4EVIA

Crystal structure analysis of coniferyl alcohol 9-o-methyltransferase from linum nodiflorum in complex with coniferyl alcohol 9-methyl ether and s -adenosyl-l-homocysteine
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
368
structure length
360
Chain Sequence
b'MDAATAVELLDAQPQVWHHFLGYINSMTLQCALELDIADVIHRHGHPIPLNQLAAALEIPQTKAPFLSRLMRMLVHLGYFTQVITKLPSYWLAPLSRLLLKQNPYNARSLTFCSVHEHLVDPWRQMSAWLRTGKEDGKDTPNAFAFAHEGKKVYEVCSEDANFSQLFSEGMAGDSWLFSRALVSKCRDAFEGLSSLVDVGGGTGNTSKVIAETFPNIHCTVFDLPHVVSGPKQTHPNLDYESGNMFTDEIPHADAVLFKWVLCDWPDEPVLKMLKQCKKALTKNGVKGKLMIADHVLDHESCNDSNSMGTSLILDMLFMSFLEGSLRTEKQWAKLFAEAGFKDYKITPVGGLRVLIEVYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coniferyl alcohol 9-O-methyltransferase
publication title Structural analysis of coniferyl alcohol 9-O-methyltransferase from Linum nodiflorum reveals a novel active-site environment.
pubmed doi rcsb
source organism Linum nodiflorum
molecule tags Transferase
total genus 128
structure length 360
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4eviA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4eviA02
4R8HA 3B73A 1DDNA 5FQNA 1BBYA 5HIKA 4RTNA 3I5UA 3HRSA 3KE2A 3ELDA 5E1MA 2JT1A 3HOTA 5A2QK 2OXTA 1XGSA 2ISYA 2VT3A 3Q9SA 4KNYA 3V7RA 5EC8A 3TM5A 3S68A 5K8VA 5BOXA 2HV9A 4HA8A 1G8AA 2WK1A 3FPEA 3NRVA 4PIMA 2K7LA 3CUQB 4ETSA 3ZMDA 5LHGA 2OZUA 1EJ6A 3QOWA 2GAUA 1LDJA 5A2QZ 2NXCA 4CZZA 4F84A 4DQ2A 4WF2A 4E70A 3IEIA 2FBIA 2ZW9A 4U7DA 1FP2A 1NE2A 4HV6A 5FWDA 2E7WA 3DEUA 2UXXA 1JQEA 3PFIA 1G6Q1 3EGEA 5L3GA 1EAMA 3L09A 2BR4A 2QRVB 3BKXA 3ZMSA 3BZBA 4QDKA 1KU7A 5HDGA 2BR5A 4CXMA 2MH2A 3EVDA 2JRTA 5K09A 3W6JB 2E7XA 3K1NA 1U5TA 4HC4A 2ESRA 3LBFA 3PQKA 2VS1A 3HP7A 1WG8A 4FT4A 2A14A 2UYCA 1TQPA 4RB2C 5EMKA 5H20A 5HOOA 5ILSA 3WGIA 5BXYA 1HKQA 2CMGA 3QU3A 2Z6AA 3RYRA 3BY6A 3CC8A 2FCAA 1D8KA 1QGPA 1KR5A 3K0BA 2L3DA 4BNCA 1D3YA 5FHRA 5EG5A 5DXJA 4L9JA 3SXJA 4AD9A 5L3EA 3DMFA 3NWEA 3BT7A 5FQOA 4UNOA 2XAJA 5K03A 2A69F 5F1RA 2LDUA 2PBIA 4S04A 2PT9A 4DKJA 1G60A 5DM0A 2G9WA 3MEXA 1D5VA 1Z3CA 5DM2A 1WRJA 1YFHA 3KHKA 4DF3A 1V3FA 1P4XA 3OV8A 2IPQX 3DUWA 5HS8A 5J8FA 2V1XA 2OD5A 2DO7A 5FTWA 2O3FA 3GRRA 5BPDA 1LEAA 5L3CA 1FYMA 5E9JA 2EJRA 5DM4A 3AJDA 3SXYA 4LLNA 3FWEA 5DYMA 4A5MA 5LHHA 1H0MA 2Z9OA 1N7IA 3HCEA 5FD5A 5EKUA 5CIYA 3SSOA 4ESJA 1UWVA 4PONA 5EGSA 1T0FA 3ERED 1M6YA 3L00A 1F3LA 3ORHA 1L9KA 2GA2A 2LNBA 4U7PB 5GM1A 2CGPA 2HGCA 1DCTA 4EJWA 3K6RA 4KRGA 1JG3A 2HEOA 4I0BA 1INLA 1JHFA 4RTSA 5DTRA 3E6BA 3TMAA 1AWCA 5EOVA 5EIWA 5DT2A 2ERCA 3P7NA 1ZG5A 2QBYA 4XRFA 4XUCA 1BI1A 2UXNA 3KZYA 4ZYGA 2AOTA 3HYIA 3CDHA 2YX7A 4WK8F 2PJPA 1F5TA 4FT2A 4X61A 5ICGA 4GO1A 4ZYDA 2E1CA 3AWIA 2DT5A 4U0YA 4O3MA 3DF8A 5CM2Z 1U5TC 3M70A 5D5VB 3TPZA 4DQ0A 1SFEA 4I01A 3MZHA 1KXZA 1SD7A 5K0BA 3UA4A 3PLAE 5CVIA 1WXWA 3BWGA 1Z05A 1XCBA 4UOEA 3HHGA 3X0DA 1V39A 2HWVA 