4EVIA

Crystal structure analysis of coniferyl alcohol 9-o-methyltransferase from linum nodiflorum in complex with coniferyl alcohol 9-methyl ether and s -adenosyl-l-homocysteine
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
368
structure length
360
Chain Sequence
MDAATAVELLDAQPQVWHHFLGYINSMTLQCALELDIADVIHRHGHPIPLNQLAAALEIPQTKAPFLSRLMRMLVHLGYFTQVITKLPSYWLAPLSRLLLKQNPYNARSLTFCSVHEHLVDPWRQMSAWLRTGKEDGKDTPNAFAFAHEGKKVYEVCSEDANFSQLFSEGMAGDSWLFSRALVSKCRDAFEGLSSLVDVGGGTGNTSKVIAETFPNIHCTVFDLPHVVSGPKQTHPNLDYESGNMFTDEIPHADAVLFKWVLCDWPDEPVLKMLKQCKKALTKNGVKGKLMIADHVLDHESCNDSNSMGTSLILDMLFMSFLEGSLRTEKQWAKLFAEAGFKDYKITPVGGLRVLIEVYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of coniferyl alcohol 9-O-methyltransferase from Linum nodiflorum reveals a novel active-site environment.
pubmed doi rcsb
source organism Linum nodiflorum
molecule tags Transferase
molecule keywords Coniferyl alcohol 9-O-methyltransferase
total genus 128
structure length 360
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4eviA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4eviA02
1CF7B 3DOUA 2OB1A 3DULA 2ZZKA 3HVJA 2IDJA 4XSZF 3LBFA 2DFIA 5FD5A 1Q1HA 3M6VA 4IV8A 2LF7A 1YFHA 4Y13A 4M74A 1R7JA 1MJFA 4QDKA 2ZIEA 1O57A 5FGMA 4BNCA 2EJRA 3HSRA 2FSWA 2XGXA 2AOWA 1ZG1A 5L3GA 1QQIA 2ACJA 1KPHA 4S04A 1RUNA 3JSPA 3KR2A 1I9GA 1FBUA 4MQ4A 1XDUA 1G3WA 3HCCA 4Y15A 5EHIA 3T8RA 2QRVA 5K01A 3FPHA 1G8SA 2Y75A 3HUGA 1S3JA 3NQOA 3FMSA 1L9KA 3MZYA 1QAMA 2GH1A 2I7CA 1FBSA 3B3FA 3G2PA 4E32A 1XGMA 1B6AA 1K7AA 4I0AA 4L0ZB 4F86A 3F8NA 1HMYA 2P6TA 5DM1A 2OBPA 3PQJA 3RKXA 4MTEA 3ZMDA 3GFJA 5DXJA 4LG0A 5ILVA 3GRUA 5FUBA 4GYIA 1BOAA 2JZYA 1VE3A 3OZSA 2KJBA 1R5GA 1JGSA 3KZYA 4U7DA 2Z3YA 3E6CC 4OINF 2O61A 1IN6A 3GNLA 4HTFA 3A7EA 3WU0A 3CC8A 5FTWA 3TMAA 3FTCA 2DBBA 2BM8A 1XMAA 1FOKA 2EFPA 2JPBA 2Z6QA 5HDGA 3VYWA 4PCLA 5E1OA 3LKZA 5HLGA 5FULA 3SSMA 4L0YB 3P8ZA 2E1CA 2OB2A 4UUVA 5C0OE 3I64A 2ZBKA 1X1CA 3O7WA 2NNNA 1V4RA 3IRQA 3MCZA 3O31A 1D8JA 4LLNA 1JHFA 1RJEA 3UJ7A 2ZO4A 4WXHA 1P39A 4UVAA 3J81Z 1MJAA 3RW9A 1G6Q1 3I5UA 1EAMA 4JK1X 2R6ZA 3F3XA 1FX7A 3ER9A 1IRGA 4RYLA 2Q2EA 2OXTA 2AVNA 1ZKDA 4NQWA 3WTVC 2V7EA 4HG2A 2KJCA 2FU4A 3WGIA 1H9TA 4PYMA 5DTRA 4QPPA 3C6MA 1T6SA 3KE2A 1BIBA 5ILSA 3FTDA 3PX3A 2H27A 1CF7A 4PIMA 1ZRFA 2P7CB 3QP5A 2IPQX 4GCVA 4RVDA 4DA4A 2PX5A 1BC8C 1AF7A 1X1BA 1IXSB 2VDVE 3R0JA 4M9ZA 3EVCA 1ZLJA 2FNPA 3IKVA 1GXPA 2I6GA 1J75A 2K4MA 4MNUA 4EKGA 3GW2A 3UFBA 2V79A 4F85A 1L3LA 3GZ5A 1TNSA 3HVIA 3HTXA 3PB3A 3OV8A 5H02A 1G3SA 3K0LA 3UJ8A 5K5RA 4ETSA 3QOWA 4AZWA 4EJWA 4YUWA 1B4AA 3P2EA 2HTJA 2F2EA 3SX0A 4M38A 2M45A 3TM4A 2XYQA 1P1BA 3T5XA 1YW7A 1U78A 2AS0A 4L9NA 3TO9A 3KQSA 4M73A 1IZ1A 2AN4A 4QDJA 5LBQA 5FHQA 3DR5A 3DF8A 1HKQA 3K2ZA 3F8MA 5GOZA 1NBHA 3GX4X 3SXJA 4ENMA 2CMHA 3LA7A 3TPZA 1Z91A 3Q7EA 3SFZA 3LAPA 5HDKA 5IKMA 3E97A 1Q0SA 2D2WA 3P7NA 4GOMD 4ER6A 5FFZA 1U5TC 3B73A 3OU2A 3BUSA 2JRTA 5HIMA 2OAZA 2AOUA 3EVBA 2IH2A 5AIPA 5EMLA 5FO5A 3TOAA 3F21A 3FUTA 3MCTA 4G6QA 2MH2A 4OBWA 1P2FA 2IBTA 2L54A 2HTEA 2FBHA 4PYIA 2ZMEA 4R8RA 2A3SA 1Z3CA 2GB4A 1X19A 1X3UA 4MQ9F 4RTPA 3WTSC 4O5VA 1R36A 1USTA 3RTRA 3ERED 2XVCA 1XTPA 2XYVA 4E31A 2X4HA 1NW3A 1YLFA 2PX4A 1MGTA 5CVVA 3K6RA 2UZKA 1HXDA 3PT9A 2IPXA 4U0VA 4OMYA 2P7HA 3NWBA 3PS9A 5E9WA 2ZVJA 3UZUA 3IV6A 2KIFA 3RDIA 2YQZA 3TFWA 3G2OA 3ZN0A 3FRHA 5KK1A 2STWA 3H3ZA 5DCFA 1HKSA 10MHA 3KPUA 1HBXG 1QO0D 3KPWA 2PKWA 2N47A 1FYMA 4BLUA 1VBFA 1ODDA 3H3UA 2F5FA 1HW5A 1RI2A 2STTA 2ZNYA 2OA4A 1ZRCA 2CYYA 4ENNA 3L9FA 3MFKA 2CWEA 4QTTB 1YFLA 4G7HF 3LSTA 5LEKA 1AWCA 4DQ2A 2W84A 2HTSA 4RTRA 2PSSA 3NEUA 5DT2A 3BKWA 2H11A 3IHTA 5E9QA 2L01A 2YPRA 2CW0F 2GA9A 1W7PA 3NVKI 2B2CA 2QUFA 3K1NA 1BKYA 1QZZA 2JSCA 4HZFA 4IRHA 4KIFA 4LK1F 1K78B 1IN4A 4AUKA 3SMQA 2ONZA 3RIEA 4PYNA 2PJDA 2PT9A 3TKAA 2DQLA 2DT5A 5EKUA 2G9WA 2XASA 1E2XA 4U7PB 1DPUA 4KDCA 5ICCA 5K5OA 3DMFA 4I0BA 2YUIA 3THRA 4C04A 4CWAA 1SD6A 4LG1A 3DXZA 2ONYA 2MD5A 4F7ZA 5EEGA 5BPDA 5GIOE 3CUQB 2PN6A 2FHPA 3HHHA 4YMGA 1M6EX 2P3QA 3R0QA 1YTYA 3WGHA 2ISYA 3GCZA 4LB5A 4LGWA 2LKPA 4RB0A 4OIOF 3HIFA 1HSJA 5D1HA 4EJTA 2ETHA 4G94A 3HSFA 4HF2A 5FLXK 1FLIA 1D5VA 3TDUC 2I9KA 3PFGA 3DFGA 3BP8A 2EFOA 3C3YA 5E8IA 2OZ6A 2M1BA 4N9HA 3T1BA 4LB6B 4FR0A 3P97A 2G7UA 5C9ZA 3KQVA 1EH6A 4LLGF 3HRMA 3UJ6A 3K0BA 1KP9A 3VOEA 3SZTA 3REOA 4KWCA 3IHUA 5HILA 1FBQA 2VC0A 3B89A 5T67A 5K03A 4LK0F 2TDXA 2E7XA 5H6RA 3TDZC 1XMKA 3EEOA 1PJZA 1IXRC 5K0CA 3RPUA 3WTXC 2H6BA 5JHUA 2G72A 2ORED 5DX1A 3BJAA 3MQ2A 2FBIA 1ZH5A 3EUHA 3CJRA 3BT7A 2B78A 2HFHA 1NW8A 2XYRA 4WVLA 1SD5A 3I59A 4M37A 4Z2YA 4RB1A 2HMYB 5CVUA 5DX8A 9MHTA 3GXOA 4PNEA 6PAXA 4LWPA 3CO6C 3P71T 5KVAA 2LF8A 1JG4A 4FHTA 1WI9A 2C7OA 3V8KA 4RB2C 4LG0B 3G89A 4E30A 1KYWA 4A5MA 4RVFA 1KA8A 3BWGA 1VIDA 4KW7A 2XROA 1U2ZA 2ZLBA 5E1DA 1IRFA 3C1DA 4MEYF 2UYOA 2IDKA 1R1UA 4G8XA 3FM3A 3CJNA 3HOTA 2WTEA 1J9IA 5FQNA 1J59A 4CTJA 5BMZA 1BBYA 1NW5A 5JUWA 4S05A 2L3DA 2QRVB 3IL2A 4ZYDA 5IH3A 3MQ0A 3O2PE 3R24A 4HQEA 5EIWA 1G4DA 3DLCA 3R61A 3HCBA 4ZZLA 4AVPA 5ILUA 4KIBA 4PCAA 2FOKA 5FQOA 4DQ0A 3EVEA 3J80Z 4QQNA 3FF5A 4B17A 2IA2A 4M72A 2B25A 5CJ9A 3E6MA 