D8P A;  2Z90 A;  2FZF A;  3F37 A;  3PW8 A;  3Q4R A;  4CVR A;  4DI0 A;  2JD7 0;  5AXS A;  5FFB A;  4EVC A;  2YJK A;  1MOJ A;  4MXP A;  3IS8 A;  4LPM A;  2GYD A;  3F39 A; 
#chains in the Genus database with same CATH homology
 3F32 A;  4CYA A;  5JKM G;  1Z6O A;  4TO9 A;  3PWQ C;  4M34 A;  3GGZ A;  5GN8 A;  2GYQ A;  4DE6 A;  3U90 A;  3AK9 A;  4TOE A;  3T9J A;  4RC7 A;  4QUW A;  5HJF A;  5ERJ A;  5HJH A;  3GE4 A;  2HTN A;  3QZ3 A;  1TKO A;  2IU2 A;  1JTS A;  5D8Q A;  2Y3Q A;  1LB3 A;  2YW6 A;  1XZ3 A;  4ITT A;  1YUX A;  3Q4Q A;  1TK6 A;  4YVZ A;  5JKM A;  4DZ0 A;  3EZ0 A;  5GOU A;  1OTK A;  3KDQ A;  3IQ1 A;  2C2F A;  2G4H A;  3ISE A;  2V2N A;  3AK8 A;  3F38 A;  4IWK A;  4XKS A;  1XZ1 A;  2WTL A;  5J8S A;  3BVK A;  5HU6 D;  3RE7 A;  3SE1 A;  4XKT A;  2Z5R A;  3SID A;  1TKP A;  5JDO B;  3BKN A;  3BVE A;  4DYZ A;  5D8O A;  3A68 A;  3PW1 B;  1SOF A;  2CEI A;  3KX9 A;  2FHA A;  1O9I A;  4PGI A;  2FG8 A;  1O9R A;  3KA6 A;  1AEW A;  3DBY A;  3FVB A;  2JD8 0;  4ZTT A;  3LKD A;  1NF4 A;  2Y44 A;  4II4 B;  3PVY A;  3PWQ A;  4TOG A;  4ZMC A;  1SQ3 A;  2GS4 A;  3E1P A;  2CF7 A;  4EVE A;  2IB0 A;  1F30 A;  4KVR A;  2XJN A;  1VLG A;  5GU3 X;  1L8I A;  3ISF A;  1EUM A;  3AF8 X;  3IS7 A;  2OH3 A;  2F7N A;  3HL1 A;  1JKU A;  4YXM A;  2V2R A;  3BVF A;  5JKL G;  3E1O A;  4PG1 A;  4ITW A;  2YW7 A;  5LS9 A;  3PZA A;  3R2M A;  4MN9 A;  4RC5 A;  2QQY A;  1JIG A;  1JGC A;  3E1J A;  2MGY A;  3KHK A;  3E6R A;  3PVT B;  3WVU A;  4ERU A;  2ZA6 A;  3O7S A;  1JI5 A;  1MFR A;  3RD0 A;  5D8R A;  1VJX A;  3QD8 A;  4LPN A;  2V8U A;  1KRQ A;  3AF9 X;  3ERZ A;  3AF7 X;  5C6F A;  3VV9 A;  2FKZ A;  3KA9 A;  3UOI A;  3WVW A;  1DAT A;  2FFX J;  1HRS A;  3C21 A;  3OGH A;  2WWX B;  3F34 A;  3R2O A;  5JKL A;  4CVT A;  4KVQ A;  5GN8 B;  3NP0 X;  3VVA A;  4LQJ A;  5D8Y A;  2V2L A;  3QHB A;  4RC6 A;  5LG8 A;  3KWO A;  4DYU A;  4LYX A;  4RC7 B;  4CMY A;  4M33 A;  3O7R A;  4MJY A;  4TW3 A;  4W4K B;  5GU2 X;  4DYX A;  3PVR A;  2C41 A;  2VXX A;  1S30 A;  4MY7 A;  3KA4 A;  1LKM A;  5J8W A;  5GU1 X;  2BW1 A;  2XGW A;  4RC8 A;  4WJG 4;  3R2R A;  2Z5P A;  3GVY A;  5CMQ A;  4XKU A;  3M6J A;  4E6K A;  2V2M A;  2V2S A;  1JI4 A;  3HIU A;  4DAS A;  2VXI A;  5D8X A;  2XKQ A;  5HQO A;  1J30 A;  2OC5 A;  4X0J A;  5D8S A;  4TOF A;  4TOA A;  2C2U A;  1L8H A;  3E1N A;  3SHX A;  1H96 A;  3E2C A;  4CVS A;  1GWG A;  1RCI A;  4OYN A;  3C1Y A;  2FJC A;  4ZL5 