2VC1A 1J7KA 3V8JA 1HSJA 3C6MA 1YLFA 5DTQA 3RPQA 4PCLA 4YUVA 4B17A 1IRFA 4N9IA 2DPDA 3REOA 4UVCA 4RGUA 3IRQA 3HVHA 1FP1D 4EVIA 4OIPF 5DD4A 2RGVA 2ISZA 3U81A 2XYQA 2XAFA 3LQRA 2PMHA 4PNEA 1UFKA 4Q48A 3G89A 3OZSA 2QWWA 1L1EA 2L4MA 1BKYA 5E2AA 5U4XA 1ZGAA 4IWNA 4GC9A 3G5TA 3HA3A 3FHZA 3ER8A 3FM3A 1USSA 3HHHA 1RUOA 4EKGA 4KT5C 4A6EA 4H0EA 3HOSA 3RTRA 4AWXB 2GA1A 2PSSA 5D1NA 3EETA 2OZVA 3HNRA 3A26A 3M1EA 2QE6A 1XGMA 3H92A 3O4FA 1M0EA 3B3GA 2DAOA 3GEZA 3G2PA 3CJRA 2MLGA 2AS5F 3ML6A 4HOBA 2EV0A 1A04A 3WTSC 1ON1A 1UB9A 4HX8A 4PCQA 4R1HA 1ZAOA 3V7SA 2OB1A 2P3OA 2UYOA 1EV7A 5KYGA 1YZ3A 3E7PA 2B9EA 4GYIA 3WSTA 4AUKA 4OIOF 4GOOD 3KPWA 3ROUA 4LLGF 3ELKA 1ZRCA 4QWQA 5FFZA 3KETA 4NECA 3KP6A 1QO0D 2XVCA 2MBFA 2VE9A 3PX3A 2ZKZA 3RKXA 2HFHA 3CLOA 1MGTA 1L3LA 4L0YB 4KA4A 6PAXA 5LQUA 2AVDA 4N0BA 3IC7A 4EGZA 3DXJF 4IRIA 5CVDA 3WTWC 1F1ZA 2LF8A 4C03A 3F4KA 3FTDA 4WXCA 2ZLBA 1Z6TA 1RJEA 3V8KA 3G8AA 2VZ9A 4FR0A 4C05A 5HS9A 4KWCA 4HF0A 2UYHA 1EJ0A 2GLUA 1XXLA 4GGGA 2XVAA 1O54A 1WY7A 1S7AA 3B89A 2QVOA 5BQTA 1BJAA 3ZPLA 4FS8A 1FPQA 1XSVA 4O29A 3C18A 3GGDA 4MTLA 2VBYA 4XLNF 2Z6UA 3KR0A 2XYRA 2HR1A 4PWYA 1X1CA 3G2MA 2DQRA 2CWEA 4E2WA 1BIBA 2JZYA 5DV5A 2HDCA 3BWCA 4EV0A 4GQBA 3BP8A 5K0LA 4ENNA 3K0LA 2XV4S 4LB5A 1QBJA 2AN3A 3KQYA 2D45A 1WS6A 3R3HA 2IDJA 1KYZA 4MNUA 1HXDA 1G6NA 2LKPA 5CVRA 1FBQA 2HS5A 3MTIA 1IN8A 1O7FA 4X60A 3KZZA 2W84A 4RV9A 3M4XA 3HEMA 3C3PA 5CUQA 1ZRDA 3FRIA 4L9TA 1IAWA 5EMMA 4BHBA 5E18F 1YW7A 3THRA 5LHIA 1F4KA 4KDPA 1G3TA 3T0YA 2J5OA 4YIIA 4R6XA 1ULYA 2ZBRA 4R79A 2VOOA 4XSZF 2XKPA 5HEKA 2ZZKA 1B59A 5F2NA 2P7CB 3QPHA 4OIRF 2IIPA 3WU1B 4DNCA 3KFWX 2ZIFA 3KLNA 1ZYRF 5F2KA 2XYVA 1JSZA 5HS7A 1VIDA 3BPXA 1KU3A 1Z9CA 4ZTBA 3OPNA 3TR6A 1DUSA 3FMSA 1SD4A 2VN2A 4HBLA 1X1BA 5KQRA 2D1HA 2GAFA 1R1TA 2MC3A 1R6AA 4F7ZA 3VFZA 1R36A 2H00A 4RSRA 3A7EA 5G02A 5KK1A 3D0SA 3THSA 3R24A 3M8EA 4EJTA 3P71T 3JSPA 1HKSA 5EIFA 2EFPA 1TQMA 4PYNA 3VC2A 3QAHA 1YO5C 2H11A 3JWHA 3ABTA 4I2OA 4FSXA 4CHUA 2KRFA 3M33A 3NWBA 4OIQF 4E33A 5HLIA 1LB2A 3R0JA 3ZN0A 4POOA 5DSTA 2D1VA 2IT0A 2K4BA 5K0EA 2VE8A 4EMSA 4KUMA 1JG2A 3KQPA 5P8WA 2V9VA 1IN6A 2I7CA 3V7CA 3AY0A 1FC3A 2AOTB 5HILA 3SSMA 1ZARA 5D4SA 2AZTA 2B25A 2YX1A 2KKOA 3Q9VA 4RS8A 4PGGA 3GLXA 1KGSA 1L3IA 3LA3A 3LDGA 4LFUA 3R6TA 2YR2A 3DXXA 2IW5A 5K5RA 1BI2A 5K0NA 2HKOA 2XGXA 4WCGA 3KPVA 5EPEA 3FRHA 1ZN2A 2X0LA 3IKVA 2RVCA 4G94A 4ON0A 3JW4A 1XD7A 2LF7A 2ADUA 2LSOA 4YFNF 1QPMA 5C1IA 4KICA 1QAOA 3S2WA 2NP6A 4HX4A 4P58A 4G6DA 1K78B 3HTUA 4A0YA 2XROA 5LQKA 5HIMA 2IBTA 1E2XA 3O6BB 2BGCA 1O9HA 5GM2A 2Q8KA 2W57A 2UWMA 1XJ5A 1BC7C 2FYTA 4V0QA 4GBED 2FQ3A 2HZTA 1ZH5A 2OA4A 4XCXA 3U2RA 4Y30A 3P2EA 2AOVA 1FSHA 1IW7F 5CCBA 4R6WA 2Z5UA 3JSOA 3GFIA 2KIMA 4PCAA 1B4AA 3TQSA 1WZNA 4EM0B 4BY9E 2CW0F 4IVNA 2DI3A 1R22A 2HTSA 5CLSA 1LVAA 2CKDA 3MCZA 4LD5A 3HSRA 4FGZA 1SVUA 3GRUA 2YSRA 3GF2A 5DX8A 2ZNZA 2JJQA 2XIGA 