4RGRA 2HS5A 4G7ZF 2E1NA 1WRJA 1JSZA 3V97A 2XAQA 2DU9A 2MBFA 1Y0UA 3ELUA 2P5KA 5IT3A 5EVJA 1KQ9A 1KPGA 5L3BA 2Z9OA 2K4BA 3ZMUA 2P40A 4RVGA 1R6AA 5E17F 2W57A 2NS0A 3G5LA 5HIIA 3GGDA 5KQRA 3FZGA 3I0TA 3UA4A 1K79A 4QVGA 2FCAA 2NNWB 3LCCA 2E5WA 4BHBA 2NYXA 4RTQA 2PX2A 3LBYA 1D2GA 4HX4A 4I2OA 3DMGA 4EGZA 2XVAA 2CQKA 4QTUB 3HVHA 3WTTC 2HYFA 3JSOA 4C4AA 2G8NA 2O03A 3BZBA 1QZYA 4IRGA 1W5SA 3BWBA 3CUQA 3G73A 2VOPA 3BGIA 1TQPA 1R00A 2NXNA 4R05A 3OPNA 4R8SA 2RDPA 3B3GA 4YV1A 4HA8A 2UZ4A 1LQ1A 2B9EA 3CUQC 1YS7A 3HTSB 2P6SA 3EYIA 3SZPA 2MLGA 2YXLA 5DSTA 4GOOD 2XKOA 5D1NA 4DF3A 4MHTA 4RX1A 5D6EA 5DSXA 3ERCA 2X0LA 2ADUA 5CVRA 3MAJA 4FP9A 5EKXA 3ELYA 4YG2F 2FF4A 1AOYA 3V8VA 2FA5A 2HQRA 5K0JA 1N2XA 4A6EA 3GEZA 3PFIA 2ZBQA 1J5YA 1I1GA 1SD7A 4WXCA 2EK5A 4L9TA 2HYGD 1ORHA 1W7PB 3FMRA 2P35A 1P1CA 1SFEA 5E2BA 2FQ3A 4RTOA 1R8YA 3ABUA 2EFWA 2ZWAA 3DLIA 1XVAA 3SSOA 5F64A 3EGEA 4PDKA 2Z6UA 3UBTA 2RN7A 1WSUA 4MHGA 3F23A 3SQNA 4NB5A 4P55A 1NT2A 5FD6A 5HOQA 4YUZA 1F9NA 5DPMA 5K1YA 3VODA 5E1BA 1ZG3A 2QBYB 1FY7A 1P4AA 8MHTA 2O8XA 4I09A 5DRYA 4WK8F 3KEQA 3M6XA 4KN4X 3IWFA 3GFIA 2GLUA 3B02A 5HZMA 5DM2A 4G6DA 3OZRA 4O6JA 5JR3A 2FNAA 3FTEA 1O7FA 5F1RA 5DLYA 4CZZA 1X1DA 3QOXA 1O7LA 4A6DA 5D4RA 4ON0A 3KCCA 5DD8A 4OMZA 3Q87B 3W6JB 3VFZA 2PV0A 2F8LA 3HCAA 2Z5UA 2VOOA 2EWNA 4OIPF 4QPNA 2XAGA 2VODA 2QZ8A 1M0EA 4LD5A 4CKEA 3M7GA 3R6SA 3MHTA 2NXJA 5LHHA 1YG2A 3GIWA 5E9JA 1SQGA 2J5OA 2ZJ2A 2ZZNA 5ICEA 4IHTA 4HDUA 2NP7A 3KZZA 2H00A 1KU2A 2PMHA 2GAUA 5K0LA 3WTWC 1SFUA 2XUBA 4RSRA 2HDCA 4GXOA 2IA1A 2Y1XA 2EFQA 3CBGA 2RVCA 3JTHA 2QYOA 4KVZA 4Y2HA 2FK8A 1NV8A 2VP3A 1WWXA 1B9NA 2O0YA 5DYMA 2GXGA 5AIQA 2AR0A 3FYDA 2NP6A 1O3QA 3JWHA 4KUMA 3SVZA 2ZNZA 2UYCA 5DEQA 2B3TA 3DUWA 4CICA 2K02A 1GXQA 3FXQA 5E1MA 3GO5A 1JG3A 4DMGA 2RGVA 5DCMB 2PFBA 1GVJA 5JFRA 1RIOH 3KQTA 3J81K 3LKDA 4RTLA 3EETA 1T2KA 3AY0A 4E33A 4FX0A 3KLOA 4WF2A 1HNNA 1QGPA 1PDNC 4FT8A 2C7QA 4GBED 3BOQA 2BYVE 1STZA 2HR3A 2V9VA 3ROUA 1YQAA 3M9AA 3RODA 2Q41A 2MLKA 4L18B 3U1DA 5LQCA 2ZZMA 5ICGA 1K6OA 5EOVA 5K8VA 4U7TB 4ZH4F 3KP3A 1G60A 2JHAA 3WGGA 1IN7A 1EV7A 3HHGA 4AIHA 3KKZA 3LDFA 3NW9A 1N7IA 3DKWA 4ENJA 2P7VB 2EB7A 1EH7A 3ABTA 2A6HF 2AS5F 3SXYA 1DUSA 4AZSA 4YUXA 5AONA 4ER5A 3LQRA 3LECA 5LGTA 3IKTA 4AZTA 2A14A 2VDWA 4PYKA 1KYZA 2PG4A 1YB2A 3GRVA 1O54A 3DH0A 3TOSA 5DD4A 5ED4A 1L3BA 3FM5A 2HKOA 2DPUA 3K1PA 1MD0A 1T0FA 1MZBA 2E7WA 1T43A 4EM1A 3LWFA 2NXCA 2UYHA 3TO6A 5FWAA 4X63A 2M8EA 3D5LA 4P7FA 1Z6RA 5P8WA 1ZGJA 5GP1A 2UWMA 2A68F 2UXXA 4OIQF 4C03A 2C7PA 3I9FA 3F8BA 5J6XA 1R8XA 2LSOA 5LR6A 1FSEA 3OFKA 5DWQA 3MEXA 3O6BB 3QPTA 2M30A 3LQQA 4L9VA 4EVIA 5J8FA 1DDNA 1QBJA 4YUYA 3BWCA 3JWIA 3MTIA 1G6NA 1XXLA 3PVCA 3AJDA 2EA2A 4X1OA 2GAFA 2GS9A 4HV6A 2ZTHA 5D5WB 1S7AA 4E2ZA 3J80K 4QQKA 2QQAA 3IRRA 1AV6A 1X1AA 4OA5A 1I5ZA 4HH4A 4A0ZA 4R8HA 3E5QA 1TBXA 4GGGA 3FUVA 3BY6A 1LB2A 5HLHA 4WX9A 4BH9A 3RJPA 3JAMK 3A4TA 4MQVA 2ZIFA 3TR6A 1O3TA 1S7OA 4RAYA 1Y8CA 1YUBA 4IHSA 3HCEA 4BQAA 1R18A 1NBIA 1O3RA 1YW8A 1FYKA 2AVDA 1YS6A 1M6YA 4E70A 2L02A 2HEOA 1BI0A 1S8NA 2VBWA 2WC2A 2EG5A 4YFXF 4HX8A 1TLHB 5H20A 4EQZA 1P4XA 3A7DA 4FX4A 1XGNA 3P2KA 1FC3A 1XD7A 4P5OA 4KDRA 1EG2A 5F2OA 5U4XA 3QAHA 4U0YA 3WTYC 2CO5A 2FRHA 5GM2A 2P41A 5D8KB 4CXFA 3WE3A 1KU3A 3G2QA 3DP7A 1XDZA 1MDMB 1KR5A 5ERIA 3LCUA 2H09A 1ZQ9A 1YFJA 2F5EA 1RI7A 3E6DA 4N9IA 4ZYHA 3QRFF 2ZCJA 2VE8A 3CCFA 1I4WA 4EJVA 1P4WA 4YUVA 2OYRA 4B09A 3MZHA 5CIYA 1RI5A 3JTGA 1D2HA 1I1NA 1SG9A 2IW5A 4XLNF 3PLAE 3KETA 3FXRA 2MH9A 3ME5A 1WXWA 1U5TA 2FBKA 1YW9A 3QU6A 3SGLA 3HP7A 5JVTA 4PYOA 1FP1D 3WTUC 2EJUA 3DQVC 1KHHA 2XHKA 1KXZA 3MGGA 1IW7F 3M8EA 3FZVA 3KPVA 5FLXZ 2OQGA 3S68A 4GC5A 3EQLF 3E8SA 2OZVA 2YVLA 5HFJA 1IXCA 1TW2A 5DRTA 5DX0A 1DPRA 3EMBA 4C08A 2BR4A 4M71A 3JWGA 3GO4A 4XCXA 2Q0OA 4MEXF 2EV6A 2IT0A 2P5VA 2DO7A 3EGIA 1Z05A 3Q9SA 2HNKA 4HBLA 2GA1A 3U9GA 2AOTB 2PVCA 2GWRA 2ZFWA 1LNWA 4M9SA 3KP6A 5CUQA 4XUDA 4E2WA 4ZYEA 1JSXA 2CKDA 4V0RA 2OO3A 1R1TA 3F6OA 5DM4A 3TQSA 4UVCA 3IWZA 3NRVA 2PJPA 4I02A 4ESFA 2I62A 4M36A 4FT4A 5HS9A 3BWMA 3KP5A 1QYRA 2K7LA 1XDSA 2JPCA 3LFKA 2VS1A 2BBYA 1U6GA 3KFWX 3KLNA 4DZRA 2K27A 5BP7A 4K2EA 2CMGA 5FADA 3TLJA 3HNRA 1VL5A 3DV8A 2H94A 5GM1A 1VP9A 1BHJA 3EEYA 3WU1B 1O9HA 3D2LA 4IV0A 3EVZA 4ENKA 3DXYA 2YX7A 4UVBA 1RZ4A 4IVNA 3R9XB 5KVRA 4IPAA 5DTMA 5JI6A 1TPYA 3B7PA 3T7TA 1FSHA 4RS8A 3BPXA 1WKMA 3E5XA 1TQIA 4DCGA 1ZYRF 2YXEA 1XCVA 4KYWA 4RTNA 4ER3A 1USSA 3FPFA 2HKXA 1OYYA 3RPQA 4RVHA 3J7AO 1JR4A 1LDJA 1J2XA 2O05A 2DLLA 2NXEA 1L3IA 1I27A 2KW5A 5EMKA 2BV6A 3UJ9A 3LPMA 4CTKA 2WK1A 3KHKA 3L09A 3L2CA 4LJZF 2K86A 1EQAA 1LJ9A 2Q8KA 1IN8A 3L00A 2EV5A 5CVEA 4BHPA 4PYLA 3V8LA 5GIPE 1ZLKA 3FUXA 3WTZA 2ZKZA 5E1ZB 1FNNA 4GOND 3ECOA 4R1HA 4LWOA 3TRKA 2K4JA 2JH9A 5K5QA 7MHTA 3HTUA 2EJTA 5D4SA 1BOOA 4A12A 2PX8A 4XUCA 4KIGA 1DCTA 2IA0A 4BP3A 1LVAA 3GU3A 4CHUA 4GUAA 1KGSA 5HOOA 3G2MA 4C07A 4MWZA 2FXAA 2NNYA 2IJLA 1DP7P 5KYGA 1MHTA 1P6RA 1ZN2A 5LQAA 3GF2A 3LL7A 4GEKA 2JH8A 3TOBA 5CM2Z 2NAZA 1HQCA 1WG8A 3ELDA 4I7HA 1ZARA 4KT5C 4KDPA 4EJUA 4M9XA 2V74B 4CGZA 3NWEA 1C0WA 3KEOA 5L3EA 5L3FA 2VDUE 3OU6A 1S6LA 1NKVA 5K0BA 5F6FA 2YR0A 4DM3A 2J5PA 4AZVA 3LDUA 1H1DA 