A;  3RAV A;  4IXK A;  2CWL A;  4ZJK A;  3L0M A;  3JZA B;  1LKO A;  2JD6 0;  1YUZ A;  5I4J A;  3UNO A;  1RCC A;  5K53 A;  4MUD A;  3PWF A;  1VEI A;  2W0O A;  3R2S A;  2ZG7 X;  4TOD A;  3PVY B;  2CHP A;  5FFE A;  1RCD A;  2ZA8 A;  3F33 A;  4PGK A;  3E1M A;  2XJM A;  4A25 A;  3C23 A;  2FL0 A;  3NP2 X;  3WVV A;  3BT5 A;  3W54 A;  1R03 A;  4ZKH A;  3C1Z A;  2V2O A;  4E40 A;  1DPS A;  1IER A;  2CLB A;  5ERK A;  2ZUR X;  5J93 A;  4LYU A;  2IY4 A;  3Q4N A;  3R2H A;  4M35 A;  1IES A;  4PG0 A;  1LKP A;  5FFC A;  3GHQ A;  3E1Q A;  1FHA A;  4RC5 B;  2OKC A;  4W4L B;  4ML5 A;  4ZKX A;  1N1Q A;  2BK6 A;  1S3Q A;  2CLU A;  3QHC A;  3V3K B;  4Z3B A;  1S2Z A;  4AM4 A;  3TA8 A;  4ZKW A;  4EVD A;  3MPS A;  3EGM A;  4DYY A;  4ISP A;  1YV1 A;  3AJQ A;  1UMN A;  5FFD A;  4TOB A;  4LQV A;  2HR5 A;  2FG4 A;  2CN7 A;  3RGD A;  4RC6 B;  5J9V A;  2WLA A;  5E1U A;  5CMR A;  5FEJ A;  3WNW A;  2V2I A;  3D19 A;  3R2L A;  4R42 A;  5CZU A;  3FRR A;  4Y08 A;  3FSE A;  1QYB A;  1BCF A;  3PVR B;  4CVP A;  5FFA A;  1UVH A;  3AJO A;  5IX6 A;  3KA8 A;  5JAC A;  1Z4A A;  4Z5S A;  4ZL6 A;  2QF9 A;  1BG7 A;  2UX1 A;  3ES3 A;  2ITB A;  2CIH A;  2VZB A;  3F36 A;  1F33 A;  4ISM A;  2V2J A;  2Z6M A;  2ZG8 X;  5E2D A;  4LPJ A;  2Z5Q A;  1B71 A;  1RCE A;  3OJ5 A;  4YKH A;  3QVD A;  3VNX A;  3F35 A;  4U3G A;  3H7G A;  1RCG A;  5LG2 A;  4XGS A;  2C6R A;  1DVB A;  3AJP A;  3KXU A;  1JRE A;  3PW8 C;  5GU0 X;  4LQN A;  2X17 0;  4MKU A;  2RBD A;  1Z6O M;  3QB9 A;  4AM5 A;  5LBH A;  2CHI A;  2N02 A;  3E6S A;  2ZG9 X;  4M32 A;  4KVS A;  1BFR A;  4ZLW A;  1TJO A;  4CY9 A;  2V8T A;  3FRS A;  1QGH A;  4YXJ A;  5JDO A;  3GGY A;  4P18 A;  3NOZ X;  3E1L A;  3PW1 A;  1NNQ A;  4CMY V;  1JYB A;  3Q4O A;  3R2K A;  1VEQ A;  4CYB A;  2V2P A;  1ZS3 A;  3JZ9 A;  3N6O A;  2PYB A;  3EZU A;  3UFB A;  4KXR B;  4TOH A;  1RYT A;  1ZUJ A;  4II4 A;  2CN6 A;  2WLU A;  2D5K A;  2YJJ A;  3A9Q A;  3BVL A;  4LQH A;  4TOC A;  3KA3 A;  4IWJ A;  4AM2 A;  1NFV A;  4EVB A;  3SH6 A;  5K52 A;  1VEL A;  4ETR A;  2C2J A;  3FI6 A;  3RBC A;  2BKC A;  1JKV A;  2BJY A;  2ZA7 A;  3BVI A;  4REU A;  2AR0 A;  2XJO A;  2V15 A;  2G38 B;  3UOF A;  1NF6 A;  3PVT A;  5D8P A;  2Z90 A;  2FZF A;  3F37 A;  3PW8 A;  3Q4R A;  4CVR A;  4DI0 A;  2JD7 0;  5AXS A;  5FFB A;  4EVC A;  2YJK A;  1MOJ A;  4MXP A;  3IS8 A;  4LPM A;  2GYD A;  3F39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...