5E1ZB 5FA8A 2DK8A 1EG2A 1BC5A 2OBPA 4A0ZA 5HLGA 2F5EA 1T38A 5T6BA 2WV0A 3UJ7A 3ECHA 1LDKB 2MA3A 1XVAA 5KQSA 1Q0SA 1U3EM 2ZVJA 4EQZA 4Y17A 5D5WB 1BIAA 1I1SA 1FNNA 3RYPA 2CSOA 4FX0A 2V7EA 1VPTA 3EVFA 4OOIA 3B5IA 4L5JA 4AIJA 3J80K 3CJQA 3LBYA 3NEUA 3MQ2A 4AZVA 1VP9A 1AF7A 4YUWA 5HDNA 3NQOA 2GA9A 5FADA 3LDUA 3L7WA 3WTXC 4FX4A 4P9UA 3LCVB 3ANXA 2OQRA 5IT9K 1XSDA 1SFUA 3T7RA 2QYOA 4U7TB 4BXUA 3SMQA 2YX4A 2EB7A 2C7QA 4M9XA 1SQFA 3G8BA 4RTPA 3J80Z 3JAMK 3FUUA 4DA4A 2O61A 2G7UA 2ONYA 3DULA 4RWZA 1EH6A 2ZNYA 2BE5F 1R58A 3GNLA 1FT9A 4GC5A 1YB2A 4YG2F 2P40A 5ERIA 5IT9Z 4GOLD 1DL5A 3U9GA 5ICCA 3QOXA 2EFQA 5HLHA 1ORHA 4MIKA 1R74A 4BLUA 1KU9A 5E1OA 1UIRA 1X1AA 4RTMA 2IH4A 3RODA 3JAMZ 2CQKA 3DLIA 1VL5A 5LGTA 3L9FA 1W7PD 5FO5A 1NBIA 5DCFA 3OE4A 3DXYA 5DXAA 3GVAA 3RJPA 2M45A 1D2CA 3KPJA 4G7OF 2IA0A 2P8JA 4M71A 4ENJA 3EQLF 1Z1DA 5E1XA 2OAZA 1RNLA 4DCMA 4U7BA 5E17F 4OMYA 1MJ9A 3L2CA 4M74A 5EKXA 2EFJA 5DUIA 4ENMA 2Y1WA 2OYRA 2A6HF 2Y1XA 1RI1A 1HW1A 1YW9A 2F5FA 3VODA 2H6CA 4XUEA 2L02A 1XCJA 2B78A 5D8KB 4WXHA 3LKDA 1IZ1A 5JR3A 1R1VA 2HYGD 3K9TA 2FSWA 1VTNC 3FUXA 1I4WA 1T43A 2PMUA 5J6XA 5E20A 5DUKA 1I1GA 3SR4A 3ZMZA 3H3UA 3ERCA 3NMUF 4PYJA 3NTVA 4X41A 2JHCA 1NW8A 2QQ9A 4U0VA 4M9SA 2AOUB 4QQKA 2MH9A 3TOBA 2ZZMA 5E8GA 2GXBA 4KVZA 2VODA 4KMFA 3B3JA 3EVEA 3CTAA 1KPGA 2J5PA 2LD4A 3KQMA 3LGAA 2WA1A 4A6DA 1NW5A 3UFBA 2KJCA 5CVVA 3SX0A 4ER6A 3F22A 5DD8A 4A2UA 3CVOA 3E6DA 1CF7A 4IPAA 3FF5A 4P7KA 2P6SA 2IH5A 4G6QA 3G7UA 5FLXK 1ZREA 3Q7EA 4LB6B 1OPCA 4YFKF 4ER0A 5LRSA 4BP3A 3HSFA 1J75A 3OU6A 2AR0A 1IN7A 2RN7A 1MDMB 2OQGA 4YIFA 2PQ8A 1RI7A 4FZVA 2A3SA 3SZPA 3LA2A 4LGWA 2O0YA 3RPUA 3TO7A 2WC2A 2G70A 3LDFA 2Z33A 2EV6A 2YVLA 3NDJA 4CKBA 5FWAA 5FULA 4HSGA 1W5TA 3M6VA 2PGXA 3V8VA 1KPIA 3HUGA 4CKCA 5FLXZ 3UJDA 1PRYA 3ZQ7A 5DPMA 2ZWAA 1HW2A 5BW4A 3FM5A 2VDVE 5JHUA 4MQ4A 4V0RA 1RZ4A 3IKTA 1BOOA 4PZJA 3FMRA 1SQGA 5JFRA 3CJTA 2PJDA 1PP8F 3KQOA 3COAC 3OCJA 5D5UB 2STTA 4KYWA 2Q2EA 2NNYA 3BXOA 2EA4A 3DPTA 4PGHA 3C3YA 4C07A 2O05A 1GVJA 3M9AA 4CDGA 2GPYA 4R8RA 5DLYA 2KW5A 5K0GA 1BHJA 1IF1A 1W7PB 1MZBA 3E6CC 1OKRA 4K2EA 3VB2A 2FOKA 3LWFA 4I09A 1K7AA 1R5HA 1V4RA 1P1CA 3LECA 3R60A 3GYHX 4RB3C 2IA1A 1GXPA 2AN5A 4BLWA 4RTRA 4LG0A 4E2YA 1NW6A 2VBWA 1TTYA 2B3TA 2A61A 2KIFA 2Z6QA 2EJTA 1X1DA 1IXCA 3I59A 3HVKA 2FNAA 3JWIA 4Q4ZF 3OFKA 1WXXA 2DQLA 3ZN1A 5K0FA 3BGDA 3M7GA 2DU9A 3UJ9A 3D5LA 3FXQA 4Y15A 2VDWA 5DCMA 3A25A 2NXEA 2PXXA 2G72A 4U88A 3A4TA 3JTHA 2EA2A 2YUIA 4G8XA 5E9WA 1T98A 5DX0A 2H94A 2K86A 2EFOA 3DMGA 2A6EF 3KQVA 1YIOA 3TKYA 4IRHA 4QVGA 5EZQA 2IP2A 5BPIA 4KW7A 4EK9A 5LQAA 2E5WA 3OZTA 2BZGA 3LQQA 1FX7A 1YW8A 2TDXA 3RKYA 2YXEA 2I9KA 1XN7A 3WE3A 3OU2A 4ENKA 3KEOA 4BHPA 1TPYA 2DFIA 1TNTA 1FBUA 3RKWA 2D2WA 1AQJA 3KQTA 3R61A 1H9GA 3KPUA 3B3FA 4IRGA 1G8SA 4HGZA 4KN7X 2FNPA 2L54A 2QQBA 4RAZA 2O06A 2P5VA 2DK5A 2G8NA 5E9QA 4YV1A 2FPOA 4LJZF 3LAPA 3ID6C 