4WCGA 4CXMA 2PI0A 2OQRA 3RIRA 4MTLA 3I58A 4XLPF 2V6CA 3FYCA 3FX3A 1XGOA 1QANA 2QVOA 2GA2A 1VQ1A 3QV2A 1NV9A 2PXAA 5CLSA 4Y17A 3C6KA 2PGXA 2H1RA 5LQJA 4UXNA 1B59A 4RTMA 1I6XA 2PT6A 1H9GA 5BQTA 1F3LA 2YU3A 4L5IA 1RUOA 4RTKA 1F1ZA 5BW5A 3FXUA 5ERGB 1KPIA 2CL5A 3L8DA 2DI3A 3TO7A 1FBNA 2M87A 1MJBA 1JQEA 2IGTA 4ISCA 4RGUA 2IIPA 3NJRA 4N0BA 4YMHA 2AOTA 4RTSA 4XSXF 1B9MA 5K05A 2ZULA 3NDIA 3NMUF 2BE5F 3WE2A 5M5BA 1SMYF 3O3KA 3FHZA 1F5TA 1KIAA 3ZPLA 4BLVA 3FTFA 4GO1A 2BH2A 4LMYA 4OQEA 2IRFG 1R23A 3A26A 1W7PD 1SUSA 5HIJA 1JHHA 3ECHA 1EH8A 2ZFUA 4EGYA 4BHCA 5F2KA 4OBXA 3EDPA 1T39A 2ISZA 2DK8A 4EJOA 3BXOA 2HQNA 1NW6A 1QPMA 2D1HA 2D1VA 1DUXC 1QAOA 2BGCA 1JG1A 2WWYA 4P7KA 3TGNA 2FPOA 1ONVA 2JT1A 2PWYA 4P58A 4BLWA 2PQ8A 5LHIA 2XBMA 3LAJA 2V1DA 5D5UB 3LA3A 3MTEA 2O07A 4HGYA 3G8AA 4G7OF 3PQKA 1JTFA 1ZRDA 5HDNA 1T38A 3HOSA 3KQQA 2BZGA 3PFHA 3VB2A 2ZCWA 4POOA 3ULQB 1TTYA 3CO7C 5CCXA 4I98B 4HGZA 2W85A 1LEBA 1IXKA 4RWZA 2GXBA 4U88A 2GQQA 3HRSA 3FMQA 1G55A 3G3ZA 1W5TA 3LCVB 4Q5SF 2QY6A 4G56A 3P9CA 5DUIA 3M33A 4FGZA 1HW2A 3P9KA 1HKTA 4AIJA 4UHTA 2PBIA 5CVDA 1OYWA 4HSGA 1Z9CA 3OE5A 4PINA 4ZTBA 3TKYA 3LX6A 4PGHA 4NHJA 3OOPA 4UV8A 1D3YA 5LEJA 2FRXA 4KMFA 1IM8A 3EVFA 1D2CA 2PLWA 2VBXA 1H0MA 3DXJF 2JHPA 2ADMA 3KQPA 5E2AA 2RV8A 3QU3A 2QENA 2ZW9A 5DM0A 3KQMA 1SUIA 4BAYA 1ZHFA 4YIFA 1UWVA 2FE3A 2QWWA 1MJ9A 2YX1A 2ZBRA 1R5HA 1RJFA 2C6YA 4JXJA 4Q4ZF 1XSVA 4Q48A 2IH4A 3P9IA 3DPLC 3V4GA 2VT3A 1WXXA 5H6QA 3ZQ7A 3TM5A 3GJYA 3OU7A 3AAFA 1AQJA 3VC2A 4A5NA 4A2UA 3KP7A 3RI4A 3GRRA 5LRRA 2DK5A 1W4MA 4RGXA 3KPYA 5K0EA 3BGDA 2CSOA 1J0RA 2W24A 3ELWA 5MHTA 2IP2A 1OR7A 5E8RA 4AIKA 3UJBA 1KQ0A 4UV9A 4HF0A 3JWJA 2EA4A 4PWYA 2F5CA 3KP4A 3R3HA 5EGSA 2XAHA 5A2QZ 4O3MA 2LD4A 4L9JA 3DTNA 4ER7A 5BW4A 4BP1A 2FMYA 3RYRA 2VBZA 1WS6A 1YZ3A 1B42A 1WQ2A 3E23A 4IJAA 4ESJA 1JQDA 1F4KA 5DXAA 3WG9A 3IYLW 5G02A 2O06A 1OR8A 3HA5A 3KU1A 2IH5A 5CVJA 5FB2A 4A0XA 2C7RA 1NHAA 3MAGA 1JE8A 3B3JA 4C05A 4P7GA 2VN2A 3G8BA 5CCBA 3DEUA 3BDDA 3T0IA 4YV0A 3MERA 1R1VA 3L7WA 5LQNA 3K9TA 5BPIA 5KQSA 1YZHA 3FWEA 1XCBA 4EV0A 3Q9VA 2R7FA 2EFNA 2LNBA 3LA2A 3FUWA 2DPMA 5EIFA 5E1WA 2COMA 4WXDA 3JAMZ 2CG4A 4EK9A 1QAQA 4FZVA 5GWXA 4RTJA 2OY0A 3CLOA 1SAXA 1FP2A 2VXZA 1XCJA 4QLCU 4KA4A 4HYEA 5HEKA 4HC4A 5IT9Z 4CDGA 1SQFA 2KRFA 1N7JA 3RKWA 1RNLA 5F2NA 3GLXA 1WY7A 2ELHA 4NECA 2UXNA 1JXSA 1B1BA 2L4AA 2OZUA 3GFLA 3DXXA 3FRIA 2ESNA 4G9YA 4DNCA 4EQQA 5D5XB 1FYLA 1UFMA 2KIMA 1L1EA 4Y30A 5FA5A 4CO8A 2RKHA 3KR1A 1UB9A 3IC7A 2XKPA 2Z33A 3OE4A 5LQUA 3BJ6A 1U2WA 1G3TA 3MWMA 1O9GA 1BI2A 1TQMA 3M4XA 3ANXA 2PXXA 3ZP5A 2EX4A 3OFJA 1U8RA 3ZMTA 4PYQA 1GHCA 4MGRA 3BPVA 4KMUX 4PIPA 4ZZDA 3EPPA 5DTQA 2KKOA 4FT2A 4M6YA 1G38A 3T8TA 4LLLA 2AXLA 4R6XA 2O6GE 2HGCA 2GPYA 3E05A 2YX4A 1Q0TA 1EIZA 4MIKA 4BXUA 3G7UA 3SM3A 4A0YA 4KRGA 4D0PA 1OYIA 2VC1A 1VTNC 4FSDA 5EG5A 3D0SA 2KIUA 4GF5A 3V7SA 4DCMA 1ZAOA 3I71A 3COAC 4YV2A 1P91A 2ZMEB 2AOVA 1YYVA 3GZ6A 2BEOA 3H92A 4CKBA 4PZJA 1FPQA 2P1DA 2G71A 3EVDA 3GRYA 2RC4A 3KPJA 1JQ3A 2DULA 1G3YA 1XSXA 1IUYA 3R6TA 1A04A 5ICFA 1Z7UA 5FA8A 2RQPA 4DKJA 4HW0A 3SSNA 3DMHA 3KP2A 2HOEA 4P9UA 1ORIA 3CGGA 1SKMA 2F5DA 1R22A 4P7JA 2A69F 3CKKA 3LGAA 3GYHX 1PP8F 4RV9A 4CYDA 1S29A 3A27A 4F84A 3HCFA 4M7RA 2OPBA 3UWPA 4R6WA 1YIOA 3SR4A 2LDUA 4KICA 1T98A 5E20A 2BR3A 3HVKA 2YTZA 3M1EA 1P92A 4X60A 5B1SA 2M5WA 2IFTA 2QM3A 3ISPA 5GINE 1BC7C 3F22A 3C3PA 1L0OC 4AWXB 3T7SA 2DAOA 2B0LA 2XRNA 3KR9A 3C0KA 2PLYA 2YSRA 5J8CA 2JG3A 2XVMA 4H0EA 1IF1A 3GRZA 1XB4A 2P5LC 3M6UA 4OQDA 3U81A 5T64A 4IRIA 3ZMVA 1ON2A 1U5TB 1Z1DA 2XAFA 2EV0A 4R79A 4I01A 2XV4S 4PCQA 2VONA 5FWDA 4XBFA 2ZXJA 4OOIA 1L3CA 1KU9A 5LGNA 3K1MA 3VSEA 4IXAA 4OA8A 2WV0A 4ATNA 3ZMZA 1INLA 5DUKA 1UFKA 3CVOA 2P3LA 3CJQA 2P3OA 1FWZA 2HV9A 3T7RA 2G1PA 1JTEA 1D8KA 3M8FA 4H0NA 3MB5A 1UIRA 2V1UA 4E2XA 3WSTA 5CYVA 4XUEA 1PUEE 3PX2A 1SD4A 2HWVA 1MDMA 3IEIA 1IY9A 5EQJB 1FJXA 1BM9A 4EMSA 4X61A 4U7BA 1G8AA 3HCDA 3A25A 2AZTA 3I4PA 2VBYA 2OU2A 3K69A 5EHGA 3VEPA 1XN7A 4ASNA 1WZNA 3EVGA 5FFXA 4FS8A 2VT2A 2PEXA 1HW1A 4FSXA 1F38A 3FPJA 4MTDA 2G70A 2Z99A 5BXYA 4L5JA 3ELKA 3G88A 1RJDA 2MA3A 3RKYA 4AX8A 3N4MA 1RI3A 4HAMA 2R3SA 4ZYGA 3N97A 3SHFA 3E3VA 4QVKA 2DW4A 4X41A 5HVQC 2EFJA 2PXCA 5T6BA 2HZTA 4AD9A 3HA3A 5K09A 4JBAA 2CGPA 5LRSA 1SFXA 1PRYA 1XJ5A 4TV7A 3UJCA 2IBSA 5FHRA 4CKCA 1RJGA 2ZIGA 2W25A 5CVIA 3NDJA 2FMLA 3U2RA 2MC3A 4GC9A 1SMTA 3G5TA 3B5IA 3R60A 3I59B 5DV5A 2D45A 2JJQA 5E18F 1UHMA 3C7JA 2O0LA 1OMIA 1XCLA 3P9NA 3BGVA 4IKPA 5EZQA 3M6WA 2O57A 3C18A 3BZ6A 5D8LB 3I54A 3KR0A 2PBFA 1PP7U 4P96A 4HDVA 3BWYA 2A6EF 3EGVA 4YFKF 2CWWA 5LSAA 1NE2A 3RYPA 2H6CA 5HIKA 3HRTA 2ESRA 1AQIA 2ERCA 4BY9E 3ER8A 1K78A 2YXDA 3P2IA 3NTVA 5TJJA 4C06A 3C3WA 4OU0A 2PWPA 4JQFA 3V8JA 5LGUA 4RB3C 2BR5A 2A5YB 2JHCA 3OZTA 3ZMSA 2V1XA 5EMMA 4EM0B 1YF3A 1R58A 2Y0MA 3GFMA 5E1XA 1V39A 3VC1A 2XIGA 5K0FA 3ID6C 2A61A 2G7HA 1UHWA 1DL5A 1LDDA 2HWKA 2ZBPA 2Y48A 3BKXA 3HA7A 3CJTA 2DTRA 1TNTA 1CGPA 2L4MA 1IN5A 1E17A 3F72A 2ZWVA 1ULYA 2GIVA 2Y1WA 2P4WA 2QQ9A 4HV5A 3THSA 1XSDA 3F8FA 3UA3A 3HYIA 1RI4A 5EPEA 2P8TA 2ZSUA 3GVAA 2PMUA 4KNYA 3F4KA 3QOPA 3GWZA 4HOBA 2GZWA 3EYYA 3F6VA 3AWIA 2PY6A 2FYTA 4UOEA 