3EVBA 4M36A 4HLYA 5K0JA 1PJZA 2M30A 2GB4A 2AVNA 5HZMA 1LJ9A 4K6MA 4BP1A 1JXSA 1O3TA 3BZ6A 5D5XB 4DCGA 1AOYA 1I5ZA 1BOAA 1JHHA 5K1YA 2Y48A 4F86A 4HDUA 2XAQA 1Q1HA 3VEPA 1FSEA 5FA5A 1KQ0A 3VYWA 1SMYF 5CVJA 4HQEA 3I0TA 2JH9A 1XCVA 1TLHB 1B42A 4KDRA 2ZO4A 1SFXA 1SMTA 3WTTC 4FSDA 4M73A 5JVTA 1J0RA 1NHAA 3OU7A 5LQCA 4MHTA 3SSNA 4ATNA 2BV6A 1VBFA 2ZMEA 3FUTA 3F23A 1HNNA 2XHKA 4AVPA 1SUIA 2R7FA 3GIWA 3VSEA 4OA5A 2F8LA 4EGYA 3OOPA 3KQSA 1U78A 2ADMA 3W6KB 1LDDA 2VXZA 1G3YA 2K4JA 4HQMA 4MQ9F 2QQAA 3SVZA 4MEXF 2JH8A 2W85A 4HTFA 1YZHA 4OQEA 1IRGA 3PT9A 3FMQA 3GFMA 2M1BA 2JPCA 4MHGA 2ZFUA 2ACJA 1U5TB 1EIZA 2GZWA 3TO6A 3NJRA 2PI0A 3ISPA 4A5NA 1P4WA 1YS7A 2K02A 4MGRA 3FPJA 2GH1A 4Y2HA 2M87A 3C0KA 1BC8C 3EYYA 2RQPA 4ZZLA 1XGNA 5FCDA 3R9XB 4GEKA 4LLLA 3T8TA 1KIAA 2C7PA 4WWCA 3TRKA 2PLYA 3SFZA 5CD1A 3P2IA 4QQNA 3LCUA 4QVKA 1T6SA 1F38A 5D8LB 2YXDA 3LCCA 3UJ6A 4AZTA 2P35A 2P5LC 1WI9A 5M5BA 1BI3A 1IY9A 2NRAC 3ULQB 3G88A 3BPVA 4PDKA 2VBXA 2C6YA 2O03A 3R6SA 2I62A 4AX8A 2NS0A 3KKZA 3EMBA 2EK5A 5GWXA 3HRTA 3P8ZA 2O6GE 1TNSA 4D0PA 5EEHA 2W24A 1FJXA 4OX9Y 4KFCA 4PYOA 1XB4A 3T7TA 1IN5A 3I4PA 1DPRA 2DPMA 3TOAA 3CGGA 1HBXG 2C7OA 4IXAA 5ILVA 2PBFA 4QTTB 3WTUC 3UWPA 5F64A 3BOQA 4LWPA 1PDNC 1YUBA 1XGOA 3CKKA 4MQVA 3FYDA 3MFKA 3FZVA 4Z2YA 1J9IA 2QRVA 1R23A 2CWWA 2HWKA 4HLXA 3GUDA 3FUWA 2XASA 5LR6A 1N7JA 4PYKA 1D2HA 3E05A 3LPMA 1OMIA 2QBYB 3LA7A 2ZXJA 3D2LA 3O7WA 4CTKA 3EDPA 1XDSA 1XMAA 3FPHA 3R4KA 2STWA 3Q5FA 2P7HA 5EVJA 3WE2A 2FK7A 3F8NA 1TBXA 4P96A 5TRDA 2UZ4A 1DP7P 2ZCWA 3NW9A 2HOEA 4RGXA 1G55A 4XLPF 3T5XA 2IVMA 4CGZA 3WTYC 1WKMA 3V8LA 3C6KA 3E5UA 3TDZC 1YFLA 2EFWA 1ZLJA 5GIPE 2ONZA 4UVAA 2HYFA 1KA8A 4GF5A 1JQ3A 5LBQA 4RX1A 3TKAA 2GXGA 3ME5A 3MHTA 3UJAA 1HQCA 2YQZA 2Z99A 4L0ZB 1N2XA 3FXRA 1L0OC 3P9CA 4KIBA 3TGNA 3BGIA 2NNNA 1NBHA 1S29A 4P7GA 1FWZA 1MD0A 1WWXA 4EJVA 2XBMA 2L4AA 5BS6A 3NDIA 4PYMA 3SM3A 1MJBA 2CFXA 3CUQC 1RI2A 2G1PA 2VDUE 3A7DA 2RNJA 2PXCA 5D4RA 3RIEA 2IFTA 3MCTA 4I7HA 2WA2A 1JGSA 3PFGA 1O3RA 5L3DA 1H1DA 2N47A 4PYLA 5T64A 2EV5A 1FYKA 4GCVA 3KLOA 4R8SA 3UJBA 2K27A 4UUVA 2BBYA 5LEJA 1P39A 4GUAA 4WXDA 4RVHA 4OMZA 2EG5A 3DV8A 2HTJA 4PYIA 3QOPA 4HH4A 4XSXF 1AQIA 1ZGJA 1J5YA 3T0IA 3E6MA 3MB5A 4N9HA 1K79A 2OU2A 5JUWA 2IDKA 1AV6A 5FD6A 1G3WA 1LNWA 5D6FA 3FUVA 1M6EX 2PWYA 3G3ZA 3B02A 4BHCA 5GIOE 3EYIA 5DX1A 3M6UA 1PUEE 2PWPA 1R8XA 2V74B 2A68F 4E31A 4ISCA 4OINF 2ZSUA 3KR9A 5IH3A 1ZRFA 1L3BA 2BR3A 3ECOA 4PYQA 5FHQA 1O7LA 1S6LA 1R18A 1QANA 3ZMUA 4UXNA 3E5QA 2JSCA 4KN4X 3E3VA 3HRUA 4UV8A 1Y8CA 5LGNA 2EX4A 5KS2A 5CCXA 3ER9A 3P9IA 3PTAA 3K1PA 5LQNA 4HX7A 1GHCA 3HA7A 4AZWA 3GRVA 1VLMA 1YFJA 3WG9A 2I6GA 5KVRA 4X1OA 3LFKA 5DM1A 2ZTHA 4G7ZF 4YUYA 1USTA 4Q5SF 3EGVA 3HTSB 1RJFA 4RGRA 2FMYA 1SG9A 4M9ZA 2PVCA 5HVQC 4XBFA 2O57A 3WTVC 1L3CA 1P1BA 3KR2A 3GU3A 3U1DA 1DUXC 1QNTA 4I02A 2AN4A 1EQAA 3BDDA 3BJAA 4ZZDA 2P8TA 4CXFA 3HM2A 1F9NA 1EH8A 4LG1A 3I54A 4EKIA 5LLQA 2B0LA 4YFXF 1KP9A 3TFWA 2ZIEA 1KQ9A 1QZYA 2F5DA 3BROA 2QENA 3I64A 1O3SA 2Q41A 4IF4A 1I9GA 3EVAA 4IKPA 4L9NA 1B6AA 2ESHA 2Y75A 4BH9A 4KIFA 2PX5A 2X4HA 4CKEA 2GQQA 4EM2A 1RJDA 1IM8A 2ETHA 1RI3A 3H3ZA 4ZYHA 5E8JA 1X3UA 3GCZA 5HFJA 1I1NA 5CVUA 4I98B 3GRYA 3IV6A 3HTXA 3HCDA 4OU0A 1ZKDA 2PKWA 5LQJA 1YF3A 3DFGA 4GXOA 1OR8A 2NNWB 3GRZA 3R0AA 5F6FA 3V97A 3K69A 4L5IA 2PV0A 4EM1A 3GW2A 4NQWA 1UFMA 3VC1A 4CICA 5FFXA 3EGIA 2M5WA 3MAGA 1E17A 3EEYA 3L8DA 3E23A 2FE3A 1R7JA 4HRAA 2OZ6A 4AIHA 5FUBA 5K5OA 1JSXA 2UZKA 3V4GA 1YG2A 1GXQA 5DSXA 3WGGA 2YU3A 4M38A 1S3JA 4EJOA 4DMGA 3BWBA 4HGYA 3KP4A 1HW5A 3AXTA 3UA3A 2COMA 5DTMA 2KIUA 2FBHA 4G9YA 1NV9A 4P7FA 2CG4A 1SKMA 1JE8A 2O07A 4PINA 4DM3A 4HG2A 4C4AA 3OFJA 5DRYA 1ON2A 1OR7A 4EQQA 3SGLA 1STZA 5K01A 4C06A 5K0CA 2QY6A 4IHTA 4BYYA 4JQFA 1WSUA 2M8EA 2IA2A 1FLIA 2BM9A 2ZBPA 4YV0A 3K1MA 2FRXA 4AZSA 2VOPA 1ZHFA 2BEOA 1BI0A 3GZ5A 1U8RA 3KP7A 4YMGA 1XDUA 3HCCA 3ZMVA 3SQNA 4NHJA 4JK1X 2OB2A 3B7PA 2PX2A 4I0AA 3ABUA 4FHTA 2JPBA 3IWZA 2H27A 2FHPA 1O9GA 1JG4A 4Q47A 3LKZA 4YUZA 2PXAA 3HIFA 1R1UA 4RVGA 3QP5A 3F8MA 4RVDA 2RKHA 1YYVA 3DOUA 4ER3A 3FYCA 4UV9A 5H6QA 2XAGA 1J59A 1FBNA 4P5OA 2VONA 1KYWA 3F8FA 5F2OA 1H9TA 2HMYB 4IHSA 2ZWVA 3E5XA 3WTZA 1NT2A 3WGHA 2IGTA 1FY7A 3DMHA 1O57A 2GIVA 1QQIA 1IXKA 5AIPA 3HVJA 1ODDA 3GZ6A 3GFLA 2QM3A 3IRRA 3I53A 3BWMA 4B09A 3P9KA 4QPNA 2PX8A 3CO6C 3GX4X 1U2ZA 2FK8A 1TW2A 4RB0A 2JTVA 3GXOA 2ZBQA 3P2KA 3BUSA 4DZRA 2PX4A 1C0WA 4GOND 1KHHA 1UCRA 2PY6A 4RVFA 2FMLA 3TLJA 3TQNA 1LQ1A 4QTUB 2DPUA 5LSAA 3TOSA 5CVEA 5E1DA 4MTEA 1OYYA 2W25A 3O2PE 3FTFA 1Q0TA 2BYVE 4HYEA 5EZSA 2XAHA 2RV8A 3E97A 3HVIA 3EPPA 2GWRA 4BQAA 1Z91A 4U0WA 2RDPA 2IRFG 1VE3A 3G73A 3MAJA 3G2OA 4GOMD 3DP7A 4HF2A 1X19A 4P7JA 3CJNA 3RW9A 1HKTA 1K78A 2OO3A 3P97A 5HOQA 2JHPA 5K5QA 5E2BA 4UHTA 3DTNA 3F8CA 3TDUC 2PN6A 1K6OA 3EVGA 3EVCA 1QAMA 3F8BA 1IXRC 1SD6A 5EHIA 1UHMA 1BM9A 4QPPA 5ICEA 3KQWA 2FU4A 2AOWA 5MHTA 2OBFA 2PG4A 2WTEA 2YTZA 2YXLA 2HR3A 5DWQA 1ZQ9A 3IYLW 3FTEA 5JI6A 1O3QA 3P9NA 5BP7A 5DEQA 1G3SA 1ZG3A 3J7AO 2VC0A 2A07F 1XTPA 2EFNA 4ESFA 2IBSA 5HIIA 4MTDA 3C1DA 4A0XA 5E8RA 2AOXA 10MHA 4WVLA 4MWZA 3DLCA 4Y13A 2UYQA 3M6WA 3WODF 2HTEA 2P5KA 3Q87B 5BMZA 3KPYA 4RB1A 3M8FA 3MTEA 4E32A 2F5CA 3DQVC 3K2ZA 3F21A 3DXZA 2KJBA 3O3KA 3F72A 1NW7A 1I6XA 2ZFWA 2XRNA 2R6ZA 2H09A 4NB5A 4RTJA 1SD5A 3KEQA 1EH7A 3VOEA 2IH2A 5GOZA 2MLKA 3BGVA 4G56A 1ZLKA 5E1BA 3JTGA 2HQRA 1ORIA 3FTCA 3QP6A 2OPBA 3LX6A 3ELYA 4MEYF 2VBZA 5LGUA 4ZYEA 3ZMTA 4HAMA 3GO5A 5T67A 4H0NA 3T8RA 1HSTA 1ONVA 5E1WA 4EJUA 1FOKA 2XUBA 2BM8A 1R5GA 5HDKA 2R3SA 3LL7A 3R0QA 5EMJA 3G5LA 3MERA 4ER5A 3ZP5A 4KDCA 3T7SA 1Z6RA 3AXSA 3BJOA 5D1HA 2V6CA 3EVZA 3KP5A 4O5VA 4CO8A 1T39A 3FXUA 3H2BA 1SUSA 2DBBA 2E1NA 4A12A 2ZJ2A 1D2GA 1U2WA 1MHTA 2L01A 2ORED 4L7VA 2P7IA 1Y0UA 2P6TA 1P91A 2IPXA 5ED4A 4OA8A 5AONA 4P55A 3HCAA 4G7HF 