2O3FA 1J7KA 2VZ9A 3CTAA 2IVMA 5CD1A 5BOXA 4OX9Y 1RI1A 3O4FA 3AXSA 4HRAA 1LDKB 1NW7A 2ESHA 3I53A 1KU7A 5D6FA 3HSEA 1U3EM 1ON1A 4PYJA 1ZG5A 3E6BA 3HEMA 3BROA 3QPHA 5D5VB 4LECA 3FPEA 1LEAA 1REPC 5FCDA 3CDHA 5DDGA 5KS2A 1KQ8A 1OKRA 2BM9A 1BIAA 2UYQA 3T0YA 5HS8A 2AN3A 1V3FA 1OPCA 3WODF 2NRAC 2CFXA 3S2WA 1FT9A 2AOUB 5C1IA 4EKIA 5LLQA 5EMJA 4HLYA 3M70A 1VLMA 4RGSA 5K0NA 5A2QK 3KQYA 4HX7A 4Q47A 3EMDA 5EC8A 3PTAA 4E2YA 4V0QA 5E8JA 4GQBA 3ORHA 5LQRA 3R0AA 2HR1A 1BN5A 1BC5A 4WWCA 5L3DA 3UJAA 5EZSA 5DCMA 2VE9A 3TQNA 3UJDA 3V7RA 3R4KA 3CUOA 4KN7X 2DQRA 4K6MA 3E7PA 3W6KB 3QP6A 1EJ6A 5TRDA 2R7DA 2DPDA 4KFCA 1BI3A 3KQWA 3KQOA 3DPTA 4PONA 5K0GA 4PGGA 3GDHA 2QBYA 4HLXA 3HRUA 5L3CA 1Z6TA 2FK7A 5HS7A 1TW3A 2FEZA 1QNTA 2WA1A 3NVMB 1ZREA 2QLZA 4RAZA 4ESBA 2A07F 3ML6A 4YFNF 1HSTA 4GYGA 3E5UA 4QWQA 4OIRF 4L7VA 2Z6AA 1FZPB 2QQBA 1BJAA 2JTVA 4LFUA 3OCJA 1IAWA 5EEHA 1JG2A 2P7IA 1O3SA 3X0DA 1I1SA 4BYYA 1VPTA 4B8XA 3JW4A 3Q5FA 1EJ0A 2OD5A 5LQKA 2OKCA 2YR2A 4IF4A 1UCRA 2P8JA 3HM2A 4GOLD 2XAJA 2AN5A 2AOXA 4HQMA 4EM2A 5E8GA 3V7CA 1SVUA 5BS6A 3EVAA 4ER0A 1ZGAA 1MKMA 3GUDA 1XGSA 3H2BA 3FPGA 4IWNA 1BI1A 1YO5C 2NYUA 2OBFA 5HLIA 4XRFA 1R74A 4UNOA 3BJOA 5LHGA 3LDGA 4HTFB 4O29A 2RNJA 2WA2A 4P9FA 3AXTA 2QE6A 5IT9K 4HF1A 1VP3A 3ZN1A 3FUUA 3F8CA 4YIIA 4M6XA 4U0WA 3LHDA
chains in the Genus database with same CATH superfamily
2GERA 1GU1A 4ND8A 3KIOA 2BFBB 3G0IA 2NWQA 4KO3S 5AKYA 3NS7A 4A8PA 3NJ4A 4H60A 4BQOA 2VRBA 3A03A 3DQPA 3DULA 3FMGA 3JZIA 4IEFB 2GQ0A 2IDJA 4ZT3A 2HWWA 4DBZA 5JVGF 1LBQA 3K70D 2Y1CA 1CE8A 1SQ5A 1ZD1A 2RK6A 3C43A 4OM7A 3VX4A 3NRBA 1OH8A 1QGAA 2JA8J 1GDHA 2LF7A 1JWLA 3BCAA 4Y2GA 8LDHA 4Y13A 3DPUA 4M74A 1FX0A 4U9IS 4MRPA 1R0WA 3GJ4A 3TJMA 1QHGA 2H1SA 4TVBA 4WNIA 3GR6A 3KE9A 5FGMA 1OF1A 4YJGA 4WNAB 2EJRA 1QCCA 2G36A 3BA1A 3HSRA 3H6KA 4AYWA 2WJYA 5DS9A 4KE6A 4UE2A 1AKNA 1T9AA 1ZH4A 2B21A 4KO4S 1WW8A 3OR2C 3K72B 1UDCA 4BYMA 1JAXA 5L3GA 2C8JA 3VNSA 4HEA2 4BCDA 5HRCA 4D26A 1H2YA 2CFOA 3ENNA 1KPHA 1DFHA 1F36A 5BWOA 4TWRA 2Z9BA 5KAIC 3OTGA 4RQBA 3T1NA 3F5SA 3P1JA 3KR2A 4URFA 3ZDQA 2D3WA 5JBIA 2ZRBA 2FG6C 3Q0TA 4F56A 1W0KD 1C1HA 1VGQA 2X8BA 3PGKA 2WYOA 3MVPA 4HDQB 4OFBA 4Y2UA 5A7HA 4F8JA 2LWIA 1K4SA 1CZNA 2FJUA 1RTKA 3HUGA 4DLNA 4AKGA 3IO3A 3RCBA 5HJ7A 3FMSA 1L9KA 3MZYA 4XLAA 1QAMA 3DONA 3HI6A 1FBSA 2ZJZA 2BZ1A 3F7MA 1VLJA 3ZKAA 1D7OA 1XVLA 3LLSA 4NYIR 4ZOQI 1V1RB 1DAGA 3QG1A 1KY5A 3UMMA 1XGMA 3GDOA 1K5PA 4J75A 2NVYJ 3FM9A 2WVJA 4D45A 4L0ZB 3GDWA 1ZK3A 4KU4A 3P9YA 4ZAGA 1BD3A 4PC1A 4TL7A 1AMNA 2O7QA 3F8NA 2QE7D 4ZO9A 2SECE 3I6BA 1I1OA 5DM1A 2B5OA 2OBPA 3PQJA 2HLHA 3THWB 2XB2A 3OOYA 1RQ7A 3I45A 4IJQA 1C30B 4C0JA 5I7SA 1NNI1 3A70A 4HDCA 1X1QA 1OWLA 4GP6A 4U5XA 3QTTA 1O4XA 4XWOA 5I7OA 1E0AA 3HGTA 4JX4A 5JAZA 3H84A 4FB5A 3GLVA 2CQQA 1PTJA 2KJBA 3KYLA 1FFAA 1JGSA 3KZYA 1VKJA 2WJGA 4GM4A 4UEJA 1OCRH 5H4HA 3ZQ4A 2R93J 3U7JA 1IN6A 2VJMB 1RVDA 1KOJA 2CLOB 2YASA 5HQJA 1JHOA 3DKPA 2ZOSA 2C4UA 1L7DA 1OXKB 1NXQA 4IP0A 2V0GA 5JANA 4D9IA 1KY3A 3MWGA 4BL0B 2ZDGA 3A7EA 4RHUA 3KB1A 1SGWA 1BA2A 4QHTA 2C2YA 5FTWA 3R7WA 2ZUUA 2BM8A 4X9XA 2HU2A 3P0RA 2WINI 3BQ9A 4GI3A 2FU5C 5AICA 2OYCA 2G1AA 2GCNA 3CCLI 3BA6A 4RL6A 3WDKA 1VCHA 2Z6QA 2NX2A 3T9BA 4UPEA 5E1OA 3BAFA 4HEJA 4L16A 3UW1A 1SANA 1NF9A 4K9KA 1L5WA 1VL1A 5DGDA 1GQRA 4NOLA 3QBJA 1HDPA 2NNNA 2QW0X 1V4RA 3IRQA 4CG0A 3MCZA 3O31A 5L6MB 4NPCA 4F4HA 4LLNA 4U9HS 2JIMA 3I23A 1RJEA 2ZO4A 4GVPA 4ITVA 1WEKA 4FN5A 4URYR 3U09A 4UVAA 1GL3A 1UDXA 2F4NA 3BH7A 4ZQGA 3F3XA 1UMBB 2PVPA 3B5JA 3DZIA 4FFRA 3CUTA 2IX3A 4W7SA 3ER9A 3P94A 3B3AA 2WFAA 3QELA 3FDFA 4QXQA 1AU7A 1X8JA 4RANA 1ZKDA 2X14A 2AUNA 4BHTA 5L53A 4HG2A 2JI6A 1WPKA 2JW5A 4UY8I 1S6YA 2KJCA 1D1PA 1XZMA 3GJ3A 1HZZC 3NDPA 4PYMA 2H63A 1P81A 4QPPA 4HQFA 3PL8A 2F1OA 3C6MA 1BEUB 5G0VA 5KNDD 2X2FA 3TW8A 4Y2JA 5ILSA 1BIBA 4X7RA 3F4BA 3FTDA 3VTFA 1CF7A 1E7SA 4EYSA 3L7JA 2IA5A 3A0BC 2BV3A 4O8CA 4RVDA 4F60A 4DA4A 1OILA 1YXMA 2Z2JA 4NUBA 5FRNA 2I1LA 3ZS9A 3OH8A 2O23A 4BWYA 5IKEA 2XLBA 2K87A 1ZLJA 3TCNA 2C77A 4B75A 2BRUA 2I2XB 3FWYA 3PPIA 5F1PA 2FJ0A 1WZ2A 1ACMA 1TVKA 1WD7A 2IXFA 2K4MA 2OG1A 2XQVA 4I1SA 3E4DA 3PHCA 4C2MJ 1XD9A 2O2JA 1AXRA 4MW9A 3QY9A 2VJQA 1PG5A 4HNQA 4J0KA 1RAFA 1QGED 1QQ7A 2JVKA 3VMMA 4OJNA 5CB8A 3GJ5A 2E4YA 2RBKA 3AIMA 4JP2A 3CJRB 1UBNA 1NBME 1NKTA 1MO6A 4O4IF 4G5GA 3L18A 1UIMA 1PT5A 2XNCA 4RFSA 3SX0A 1P9NA 4O2RA 1IB0A 5IZCC 3B2EA 1MBHA 1P1BA 2XYQA 3NU1A 1QC5A 2HBRA 3VRHA 1U78A 1XGKA 2POQX 1XJWA 3VU8A 1BE0A 1PR1A 4E5SA 2P27A 2Q3JA 3JQQA 5AW3A 1NVKA 2VB6A 2R6JA 1TJPB 1Z7LA 2V96A 1PUXA 4Q3KA 2QF7A 1VQ5I 1X3WB 3G5MA 2FEPA 3DF8A 3EIWA 2PVSA 3LZCA 3OZAA 4DNXA 2J33A 5KTKA 3GJXC 3ZVNA 2Z9CA 2O5RA 1LBTA 1E2MA 4XN0A 4TWBA 4YS6A 1KJYA 3ZHRA 2A92A 3IAS6 4EZEA 3GLFA 2VWPA 2JCSA 4IG9A 3BSWA 1T29A 2GRUA 5EIXA 2FMTA 4PZZA 4FYXA 3GX4X 3SXJA 1M8KA 3AI2A 3Q72A 3H13A 1WFXA 1U6JA 3ONFA 4GVLA 4H7FA 2DHQA 4LTMA 1Y3IA 4TV9B 4D7MA 1KO7A 3QEMB 3W05A 3T8YA 4PCUA 3ZYZA 4BIMA 4FFBA 4N3GA 3ZJ4A 5IKMA 2DT6A 1XF1A 3E97A 3VC3A 1OHHD 4HFJA 2UZ1A 1EEHA 4LBVA 4QUHA 4EECA 2D2WA 4QHYA 4NJMA 1DIHA 1YR7A 4ER6A 4A2CA 1B26A 3GLUA 3LXRA 3B73A 3OU2A 3BUSA 4EZIA 4ZHSA 2OAZA 1P18A 2NU6A 