3BKWA 1SAXA 3OZRA 4RAYA 2O0LA 2Z3YA 4CWAA 4YUXA 3PFHA 1UHWA 1CF7B 4YV2A 2QLZA 3HCBA 4RTOA 4UVBA 5DDGA 2MD5A 3QU6A 3C7JA 4TV7A 1NV8A 1OYWA 2EWNA 2YPRA 2DLLA 3SHFA 5L3FA 4IV8A 1KPHA 3CBGA 3ELUA 1VP3A 4OQDA 3MWMA 3EMDA 1S8NA 3CUQA 2RC4A 4LK0F 4LK1F 5IKMA 2HKXA 4C04A 2ZCJA 3UBTA 1P92A 5C0OE 2H1RA 4RTQA 3WU0A 1U6GA 4M6XA 4CTJA 1Z7UA 4FT8A 5LRRA 2B2CA 2HNKA 4HDVA 4QDJA 4QLCU 5DRTA 2CYYA 2EJUA 1REPC 3F6VA 4S05A 3DKWA 2VT2A 1BN5A 3HA5A 1I27A 2FXAA 1YTYA 3PB3A 4KIGA 4HW0A 4ER7A 4CYDA 2Q0OA 5D6EA 3FPFA 3FZGA 5B1SA 1QYRA 2AOUA 5LEKA 4ZH4F 5IT3A 3QV2A 4IV0A 4RYLA 3LAJA 1JG1A 3ELWA 3N4MA 4O6JA 2AXLA 2K4MA 2ZBKA 3A27A 1CGPA 4FP9A 2V79A 1RI4A 2G71A 4LECA 4B8XA 1IN4A 4KMUX 5J8CA 1JTEA 1RJGA 4LG0B 5LQRA 1B1BA 3GJYA 2R7DA 1JQDA 3PVCA 3CO7C 3N97A 4YMHA 4PIPA 2QUFA 2P3QA 3KQQA 2P41A 3M6XA 2FF4A 2P7VB 3I59B 3RDIA 1NW3A 1KU2A 4E2XA 3HSEA 4IJAA 5HIJA 2NP7A 5KVAA 3UZUA 1YQAA 4P9FA 2QZ8A 1MDMA 4BLVA 4WX9A 5DCMB 5H02A 2A5YB 3RI4A 2XVMA 1R8YA 3RIRA 3J81K 3SZTA 3NVMB 3I58A 1QAQA 3TO9A 5GINE 1OYIA 4RGSA 4XUDA 1B9NA 2DW4A 1J2XA 3IHTA 5EQJB 3C3WA 3GDHA 1P6RA 1WQ2A 2NXJA 5C9ZA 1NKVA 1FYLA 2JG3A 4RTLA 1LEBA 5EEGA 1HMYA 4BAYA 2ZULA 3MGGA 3J81Z 3BWYA 5EHGA 3GWZA 2FA5A 3DPLC 3KR1A 5E8IA 5ERGB 5ICFA 3I71A 3MZYA 4L9VA 3JWGA 2JHAA 3KCCA 4JBAA 1PP7U 1W7PA 3GFJA 2NYUA 1TQIA 3DH0A 4OBXA 2DTRA 3EUHA 2NAZA 3PQJA 5FB2A 3TM4A 3CUOA 4LWOA 1RI5A 3UJ8A 4C08A 2HQNA 5CYVA 4HF1A 4HV5A 1VQ1A 2NYXA 3O31A 3FX3A 1JR4A 4LMYA 3PX2A 2GS9A 3KP3A 2FRHA 4OBWA 1YS6A 1RUNA 3KU1A 2PFBA 3AAFA 5BW5A 3FPGA 5AIQA 1ZG1A 2C7RA 1MJAA 1G38A 2VP3A 4E2ZA 3OE5A 4M6YA 1S7OA 2ZIGA 4X63A 4L18B 2AS0A 1XDZA 5TJJA 7MHTA 2O8XA 1IXSB 3IWFA 2P1DA 2H6BA 4M72A 5L3BA 1DPUA 2V1DA 2ZZNA 4ASNA 3CCFA 1B9MA 2CMHA 2P3LA 1MKMA 2PEXA 2WWYA 2DULA 1W5SA 2ELHA 2ZMEB 3E8SA 4M7RA 3GO4A 1TW3A 4JXJA 5GP1A 1XCLA 3BJ6A 3UJCA 1P2FA 2P4WA 8MHTA 2XKOA 2PLWA 4M37A 1FZPB 4F85A 3F6OA 5FGMA 2FBKA 1JTFA 3EEOA 3LHDA 2IJLA 5ILUA 1MJFA 1IUYA 1W4MA 3HRMA 4HTFB 1T2KA 1RIOH 3DR5A 2F2EA 4RTKA 3LSTA 4GYGA 3T1BA 2NXNA 3HCFA 1D8JA 1KQ8A 2CO5A 5CJ9A 1R00A 3NVKI 4HZFA 3G2QA 3F3XA 3KP2A 5H6RA 3MQ0A 2ESNA 2FEZA 4ESBA 3QRFF 2V1UA 3PS9A 1QZZA 3QPTA 4AIKA 2OY0A 3IL2A 2PT6A 5EMLA 2CL5A 1XMKA 3IHUA 9MHTA 2OKCA 1P4AA 2YR0A 1XSXA 3I9FA 1G4DA 2G7HA 4R05A 2Y0MA 4E30A 2BH2A 5K05A 1FBSA 3JWJA
chains in the Genus database with same CATH superfamily
2WW8A 3WYAA 4AT1A 5ALVA 3CCUI 4WEOA 3AQIA 2OF7A 1XC5A 2Q27A 1IBSA 2FV8A 4GHWA 1MV8A 1OF1A 1MA0A 1FIAA 2BFDA 2HV9A 1AQUA 2X7XA 4QSHA 2X6YA 1FXSA 1YE5A 3QOWA 1T56A 1LDJA 3S2YA 3HJCA 5FFMA 2DMUA 4DLKA 1SB8A 2FFBA 1Q50A 2GEFA 3CXRA 4QEZA 4OKSA 1FP2A 4ZCIA 1YDHA 2E7WA 4YP1A 4LCJA 1EAMA 3IOCA 2C4HA 4N5IX 4JAVC 4QDKA 3QEOA 4N47A 4IHAA 3MJ4A 5HSGA 2QZ9A 5AKIA 2C2WA 4ZQEA 3WWYA 3TEMA 3AVPA 3TSWA 1MNDA 2GZDA 5A02A 2D5IA 3C3JA 3C5WP 1AKHA 4Y6RA 5ESWA 4JSTA 3RASA 2ZR0A 5JZMA 3TAUA 1JLHA 2NVOA 4NAUA 4M4SA 4ARVA 2EFHB 3EDCA 2FPSA 5DM2A 4K86A 4D8WA 2Z1MA 1GHTA 5J8FA 3R9WA 2DO7A 1A1VA 5LZ4A 3A6ZA 2NVUB 2IHVA 3RUAA 3PD7A 5LHHA 5ARDA 3VQTA 4XWTA 2H4XA 2EBWA 2R2AA 2IELA 1PHRA 5TRTA 4RTSA 1BA2A 2W9XA 3AU9A 1YA8A 2GBYA 3P7NA 4DYCA 2VDQB 2J5XA 1WV1A 2RCNA 4KXVA 2YX7A 1BR4A 5ICGA 1JQ5A 4IUDS 3A3KA 3O94A 1GNTA 1U5TC 3M70A 1MRZA 2KFDA 5I5GA 4YJDA 3WYEA 1SFEA 3GCWA 1SD7A 3PLAE 1K7YA 3H1PA 1JR6A 4EMTA 3OZDA 3H16A 5DTQA 1J00A 3T06B 4BV3A 1SC3A 4E5KA 3O8OA 4EVIA 5K3FB 2RGVA 1IJFA 1YE3A 2J9ZB 1VLLA 2QLNA 3DC7A 2V0NA 5U4XA 1WA5A 5CDHA 4QTXA 2HREA 3N58A 2WF5A 4AWXB 2HD4A 3GJ3A 2N8GA 4G4SO 3O4FA 2Z2IA 3EISA 2ELKA 5D3KA 3UAOA 3K0AA 3PENA 4KQFA 4P82A 2C57A 1T2EA 6GPBA 5JT1A 3HJEA 1CE8A 5DNWA 3IAM1 1PEAA 1O95C 2M6LA 3PTLA 3WSTA 2AXQA 2PZAA 3KPWA 4LDPA 2QD2A 1WP4A 1YX3A 5FFZA 4IICA 4YP5A 1XLVA 1JT9A 2GPWA 2VE9A 2C94A 4LE2A 3RKXA 4J01A 3RTCA 4KMRA 1SC6A 3USES 1GFWA 3Q1KA 4GYYA 1RXUA 3RTAA 1GT91 3WB9A 5ES4B 3A4VA 3EEQA 1AK2A 3ABLH 2H9AA 2WFLB 4PCUA 4HUQA 4O29A 1KH3A 4XLNF 2Z6UA 1RPWA 2GRUA 3PKZA 4N4AA 2HDCA 4AG6A 3TNLA 3ICOA 3BXZA 5AQEA 1WMFA 4QXOA 1B4DA 1HI9A 1NUTA 1SH7A 1ADYA 1BWQA 1G6NA 4G9BA 4BC0A 1EXDA 4WY8A 1TM4E 4Z9AA 3MTIA 2LWIA 3OQMA 2YMQA 1Y48E 1SWVA 4JVSB 3C3PA 1FYWA 4HMOA 1Y5NA 1EGAA 5I7RA 4X5OA 3G5MA 2ZBRA 1W73A 4IGFA 4LHYA 4TMTA 2QQGA 4BO6A 3KLNA 1UBNA 4BX8A 4DQVA 5K2MA 1P75A 3RVBA 3IDOA 2LUOA 2Q7OE 1P0QA 1VKOA 2J0VA 1XQ6A 5BYBA 3VC2A 3GGSA 1PTJA 3TRDA 5HLIA 2HT1A 4POOA 2IT0A 2P62A 3O2QB 5F5XA 1UBRS 1L4KA 3WGVA 3AY0A 2BCJQ 1HG0A 5EWJB 1QHHB 2QRMA 4KH1A 1CY2A 5FL7D 1KU0A 4RS8A 4LFUA 5E38A 1XEWX 4TKVA 2F3TA 3E9ZA 3HBJA 3SNHA 2WYIA 3MKYB 1K7SN 2LK2A 4F9EA 4CCYA 4R1LA 2YNMD 1ZQ3P 3LCJA 4M7WA 3VR6A 5J2UA 1K78B 3DCJA 4YJ2B 1KXJA 1E2XA 4AICA 5DYIA 5GONB 5KVCA 1Q57A 3PHJA 1R12A 4PZZA 2AOVA 2Z5UA 4UBOA 4B45A 4BY9E 1GGMA 3LWNA 5E3LA 4K9QA 3PC4A 1U04A 4JEUA 3HSRA 3NDPA 1L5NA 2ZNZA 3TLAA 2BFFB 1NNI1 1FTNA 4A0ZA 1NLMA 5HVNA 5F5NA 4OLFA 2MA3A 4TWAA 3E0JB 1Z0DA 4EQZA 5KYKA 5B66C 1I1SA 1UPCA 3U40A 5JYBA 1LFAA 3CUSA 1K4KA 3J80K 1H2EA 1P2DA 4OIFA 3UJNA 1V25A 3RVKA 3DFFA 2W6QA 1UOOA 3KZCA 3WLMA 3AHJA 3TLCA 4A8PA 3BE4A 2OLKA 3CSSA 2G9VA 3VR6D 4ND4A 3KT3A 1N2EA 3RGGA 2ZNYA 4IIUA 1NLFA 1EESA 5KDOA 1FT9A 2HXOA 1H1LB 2ZJ5A 4H3SA 4BFCA 2WJ4A 5ALUA 1YO6A 2GHIA 4TVBA 4QTZA 5LZ5A 1Y63A 1E64A 5G2OA 3ZD9A 2IYWA 4H1UA 2IA0A 2D00A 4W5JA 1GQYA 1YQEA 3G1WA 1TM5E 4A82A 4JLAA 1UF9A 3T9CA 1J07A 5IUJC 1CC1S 2E1OA 4MUNA 3NLLA 4TTRA 3NHKA 5DLPA 2PHZA 4B0PA 4KPUA 2HV8A 2IGBA 3JAKA 5SYNA 1D03A 4J0IA 2J6HA 3B60A 1YB4A 1K97A 4KQMA 4AJIA 3W90A 1J1IA 4MYRA 2VODA 3RKQA 1EJ2A 3LX8A 3CTAA 2E1MC 4O5AA 4TT8A 3OYDA 2HNAA 2F64A 2CXNA 4ER6A 4QNMA 1ZJWA 1J0BA 4ARZB 3BXHA 1B0PA 2Q2NA 4AN4A 3OX4A 1I4LD 3SMVA 4YJ3B 3HBNA 5FNVA 1J75A 4OM7A 1RI7A 4WBNA 2J3LA 2J3KA 1KFEB 4QEDA 1XO1A 1QOPB 1UH5A 4X3OA 3Q0TA 3WYBA 4GX5A 2Q1XA 4HSGA 2PGXA 5DTIA 4KLRA 3QKWA 1HA3A 