3P9ZA 2NUTA 1AX9A 1H8HA 1HT3A 1P8JA 4EBFA 5FO5A 1JIVA 1XRSB 4LHYA 5AVQA 5CPBA 1FE8A 5HCIA 4GP7A 3TOAA 3F21A 1WP9A 4HHEA 3ZGZA 3MCTA 1PDVA 4FQGA 2HXGA 1QOPB 3PC3A 1YHQI 1USUA 4QA9A 1E8NA 5JAOA 1P2FA 2GN8A 1XRQA 2MMGA 2VUHB 4MKXA 2HU5A 1A7AA 2REOA 2L54A 2HTEA 2UV8A 4TT8A 4DNOA 5BR8B 3G6EI 4R8RA 4DR7B 1RKXA 2HHAA 3K10A 3LCRA 2A3SA 2I22A 4J9UE 2JJYA 3CURA 2DMQA 2FE4A 2X76A 1X3UA 1H6DA 1H9AA 4IHWA 4Q3OA 4U8GA 3AUKA 5FX2A 1AV7A 4J00A 1II0A 1X7GA 1USTA 3E0JB 1SXGA 3GJZA 3W77A 4EENA 3F9IA 4OGGA 2XYVA 2A86A 4A8TA 2XNDD 1MGTA 2NTVA 3L1UA 3TNDA 1A7KA 2WY8Q 3WMWA 4BXOA 2I7TA 4CCSA 2X5KO 1VB3A 3RAJA 3PS9A 4GGMX 5JSZB 4RMHA 1FDUA 3WB9A 3UZUA 1XPOA 2H1FA 2KLHA 2YC2C 4JEIA 2KIFA 2YQZA 4DPKA 1NQXA 1RZVA 4KQ6A 2VNSA 3TBKA 3A1YA 1T6ZA 1DT3A 1HE8B 5BQ3A 3BRWD 3COSA 5JAPA 2NU9A 4UTRA 3GEHA 4EGAA 10MHA 4JROA 5J63A 4NU6A 2D0DA 2FOIA 5DCUA 5CNIA 5IW8A 5C7IO 2H3HA 2B9VA 3EXHA 5HF5A 2CXRA 1FVHA 1VBFA 3NOQA 4A16A 2CDBA 3P5JA 4PBSA 2XA1A 3H3UA 2I2CA 4Z9XA 1ETHA 1HW5A 1WCV1 4D42A 2HLPA 2QOEA 3JALA 1F8FA 2V0NA 3WGNA 1CULC 1JRLA 2G67A 4E6PA 4KPFC 1CUBA 3TTUA 2OA4A 4PQFA 1SA0A 3UEOA 1UP4A 1JKOC 2RJOA 3NHSA 3AM3A 2C99A 1PJ2A 1M74A 3EW9A 3D6TB 4UJ3A 3GZNA 4X20B 3A02A 4QTZA 4DQDA 2IUYA 2HEGA 4IJWA 3IKLA 4JP3A 4QBGB 4A9AA 4F4CA 1YFLA 2O2DA 3IIIA 1HQKA 5LEKA 1S89A 4GI2A 2I4NA 1ENZA 3PNOA 3LWBA 2OD2A 2P6NA 1MO4A 1EA7A 1II9A 2PT5A 4LZAA 4N0QA 5EJ2A 1HEUA 1SUPA 5LBIA 2ZYRA 4WY2A 3EZ7A 4IICA 5FT9A 3IBSA 1MMAA 3DW1X 4WACA 3ESYA 2MHCA 5HKKD 5I3CA 4TGLA 3SQWA 1P7ZA 3T1TA 4XVUA 1PWYE 2RC6A 3EH1A 5FOSA 1UMDB 1NL3A 1E0EA 2IEIA 1OBFO 4TV8B 2O7VA 3AF1A 4AYXA 1NN5A 3T3DA 1VIAA 1VE9A 2I3BA 4P83A 4EGJA 3TOCA 3RC8A 2OVBA 1IQPA 2QUFA 1RIFA 3PQDA 4MRSA 1UXHA 1KFBB 5K8LA 1AB5A 5EAIA 3TQIA 3E9ZA 2GD1O 2GAOA 4C6SA 2HREA 4ZEVA 4ARCA 1NVTA 4KIFA 1NR5A 1K78B 2AJDA 3V1LA 4YJHB 3AG4H 2B1QA 4C21A 1IN4A 1K08A 3N05A 1T26A 4GXQA 4JUAA 4K81B 2H0AA 3EF3A 2X0IA 1K4YA 5K3FA 1ZH6A 3TLAA 1FDRA 2ZWMA 3N8KA 1NUQA 3PXCX 5EKUA 2XASA 2HRBA 2VCYA 4DJJA 2PUJA 1MBFA 4IZZA 1AZWA 4L95C 1IYZA 2FUNB 1HLVA 4XTCS 5AJHA 1DPUA 4NXMB 1E3MA 5ICCA 3RJZA 5FXMA 3DYVA 3IAS2 2HB6A 2TRTA 2X6RA 2EEPA 2WG1A 3AHGA 3AQ4A 1CQPA 1WMDA 2NYRA 1EX1A 1ZS9A 2IW3A 2Y71A 3QPVA 1J97A 4BAGA 4LFAB 1ETOA 1QU3A 4X3PA 2GEUA 5DT9A 3HYLA 4IEEA 4F7ZA 2FUG6 1GZ5A 4NE9A 5BPDA 4AAYA 5HKKA 3S8YA 2XCTB 3CUQB 1NP3A 3RJTA 5AMXA 5CEJA 1FQWA 5JXGA 4QD3A 1AC5A 3FXLA 1CT9A 1E6MA 1KZ1A 1UBTS 3BSSA 3PWSA 1KS2A 3A1FA 3R5HA 1Q92A 4MVXA 2TMGA 1FNCA 2YV1A 3HGMA 4GI1A 4BNWA 3M1LA 2PFGA 2VUSA 3RT1A 2OR3A 2VJNA 4EJTA 1WBBA 2VJBA 2BM0A 1B14A 4K05A 2VLBA 3WI7A 4RKYA 1BR4A 3QYFA 1VA5A 3GLIB 3BCBA 1H42A 1NLFA 3D3QA 3F6RA 5IT9A 3PFGA 3DFGA 1OTHA 2AEFA 3S1QJ 1VOTA 3B52X 4U8HA 3PL5A 4Z53A 1KEWA 1D0SA 2OZ6A 4N9HA 2NG1A 4LB6B 4FR0A 3RH0A 4CT0A 4MULA 2I6QA 1RRFA 2G7UA 2GBGA 3KQVA 1YJNI 3WFZA 4BBJA 1EH6A 4LLGF 3LVFO 4PRLA 4NH0A 2WWRA 1UP6A 3EUKL 3C97A 4WLVA 4EVSA 3O2JA 1J9GA 3CZMA 5ES4B 1KDPA 1U2RA 1PT8A 3BR6A 1RVV1 4OHFA 1KJIA 2X0FA 1T1IA 1SVNA 3RT7A 5DP1A 2HWXA 3V4SA 5HILA 3JVDA 1FBQA 4HH0A 1JEYB 1AOXA 3CX6A 4N49A 4ROSA 6LDHA 2BFAA 1GGJA 3DAOA 4KMMA 1QP4A 3NOXA 1ZR2A 3C8MA 4LK0F 1V54H 2YWXA 4FEYA 1J06A 3LSYA 1DBQA 3FOBA 4DJ5X 1P5FA 5HKBA 1GZSA 5T5QA 3UQYS 3GUVA 3EEOA 1PJZA 4JKOA 4BU2A 1IXRC 1PNQA 2BDUA 4M3DA 2VKHA 3SBXA 1RCTE 2H6BA 4YEJA 4G2TA 4ZYYA 4HPQA 2GESA 3JQAA 1Y3FE 2OP1A 1T2EA 4ZCQA 2WJWA 4EHJA 5IKPA 2F1HA 3I2KA 2HFHA 4D57A 3VOSA 4A0SA 3TQQA 3I59A 1KYQA 1U1DA 3Q5GA 3QOEA 3K6JA 2PEZA 13PKA 1VHWA 4RVCA 5EINA 1NY6A 5NLLA 1F43A 3ITDA 1SZPA 2G40A 1UT5A 4RY2A 3RAGA 1D09A 4Y1EA 3LU1A 3LC0A 2IXSA 5JMWA 3UAWA 5KDLA 3NTXA 5BURA 4MHOA 4LWPA 2LXNA 1GTSA 2BMFA 4ED9A 5KVAA 2LF8A 4XI9A 1PG2A 4FHTA 1MRZA 1REQA 4OHMA 3ESCA 3EZ2A 5AOVA 3ZQHA 4K87A 4MA4A 4WHMA 4YXWA 4LG0B 5B2FA 2ZM5A 3GD7A 3EYWA 1VZ2A 1F7UA 1PYGA 5BYBA 1N5IA 1ZRHA 2X58A 2WT9A 2GLOA 4KW7A 4QG3A 3DVQX 2DBVO 5BSEA 5BSKA 2Z4SA 3H2JA 1W59A 1M8PA 3C1DA 3N8HA 1PV2A 4OHPA 5ITSA 3IDAA 4GRAA 4MEYF 1M1XB 1GTZA 3MS4A 4INOA 5THXA 4EPWA 2UYOA 2IDKA 1L4KA 5JRJA 4NWIA 5ADVA 2XBLA 1U0GA 2FGKA 4N3BA 5JNLA 3FM3A 1XAHA 1J9IA 3HOTA 2YVUA 5F0FA 5FQNA 1BXRB 3CF6R 5E3HA 4EB3A 1VYVA 3IH2A 2L9VA 3QLEA 4CTJA 1YQDA 1I2DA 1R6UA 2Q2QA 3MPUA 1NW5A 4R0MA 4U6QA 1A77A 1ISIA 4WK4B 3VAZA 4ZJUA 2L3DA 2C2XA 1EYZA 1N0UA 2GYYA 2VDJA 3UKOA 1DDOA 2ORVA 1Q22A 2QNIA 3NGMA 4CM1A 5KOHB 2ZYVX 3T4UA 3G0HA 2BBTA 3NYRA 4KO1S 3R61A 2AT1A 1XEXB 2W00A 5ILUA 4HBZA 3FKJA 4PBTA 4W1SA 3VU9A 4BIIA 4QATA 1E5TA 3LX5A 5FQOA 4TWZA 1IWOA 1NMQA 4CDNA 4K7JA 3SZ3A 3B3QA 3KVNA 3SHVA 3LO5A 1Y4DE 3VDXA 2IXAA 3AHEA 2B35A 4J2HA 4MW0A 2ZRMA 1E2GA 3I4FA 3BB3A 4JMLA 5KWIA 1FXUA 1VHQA 2GWHA 2GEKA 5TPWB 3GC6A 1R66A 5GTIC 3NHBA 4NPHA 4V1CA 2A59A 3CNOA 3DEFA 3BG6A 3AKZA 1ERDA 1JSZA 1N5DA 1FTSA 1Z47A 4GYWA 2XY4A 1AHHA 2HCRA 2XAQA 2JVIA 2WJHA 1GQYA 2YWFA 2RGUA 1G2PA 1EVKA 1NYRA 2P5KA 2YJ4A 3AEXA 2K5UA 1KZHA 3BL8A 4HRVA 4Y6PA 5CLGA 4XICA 5A9TA 3TIXB 4F7DA 4ZDLA 1IPFA 5DXFA 4H0FA 2Q3MA 1HRDA 3I92A 4J4HA 5A05A 1GAWA 3AX6A 4AF6A 1TWHJ 3DFMA 2V58A 4RVGA 2XQFA 1W4BA 1I3AA 2FPIA 5A1TA 4JXXA 3JATA 2W2LA 2NS0A 7YASA 2A6PA 3G0DA 2DETA 4AY4A 3CRZA 4QPZA 4ZYLA 3I0TA 1K79A 4TWAA 2FCAA 2JK1A 4A91A 3BJIC 2Q3EA 1HKHA 4DT1B 4TN5A 5FTJA 4ALLA 1EFAA 3ENKA 1DAFA 3DBVO 4TQ9A 1WO8A 4OHKA 3HZHA 4YAKA 4P38A 2O8FB 1V35A 4PFPA 4I2OA 3DMGA 3K0HA 4LJAA 3ZE8A 4DR3B 1HOTA 2CQKA 2VIIA 3TDKA 4AMGA 5JBQA 2QVCA 4GE0A 5G0UA 2RBGA 3O0TA 4EGQA 3WTTC 1HYBA 4ZCPA 1LQTA 4KE7A 1T1EA 4D4MA 1BCSB 2LBFA 1O6GA 3T5DA 2M32A 4I36A 3DLLF 1SG6A 1NVEA 4L4UA 1SC4A 3OOWA 4IRGA 3VWBA 2MABA 1N6IA 3CUQA 2VK1A 3G73A 2VOPA 2RGGA 1R00A 4IHVA 1GCUA 1VGVA 2DWUA 3BD9A 3OPNA 4EF5A 4HA8A 1VPWA 3O91A 2X41A 4QX6A 2D5IA 4US1R 2YFHA 4DMCA 1YHNA 2PQ6A 2RK4A 1O94A 5TXGA 4D8XA 1T8SA 3KJZA 1YB5A 1WXQA 1MAAA 5HVNA 1CUWA 1KVUA 3ZOBA 1ONOA 3HTSB 1Q1VA 2P6SA 1SFOJ 1M6NA 3SZPA 2EJVA 2PGAA 2RCNA 3K31A 4OGWA 2W70A 4BBRJ 1N7HA 5DNEA 2YXLA 3OFVA 1EPUA 1QHHD 2B94A 2XKOA 2VH5R 2R8XA 4RZHA 4AG6A 4DF3A 2JLXA 4GFDA 1HDDC 4M8NE 4EG3A 5D6EA 1JLHA 4EY7A 5BWMA 1ZM2A 3GP3A 2PWBA 2F7SA 3OIQA 5AVUA 5EKXA 1U2EA 3JQPA 5JSYA 4R8KA 3LKBA 4LI0A 4V0SA 3UAOA 1YI2I 4MR9B 3OCUA 3NYWA 2BHSA 2WM3A 3PFIA 1JQ5A 3SYMA 4LQLA 2QX4A 3SC6A 1I6MA 5KWJA 4L9TA 4QJ5A 3PQ4A 2HYGD 5EKTA 2YICA 4UU1A 3SQMA 4A2PA 3DCFA 3HY4A 2P35A 1U0FA 1SFEA 1MABB 1Y9ZA 2VJCA 3D3KA 4URHA 1P0IA 1MFZA 4C7OA 4ZVOA 1BX0A 3CWCA 2KBEA 3ABUA 1ODSA 1XVAA 1Q0RA 2VPYA 1DCKA 2PMBA 4K03A 3UBTA 1KRXA 4EPXA 3AFNA 2VHYA 3OT4A 1LPSA 3MOIA 4J7CA 3O4GA 3PRJA 5J4VA 2G07A 1OX4A 1TFUA 3MINB 1F9NA 2VKVA 3WGLA 3VODA 4CM8A 4EG0A 1Y8RA 2C3OA 4JLVA 1KIFA 3PGJA 4MWEA 4OQYA 1FY7A 1P4AA 1M8JA 1Z6ZA 1VMEA 3CW9A 5DRYA 2Q07A 2WTMA 1XDBA 4RORA 4EPVA 3TNJA 1A9TA 2NO5A 1UKZA 2VJPA 4H7DA 4NBRA 2AYXA 2GLUA 5CA1F 1VTKA 1N2GA 4OQPA 1B16A 2FNAA 2O7RA 4NMLA 3ZBUA 4BQEA 5DLYA 5F23A 3HJCA 1SA0B 4BPRA 1O7LA 4YWHA 1O5IA 1XR3A 4KAXA 3NNNA 3KCCA 5DULA 5SY4A 3VFDA 1Z35A 3W6JB 2DMTA 1MZPA 2NPOA 1TVCA 1UFQA 1Y82A 2IE8A 4NC6A 1PKXA 4U9UA 3NNSA 5JSHA 3KXIA 3T38A 5C1DA 2JCBA 3QM1A 3UJHA 2NU9B 4KAAA 1U7PA 3EPKA 3Q3GE 1PU2A 1AMOA 1G17A 3GCXA 2HSEA 4IEIA 1CQJB 1W0JA 1VQ6I 3NV9A 3R7BA 1VHDA 3RK0A 3WMXA 1I4LD 4B5LA 2PA3A 4HGNA 3G0CA 5LHHA 3GIWA 3HZJA 2ZR9A 2J5OA 2ZZNA 5F7ZA 3JVIA 521PA 4O4IA 1NLUA 4XQ0A 4AJ4A 4BXOB 4Y8VA 1H2WA 2BGUA 2GD6A 2NP7A 2QMYA 4JR2A 1JGTA 3QA9A 3NYQA 2CV1A 3FZYA 4HXEB 1JSRA 2OV3A 4WD3A 5C1BA 3KTOA 5JALA 4DMLA 1GVNB 3IQWA 2HDCA 4GXOA 4R01A 4P0PB 3O3MB 2IA1A 4ZDOA 2GXUA 2EFQA 2G04A 2RVCA 1QPIA 1IBCA 1T4BA 3QU5A 4FXPA 3RU3A 3UGQA 3ZHTA 1USGA 3BL6A 4UDXX 2FZLA 2UZAA 2EZKA 1NV8A 1OISA 1MJHA 1J9ZA 4FCCA 1EFRA 5IJAA 3B70A 3Q3SA 4JP0A 2JC3A 2MSWA 3H3JA 3JQ7A 2AR0A 2GXGA 3FYDA 4XWAA 2WP0A 1NKSA 1MNDA 3LH5A 3S55A 4A3GJ 5BN3B 2NP6A 1KO1A 1LQ2A 2DQSA 2HPVA 4KK3A 4LK3A 1WVGA 4R3WA 4KUMA 5DGCA 2C59A 2I8AA 1KKUA 1EVQA 5IAGA 2UYCA 2IYPA 5BVHB 3IAS1 3PO3J 2FN7A 3QFTA 1N0IA 1POWA 3SS9X 3FXOA 3D2CA 1M75A 3UOWA 3NORA 3QKRA 5TDHA 5JMOA 1SC9A 5ISMA 3FROA 2F43A 4NATA 3IHWA 1NK2P 5DCMB 5L3VA 4G36A 5CJJA 4CQJA 4EJMA 4CM6A 1JDPA 2PFBA 2AK2A 3SFIA 2I8LA 3KQTA 3LKDA 4MMXB 3TBFA 1RR7A 1ZD2P 4G9EA 3LW8A 3SZGA 1T2KA 2XF2A 2GN2A 3BHJA 3AM4A 3DOHA 3LSPA 3AY0A 4E33A 1V25A 3K0CA 3WHLA 4FX0A 1XTSA 1JKRC 2Y4NA 2Z5LA 4MROA 1HNNA 2HKIA 2Q5OA 1WH5A 3LRPA 5EUMA 4C7XA 2PUCA 2C7QA 1H85A 2IU6A 2FJ1A 1EHCA 1Y8QA 4GBED 2GLTA 4M0CA 2HOSA 1LU9A 1BE6A 1LTKA 5DP2A 3H17A 2FZCA 5DWVA 1HG1A 3ROUA 4HPWA 3I1YA 5CB4B 2FZGA 3GVXA 1U65A 4XOPA 2CHVA 2E85A 3G8YA 2GHTA 2PLNA 2Q4RA 4PF1A 5CLLA 4CV2A 1GL7A 3ROTA 3B6CA 5F04A 3SEQA 3JQBC 3TSOA 1TVMA 2B4AA 2ZZMA 2JD0A 1MEJA 1GPAA 4WDQA 2FH5B 3KP3A 2JHAA 4A8HA 3WGGA 2NXNB 1Y4UA 2CJXA 1DAHA 1JX6A 1RWVA 2EL9A 2OUKA 1OC2A 4WERA 4DWWA 4ESEA 1ZZEA 3HH8A 4JGBA 1TMOA 2AGVA 3IQZA 4A5SA 1H65A 4EATA 1XPRA 1G98A 1PJQA 3CC2I 2FF7A 1G18A 3Q3VA 5E3NA 3IR5A 4ZOAA 2O8BB 5CK5A 3RIHA 1EH7A 1XXHE 2FRDC 2A6HF 1WY5A 3OPQA 1PK9A 1B6RA 2I3ZA 1U9YA 2IZ1A 3D5QA 3Q3IA 4OLHA 4Y2PA 2IUUA 3UB3A 4F7WA 5BW4A 5ALPA 4QLBA 1M2GA 1ZOLA 4Y9SA 4E13A 1XZIA 3UPTA 4AZTA 3DE5X 3UMFA 3D54D 1SBTA 4LGVA 4BNVA 2BEVB 4D5GA 4IQJA 4KWEA 3RJMA 5FA6A 5LOVB 3HRIA 2X8AA 2N1MA 2OGUA 4JBIA 4L74A 3VH2A 3GA5A 5JXIA 5JJIA 3PR3A 2PG4A 2FQWA 2JJ2D 1KOGA 1P3JA 1JLMA 2KHZA 1JHZA 2O1XA 1DC6A 1GGEA 3M3HA 5ITWA 5ED4A 1KZGB 3MN2A 1ULAA 3PEFA 4BNIA 2CMPA 3FM5A 1XHFA 2HKOA 1MRSA 4IIXA 3BR1A 2VOEA 4R1TA 4F9FA 4LGCA 3IMGA 1Z9BA 3NI2A 2E7WA 3OQ6A 3OYAA 2AI2A 4EM1A 1DDIA 3F67A 4G4GA 2M8EA 2HWUA 4LBZA 3QELB 4CV0A 3LSMA 4GMDA 3WYEA 2UWMA 1JDUA 2B1IA 2DUWA 1BVRA 5JBNA 1G7CA 4AVZA 1U9JA 1ZEJA 2HPZA 3R75A 5K20A 5FLMJ 1JVBA 4P92A 4BNYA 2WB2A 2LRHA 3KEMA 3I9FA 2J67A 1Y80A 1MEOA 3LUCA 4PAOA 5LR6A 1X4PA 1G4AE 2O4UX 4EY5A 1BCRB 4FHEA 3OFKA 4KRXA 5DWQA 3T61A 1T8YA 3ZD8A 2DY0A 1GKIA 1NN0A 3PUWA 5I48A 4DZJA 4LOIA 4XM1A 3L6RA 1FSGA 1MGPA 1Z8DA 3JCZA 5FH9A 4G63A 4MVWA 1VSUA 3O8DA 3H1AA 5B30A 3HBAA 1OZFA 2GPBA 2WSSD 3LK7A 5CFPA 2BSAA 3HDTA 5EJGA 1TYZA 2IPLA 5I9TA 3RSHA 1L5OA 4O0LA 3V4LA 3LQQA 4L9VA 5J8FA 1DDNA 2Z8ZA 1DADA 5AUNB 1U28C 4ZOEA 3BGSA 1I0LA 2AG8A 3JWIA 4Q4JB 3MTIA 4F04A 5C46F 1G6NA 4YELA 2XB9A 1XXLA 1T2FA 2OILA 3R7WB 3EIFA 3WGJA 2DFDA 5L40A 1PGOA 1Q7TA 2EA2A 1IG3A 2OAP1 3O94A 3QYJA 4YRRA 3D3WB 5HXAA 3DLBA 3L6OO 5F3RA 4I50B 3UXYA 2UZ0A 4BVJA 4C43A 1TTHA 3J80K 4QQKA 2QQAA 2CWDA 2NADA 1X1AA 4MDYA 3O8OB 1A1VA 4GMKA 4NNOA 5JAMA 3MBOA 3DTKA 4QGAA 4A0ZA 2ATIA 2V6IA 3E5QA 3DAHA 2DYRH 5BWBA 4RZXA 3WYBA 4KRFA 2B37A 2BFCB 3A9VA 3FUVA 2ORWA 4MI3A 3DL4A 5HLHA 1HCRA 5FRMA 1K27A 1NN1A 4W5NA 3ADCA 2WWTA 3PQ6A 3TUJC 5BN4A 5H2FC 1ZL2A 1H6CA 2I1WA 4CF4A 1IJBA 4MCHA 3U44B 3CMCO 4QEZA 4DJTA 5JYEA 2ZIFA 1B4DA 4C3IJ 1GPUA 1PT9A 3AF3A 3O83A 4TSRA 3PDIB 2D8MA 4OBBA 1U0LA 1J0BA 4UFNA 5ESXA 1RPNA 5K3DA 4IHSA 2XTJA 2FZ5A 3A0RB 3EFOA 1NBIA 3VPBA 3DB2A 3WL5A 4R2HA 4KGDA 3ZDBA 4YWJA 4A92A 1FYKA 1PSDA 1YS6A 5FEMA 3RBAA 3ZI0A 3AG6A 2HCFA 4DCOA 3UG6A 3AKYA 1X3ZB 1I14A 2VLAA 3CSUA 3PPVA 4B79A 1DJOA 2WMDA 2PCJA 3GMDA 3E48A 1TLHB 3N0WA 1RBMA 1P4XA 3A7DA 4H27A 5FO0A 4EJFA 5KTPA 3KHSA 3FJYA 1D9XA 3P2KA 2OUMA 4A26A 1ESZA 2RG1A 1GTJ1 2ES4A 1XD7A 2PH3A 3B12A 3IDZA 3NONA 4OHZA 1JIIA 2XBUA 5GJWC 1OXMA 1PZXA 1T36B 5COAA 4D82A 4TYNA 1VG1A 4BFLA 2NVXJ 2E5LB 1B41A 2FRHA 2RHOA 2TSYB 5CDFE 2R751 5D8KB 5DTJA 1U3WA 3UAZA 3G0GA 2BI7A 5HWSA 3WE3A 1KU3A 2R7KA 3DXFA 1UHSA 2Q9AA 1ZDMA 2X48A 4EVRA 1KR5A 1UJ8A 1T3GA 3DE1X 1GD1O 1Z6QA 5EWLB 2FCRA 2H09A 2JA2A 4NCJA 2DQZA 3IP3A 1QORA 3BTIA 3OOUA 1MEEA 3E6DA 3D59A 4ZYHA 2QS9A 4HZIA 4KSYA 3QRFF 4IWYA 4DABA 5LKAA 3FNFA 1Z8NA 1JZQA 2DQKA 3EOBI 5LBTA 1JFTA 3CCFA 3UB2A 2IEBA 2WAQN 1KTIA 1CEYA 1P4WA 3EXFA 1O6FA 1AKHB 4UOQA 5LP6A 2O6HA 3LJKA 4JI1B 3B2NA 3JTGA 3BQMB 4J1NA 1D2HA 5B6JA 2BTOA 1KEZA 2YHAA 2ONCA 4IGAA 4BNNA 3NKFA 1Z2OX 4L9RA 4A93J 1U9IC 2DGDA 3M4YA 4JAVC 3CIOA 4NH4A 4NZPA 4UPVA 4JVNA 4ZI7A 5CQEA 1EVYA 3BTOA 2EFCB 3FXRA 5FD8A 4F2PA 1JF8A 5M29A 2ZK7A 3KL4A 2MH9A 2HVQA 1VRWA 3LRXA 3PGVA 4K1XA 3CD6I 3QU6A 1CJCA 3I6YA 3JYPA 5I47A 3HP7A 3CG0A 1C14A 2QUBA 2NS8A 3O93A 5L7TA 3AUXA 3ED1A 4ZYTA 3QTLA 3PC8A 4OJKA 3T7CA 4BJHB 4UB6C 3OQOA 2W6CX 4IZHA 3BG5A 3PSIA 3GLIE 5K3CA 3QODA 1IW7F 3W2WA 3KVOA 1AGXA 4HUQA 4IIJF 3FPLA 2CD9A 4RJTA 2KP6A 1GG8A 3OP1A 4GC5A 3S68A 1NVUQ 3E8SA 2BFFA 2YVLA 1DT5A 1SOWA 3CHYA 2A78A 1W48A 3KLBA 4LY6A 4M9CA 3WNBA 2ZB9A 3EMBA 1GN9A 4DWOA 1TK2A 3O3CA 1LX7A 3GEBA 5HS6A 4IUBS 4D43A 1U1GA 4NI5A 1OGJA 3GO4A 5CR9A 3ML1A 1L5NA 3GTKJ 3C4VA 2P5VA 3GGOA 4JYBA 5FWYB 5C8XA 2V6EA 1VQNI 3EGIA 3E0QA 4JFAA 2CXUA 1GV2A 2GA1A 4HBLA 1GQOA 2B0CA 2O52A 1H4VB 4KFTA 1KP3A 3NAZA 5IUNC 4FUTA 1Q50A 3IMEA 1HDXA 1KMHB 1NUAA 1P75A 2FZVA 3L6EA 4FR2A 1O97C 4Q4AA 2Q9UA 1ZAYA 1VLVA 3D6MA 3EYAA 4N8EA 1GPH1 5KQMA 4ZDJA 3EUAA 1D1TA 1JSXA 2CKDA 1WCWA 2OO3A 2PZAA 5D3KA 4UVCA 2ZT8A 1E1CB 3NRVA 2PJPA 2ORYA 3UT0A 1ZIPA 1M67A 1EWRA 1R0ZA 3B6AA 4M36A 4MUYA 4FT4A 3RREA 1N77A 3BWMA 1Z5GA 4XLTA 3RE1A 1Z5WA 4XKCA 1BW9B 3KJHA 3K9FC 3MMXA 3UATA 4Q4CA 2NTEA 4X66B 3LFKA 2VS1A 1XX5A 2P2GA 4BTEA 1AUXA 1U6GA 2GDZA 2WUDA 2X5JO 1RKBA 4MVJD 3JQGA 4RELA 2BTQB 1UJ6A 4W9MC 5FADA 3HNRA 4I1OA 5JWHA 2YJ5A 4U39A 2V6BA 1PFWA 4Z9FA 1GNTA 3U7QB 3ZHCA 5GM1A 3WFIA 3B9PA 3I2JA 1EJ9A 1BHJA 1G9TA 1WMSA 1R6TA 3WU1B 2R65A 3JQDA 2JA1A 4L7QA 1WBDA 1XO1A 5KSOA 3RVBA 1ZN7A 4KLRA 5CDGA 5I7WA 1NHGA 1U3CA 1KP2A 1TD1A 3TLKA 4M83A 1RZ4A 4IVNA 1K5HA 1K9VF 1C1YA 3LYAA 1U0OC 2KRHA 3OKPA 4OGFA 4QU0A 4WZAB 5DCYA 3U80A 1JMKC 5KVRA 1TCCA 5A5VA 3OUTA 2O8FA 2F4MB 2CK3D 4A0RA 2TYSB 5JI6A 2QT9A 2E5NA 4FOOA 2FSHA 3AOEA 1JW9B 4X93A 1TPYA 4BC1A 3B7PA 5H83A 5KTMA 3HOUJ 3ADKA 3JW8A 1NBOA 2WY2D 1TCVA 3QJ5A 5DLEA 1GLNA 1KZ4A 3JRWA 3C41J 3QGMA 5E7IA 4MCJA 3F6SA 3RIMA 3WR5A 2EKZA 3CH7A 3O2SB 4WN9A 2DHEA 3AUFA 3LP5A 1II8B 4RVHA 1JR6A 4CL8A 1NFFA 1NJ8A 1U4NA 1ZMRA 3OPYI 1J2XA 3D6JA 3JD0A 2VAXA 4M9UA 4Q01A 4OMDA 5J2TF 4FGJA 3R9WA 2DLLA 2YL2A 3LC7O 4PJJA 4HX2A 2NXEA 3C5EA 2FOXA 4P2GA 1L3IA 4NENA 3OYEA 1S2GA 3M9LA 2OCXA 4EHIA 1LFPA 1FS5A 3IT2A 3L2VA 4DB2A 3MYYA 2BELA 4H2DA 4LYHA 3PL1A 4EGFA 2FSPA 1QCDA 2OHVA 3KHKA 3GPCA 5IJ0A 1NQ5A 2G7ZA 1QRYA 3MOSA 4ZJYA 3L2CA 4LJZF 1KYXA 3C1AA 3PXUA 4GBJA 5G53C 6NULA 1EQAA 1G8XA 1VL8A 3L00A 3OF2A 4MEJA 1QVAA 1LUAA 5LLSA 3ZCTA 1TQ8A 1UXJA 3LAWA 1Z6GA 3ORFA 4NKRA 3CP8A 4CCNA 5AWFC 3TQCA 1BD4A 4D8WA 5GIPE 1BA5A 5CFLA 1FUEA 2BVMA 2VDLB 1ZBQA 3FUXA 2C29D 2Y0DA 1TKAA 3SR3A 3SYNA 5HUQA 4URUR 3ECOA 4ENPA 1TWCJ 3G79A 2VATA 4LWOA 1T1GA 3TRKA 5K8CA 1JR3E 1FTGA 4GRIA 3E7FA 1YZNA 1VG8A 5H9WA 7MHTA 1SUFA 3BD7A 2PX8A 4Q3LA 3F3KA 4MWTA 2GBLA 4MSUA 4KIGA 1FIPA 4YRKA 3E1KA 2NVWA 1SY7A 3OZ7A 3Q98A 4FYPA 2AQKA 3JAKA 4BP3A 4CKWB 4DIDA 1LVAA 1UP7A 2D5CA 5M5XJ 2Q1WA 4TUYA 1MB4A 3VPHA 3WP1B 1KGSA 1SAUA 1LDNA 3LY7A 4BYGA 5J1TB 4I46A 3M3DA 2AUTA 2E1PA 3JY6A 3F9CA 3OO1A 1IVSA 4MWZA 1EKXA 4D3DA 2IJLA 3OPYA 4FOSA 1DP7P 2WWIA 4QG7A 3OS2A 4KWIA 3SJCA 3JX9A 1P6RA 1KMQA 3P2MA 1L9XA 3CC4I 2OWDA 4TTVA 4U7GA 4H6PA 4DCCA 2XGOA 3KQNA 1EK0A 3GG9A 5EWMB 5JCZA 3QF4B 2BHNA 2XB0X 2JH8A 2ZUDA 3C5CA 1M2WA 3DT9A 2DBQA 5K2MA 2VJJA 2QUJA 3TRJA 1LCIA 1N0VC 3V34A 1Y8ZA 4BWGA 1Q95A 5FTLA 3UF0A 1OGYA 3SDZA 1VCMA 2GHRA 3GEMA 4O1HA 3UHFA 1PVOA 2NTJA 3LT4A 2SKCA 1JN0A 3BFXA 3IQEA 2ATVA 4KDPA 4PPNA 3F0CA 5CG2A 1GLVA 4M9XA 1P0MA 3K4PA 4AF8A 1M2OB 2VA9A 2V74B 3EMVA 4RF3A 4CGZA 3WGVA 3NWEA 2M6KA 1C0WA 2XHZA 1M5TA 1DXHA 1L8OA 5DYWA 1IY0A 4AWAA 4RDXA 5L3FA 2XMRA 1JIUA 4G5YA 2RGNA 2C61A 1M0TA 2QTRA 3NKVA 5AOBA 5JCOC 3OU6A 3B2QA 3H2IA 1SOUA 4HLUA 1ZIOA 3AETA 3DEIA 3FNRA 1MC4A 4HUQB 2X8JA 1YH3A 2QZSA 1FL9A 2W6ZA 5B3AA 1TZLA 3LF2A 1H8AC 4CXMA 4C6HA 1IRXA 1PUFA 2C2OA 3N2EA 1FNDA 2WZQA 3A9SA 3HJRA 4X97A 1GKUB 1OQAA 2P9QA 3H5VA 1RR6A 3KM0A 2V6CA 3I9KA 3TIFA 1EQUA 3RG8A 4FHCA 4BJ3A 5BSUA 1F0KA 1XGOA 1L6IA 1YB4A 2QVOA 1XS9A 2Z3WA 2PYZA 3FSJX 3N8NA 3SZRA 2JAXA 4IIUA 2XUKA 2PFSA 1CW2B 1AUQA 1CERA 4CMAA 3QV2A 2L9RA 4ALIA 5ALHA 1ZESA 3PWZA 1JEAA 4M22A 2GO7A 3DOOA 1NC3A 5CLIA 1QUEA 4JNKA 4P3PA 2ZR7A 5AQEA 4BMDA 4GT1A 3RRBA 4CMBA 1UKVY 5AVSA 4ZQCB 3OJEA 2XTZA 3ONVA 4D25A 3PVZA 3C70A 1H9GA 5BQTA 3BSFA 4CUGA 1F3LA 2DTDA 4FE3A 4JJKA 1E1CA 4UAUA 2YU3A 4L5IA 2XCIA 5K3AA 4RTKA 1WHTB 2HJGA 3FXUA 4BVAA 4IQ0A 1XMQB 4XNFA 3H0GJ 1EESA 4YJ2F 1KFEB 1ZXXA 2Q2EB 2CL5A 2G5PA 1UFRA 2GRAA 3DV0A 5SYMA 4KR9A 1KMHA 3V4RA 4LMAA 1R0BA 2VAVA 1MBGA 1KF0A 2DQYA 1APLC 1PNOA 3NJRA 4HWOA 4OXKA 3W6VA 4TSFA 3L8YA 1XKLA 4RTSA 1PNRA 1IXZA 3OQJA 1G3IA 4DSTA 4Y52J 5JQGB 2YMQA 1YQ9A 3W7AA 2BE5F 4OKNA 1BAPA 3ZHSA 3ZD6A 4IW3B 2R47A 5BW8A 1XOIA 2FEAA 3R77A 5IT4A 4MV3A 4C0WA 2P2YA 3IAXA 3S1MJ 3FHZA 1KIAA 2O0MA 5KHLB 1RLMA 4BLVA 1XT6A 3FTFA 3FLEA 3G7NA 4C4RA 4V39A 5IWAB 1RMTA 4F9GA 4OU4A 3MKWB 4G5XA 5KVQA 2AF4C 2JB9A 3QMVA 4L5CA 3X3HA 4LMYA 3UNXA 2JAUA 2EQAA 5BNIA 2DLCX 2LOOA 3T3PB 2IRFG 1WEHA 2I4OA 2Z8XA 7AT1A 6PFKA 5C7YA 3K0SA 3FFWA 5KTNA 1M2VB 4E6KG 3ZWWA 2PZBA 2NVUA 2QDXA 2ZRNA 4CM7A 3T3OA 2YS9A 5AVRA 2O54A 4DN6A 2AKEA 1FDVA 1ZIXA 4LDPA 3RV4A 1PW7A 2FZ4A 2PZJA 3P45A 4BNDA 2Q62A 4NJEB 3EDPA 1IRZA 2XITA 4P22A 2ISZA 2DK8A 3SIWA 1N9GB 1VB5A 1W581 2ECOA 4V0NA 4YO7A 1Y3CE 1NW6A 4W1RA 5EHXA 1JH9A 3ITEA 5AW6A 2BFCA 1JJ8C 2D1VA 3F3YA 1E2PA 1JSCA 4K88A 3T3NA 2ZJQF 1CS4C 2AG0A 4XD7D 2X7HA 4B73A 1L4NA 1MH9A 1JG1A 2Y8EA 4HAOA 3IQFA 2W2QA 4ND6A 3WGKA 3WLOA 4P7KA 3TGNA 3ZH9B 4DA7A 2V97A 4JEUA 3SJ7A 5CVCA 4D9NA 2WU3A 4BLWA 3I01M 4O63O 2PQ8A 4AXXA 4MQEA 1MJGA 4I50A 4LJYA 1STOA 2HNAA 3DCIA 2N9UA 3WL7A 5TMPA 2HR1A 3LAJA 3MKLA 2V1DA 2H8KA 3IQDB 1NR7A 1RTTA 4FIZA 4QGHA 3LA3A 4BX2A 4Y4RA 3HUEA 1HXHA 2C5GA 2AH5A 5HF9A 2Q2WA 2X15A 4Z4HA 4ZEMA 4HGYA 2YV4A 3TH5A 1AKTA 1C4WA 1E92A 2CZCA 4LDJA 3NKLA 2GR9A 4DQKA 3QVWA 4XGKA 3VYUB 2JFXA 3PFHA 4L57A 1T0HB 2X5XA 4F6CA 2EATA 4LQDA 4ZKDA 4J01A 2ZUWA 4RGYA 3MIIA 4ACAA 1R0CA 1GIAA 4D0SA 2JNWA 2LTAA 5JC1A 3OQMA 4CEIB 1WULS 5CHEA 1P7JA 2WAOA 2W85A 1IXKA 1BVUA 1E9SA 4X94A 3WISA 3W6OA 5KTOA 5M34A 3HRSA 3FMQA 1CQZA 2ZBGA 1G55A 4IIJA 3ZHZA 1RRVA 3G3ZA 4FKZA 2IYQA 3CSDA 5DI9A 3LCVB 4CN9A 2RBEA 2QY6A 3GRKA 5JCJA 3TPCA 2CLIB 1YT5A 3W2EA 3J7ZI 5KJ1A 1AVTA 1SKAA 3VUEA 1E9BA 1ORKA 2OHHA 4EHDA 2RKBA 3D8NA 3S6JA 4R1LA 2CYBA 4NCBA 1DJMA 4AIJA 1OXVA 2D2FA 5EYPB 5LDGA 4NC9A 2PBIA 3F6YA 3GUUA 4B40A 1THGA 1Z9CA 1XV5A 3C4QA 2BKVA 4OP1A 4B6SA 1GPLA 4CT5A 1HETA 1P1KA 3TKYA 4MEAA 4G2NA 4E12A 2B2XA 5CCEA 4W7IA 4NHJA 1ODTC 1MC5A 1TUBB 3KDSE 1E32A 4KMFA 2OBXA 3UAGA 1IM8A 1YHZA 3V1NA 4J0GA 5IZCA 2PLWA 2VBXA 3OM8A 1M83A 2JHPA 3LY9A 4LXHA 3UB4A 5LOVA 1K3UB 4IKEA 3D7SA 4BMOB 2QD1A 4ENVA 5JZBA 1XVTA 5EHQA 1T56A 3CH5A 4QOFA 1SXJD 4BAYA 1A4UA 1NX9A 1TZJA 2GK7A 3GZJA 3TR0A 3FRJA 4PQEA 4FMDB 3KT6A 1GUUA 3L77A 2VSYA 5CA1B 4BZWA 2FE3A 5JLWA 1K6MA 4L76A 4URVR 1ZJ5A 2B1JA 1MJ9A 3QQ5A 3D5SC 1CRWG 1H8HD 3EH2A 1C9MA 3SIXA 3BIOA 5JFGA 2B92A 1RJFA 4NONA 2IP1A 1NG9A 1PEKE 4PRKA 4N3NA 5DM60 4Q05A 4F4FA 3WGTA 4PHFA 4F8EA 4MUGA 4D9HA 5FTNA 1B8PA 1QGZA 5B3LA 3WHCA 4A8JC 2QGZA 5H6QA 1AHNA 2G5GX 3KK0A 4HQKA 1QIGA 4JLKA 4PX9A 3D31A 3HHEA 1CUYA 3LFHA 2JANA 3IAEA 1EVJA 4N41A 1JI0A 4KO8A 2DK5A 5IM4F 1PVEA 2YRFA 5EJAA 4RGXA 1DC4A 3FBNB 1Y37A 1M1YE 1ZK4A 2PQ0A 4QFCA 5EY5B 2VPWA 4B3SB 3QPAA 1FSZA 1QVRA 3KPYA 5K0EA 4RFLA 1TU0A 1DX6A 4DDHA 5ALNA 3G2BA 2CSOA 3A3NA 1J0RA 1XWIA 3CM0A 4NECA 3S8MA 4YA6A 5JJ5A 5DMXA 1PKEA 3BBPA 4XSHA 1PGQA 1L5FA 2LDXA 1OR7A 4FZJA 4UHFA 1BQEA 4XGRA 3DMDA 4J76A 5CNJA 5AXAA 5J4KA 4A0FA 4AIKA 1N5OX 2FD5A 1QZTA 3AUTA 3OO0A 2VPXA 5KIAA 3ETEA 1JXMA 1IJFA 1FDWA 3PD7A 3ZY2A 4QPJC 4HBGA 1YX5A 3S3MA 3F78A 3V8PA 4E5KA 1D3AA 4MP6A 4KWTA 4PWYA 3WB2A 2G4CA 4FUQA 1YIJI 1VI6A 3W8EA 4DSUA 3MT0A 4PXYA 5EGSA 2GUGA 5A2QZ 5GJCA 4KN9S 4TLCA 3FOFC 4DRXB 1CJUC 1FUKA 3HKZA 2GPAA 3LGXA 2WSSA 2QGFA 3ME5A 4FMCF 4NICA 4QDZA 4QOIA 3FWHA 1C7JA 1AF4A 2HMUA 2ZT7A 1C9EA 3FMOB 4FFNA 4TKUA 3CLUD 3FYUC 3WOVA 1YL5A 1TEHA 2R9VA 4IJAA 4ESJA 2WPDD 5AI9A 3R7SA 4BVGA 1SXJA 2F1JA 3D4NA 3F96A 3QPBA 4PLYA 4TLBA 1DC5A 1JJIA 2VSNA 2YZMA 4OOEA 4TX1A 1ZH8A 4R7TA 1JI3A 3JD1A 4V2IA 2H5IA 1PN3A 3L1VA 2E1MC 5A3JA 5K6AA 1NYTA 3K9CA 2YC4C 2AIRA 4C6TB 3GJ8A 3GHHA 5C4XJ 1FYFA 3HA5A 4BV3A 2EPFA 4XQFA 1JL3A 4H31A 3RLIA 4UNPA 2O8BA 1YCDA 3H9QA 2Y4OA 2NSJA 3MAGA 5JHHB 5IHXA 1JE8A 3BK1A 4PWZA 4R3UC 1OX5A 2VN2A 4HLDA 4L6IA 2VK8A 4E1AA 3DEUA 4F3RA 1FQKA 1K4KA 4FMBB 5AOCA 1CUSA 3FKIJ 4KZPA 4D5EA 4YV0A 4F55A 3MERA 3SF0A 4O4JB 4PSXA 3UOGA 2NPIA 4EG4A 6REQB 1ZJWA 1LI5A 1K86A 3PD0A 1YZHA 4ID9A 2R7FA 2CE2X 1Y4ZA 5EIFA 2PN1A 2JJ2A 4PGMA 5IH7A 2HIAA 5I45A 4ZYVA 4V2GA 2LCFA 5LMZA 1S2MA 1UXKA 4DA9A 1AKRA 5CB4A 4Z1MA 5JNSA 2W8ZA 1QAQA 4YVFA 5GWXA 4IDCA 5KJEA 3HGGA 1YDGA 3O8QA 5CXSA 3RU2A 1Y8QB 3FD8A 5BMVB 4JLOA 1SAXA 3DDUA 1OOEA 4YR7A 5IWCA 1D4AA 4LMPA 3AEUA 4HYEA 5AVWA 1Y7IA 3DP9A 4TRJA 2PUTA 2C00A 2ONJA 2HSDA 2ZXUA 1U81A 2BFDA 1N7JA