2FOLA 3NHLA 1A5AB 1XS9A 1RRPA 5MF6A 4AQYB 3CJTA 1W19A 3FYTA 3HSKA 1Y1TA 2XCLA 5BR4A 2VTEA 3QMWA 1EUCA 2LBFB 2OCBA 4D56A 2VPTA 3G79A 3LWZA 1OKRA 1EWKA 3UMYA 4EHLA 2AN5A 5FJIA 4LG0A 4E2YA 4YJGA 1K83J 4Z9YA 3S2UA 1FJLA 4M0EA 4PCVA 2XECA 4G8CA 2GTPA 2X5JO 2AXPA 2NV6A 1YE8A 1TA9A 2NXEA 2PXXA 2ZVQX 3TW0A 1G6OA 1UBUS 3EZ7A 5TISC 4BDZA 2A58A 5C4MA 3O8QA 2L17A 4KODA 4G8XA 5T4HA 1IULA 5D8DA 3G0OA 1ULTA 3GG9A 5LQAA 5KBYA 4M46A 1OGJA 2JFBA 2JGRA 5B7QA 2CE7A 2Y9YA 2E82A 2O8EA 3LVBA 2ZBDA 2XTJA 2CL0X 2W22A 4M21A 2J32A 1FFYA 1DBSA 5E9QA 5D2CA 4MIEA 1HDIA 1QWSA 1SHUX 1JAZA 3WK9A 2DQSA 3U4IA 4ZVVA 1EBFA 2YQ5A 1PZGA 1JHHA 3RG2A 4OJQA 2XAQA 4X44A 3VEPA 2PUJA 1SMYF 3JXEA 2ZIWB 1XCVA 2ZWPA 1TLTA 4KDRA 1YGPA 3FPLA 1FDOA 2HWYA 2GNOA 5JVTA 5IEJA 2XUQA 3SSNA 3W0LB 3FUTA 3STUA 1UINA 4OA5A 5CLFA 3HXPA 1YRYE 2P6NA 1ZVVA 3T7EA 1E1QA 3UV3A 3KTDA 4J7AA 3DZ8A 1FBTA 3M5WA 2JH8A 4QGHA 1ULSA 3FMQA 2OTCA 1QHIA 4L8FA 2NUTB 4J16A 3OPYI 1TUIA 2K02A 4H7JA 3Q3EA 1XGNA 3DONA 5TQ0B 3SZLA 4U3JA 3WHKA 2BGIA 4Q82A 3OSFA 5JD4A 1U5BB 4IAOA 2EQRA 3CFYA 1U1GA 5EGNA 3C8DA 1V8FA 2JWTA 5ILOA 4QBTA 4QDUA 2PH5A 4FKZA 2XZOA 4PDKA 4AX8A 3NX4A 5LOVB 2EK5A 3HRTA 5EEHA 4KFCA 2VEDA 2QM8A 2UUCB 1X7ZA 2YYZA 4XLFA 3QPWA 5IARA 1E1QD 3FZVA 4X65B 1KYQA 4L0MA 1N7JA 2ZXJA 3O7WA 4F2PA 2IYEA 2KSQA 2QZSA 5CLIA 3GZNB 3Q5FA 1OAAA 5K8CA 4ZK2A 1FFXB 4A73A 1BYIA 2IUSA 3UG7A 3C6KA 1YFLA 2A78A 4TXHA 5JY1A 4BWYA 4GPBA 1WDMA 4TL7A 3IBFA 4ZI5A 3EXG2 2QL9A 1PJQA 3IXLA 1WJDA 1RD4A 3U7QB 3BGIA 4A8JC 1OHHD 2Q28A 4IL6C 1UK6A 1X1EA 2B9VA 3PRYA 3LOPA 4Q3BA 5JJKA 4HBGA 1ZC3A 2IFTA 3O90A 1XB2A 1CQIA 4I7HA 2WA2A 2NO9A 4ZV7A 2IIBA 5KYYA 3DD5A 3HUTA 4EGSA 4ZRDA 3NHWA 3PM1A 3DV8A 1ETQA 2E5ZA 4LYGA 3GEEA 5D7BA 1LNWA 5K0SA 3LFTA 3G3ZA 4DLAA 2BMAA 5GIOE 4NY1A 4WLEA 1PUEE 2BR3A 1W0TA 1YT5A 4PYQA 4DQKA 1BU8A 5FLKA 3DBHA 4BP9A 1D6JA 4ZZ2A 3HA7A 5D6OA 2DFVA 2JFYA 4XJVA 3WG9A 1X80B 3ZWWA 1USTA 1CEEA 1SG9A 1DKUA 1MHPA 5HVQC 3ESRA 2ACVA 4JWKA 1J24A 4MYSA 5BURA 3M07A 2JGAA 5G0SA 4IDQA 1PKEA 1TL7C 2XDVA 3LYAA 3O3OB 1PZNA 4YTEA 5AI5A 5FV4A 3OEED 1H0SA 2WHXA 5A05A 1W4ZA 1EK6A 4KI0A 1P2SA 3BG6A 3S2IA 2HYJA 1GVHA 1IMJA 1QDUA 5CVUA 2QIPA 5HZGA 1XA3A 3GAMA 3PGLA 3U7FB 3HDGA 4IIXA 2X23A 4L5IA 1DINA 1SCUB 3VC1A 1MPXA 1TWAJ 4J43A 4GWKA 3WGJA 1ZAYA 3LOCA 5FWXA 2C78A 2GXSA 4RDCA 4U2BA 1JEJA 1UBLS 4AIHA 5EGOA 2W2VA 4FMPA 4KZPA 2DY1A 5DSXA 2PS9A 3S8PA 4Q7JB 2XMGA 3ANTA 1YDMA 4UM8B 1LRLA 4FFOA 5EJ7A 5HK8A 1Y9EA 3TBFA 4DXAA 5IJ9B 3CH6A 1QE3A 5CTJA 1ON2A 3SGLA 3MGKA 1EX7A 3K9QO 3DLHA 1ULUA 3PO2J 2A0WA 4BKQA 4JK1X 4I1SA 5BMVB 1RCFA 2WICA 1LBIA 1R0RE 4PUSA 2HOTA 2CN1A 5F4BA 4EDFA 2IZ7A 3PUHA 1JG4A 4UPEA 4NU0A 3TGWA 1PJLA 2R4GA 3JRBA 4OQ4A 1FS4A 1J5PA 4IDOA 1BVYF 2YZ7A 2FP3A 1BRTA 5F2OA 1PJTA 5LMCA 2HWXA 1CDEA 3I42A 1F4LA 1LEHA 3O6VA 1MENA 1QVZA 1KYYA 4GVPA 3EN0A 3C48A 1XKLA 1Y9ZA 4RLSA 4I19A 4OHKA 1C0WA 4KVAA 3AL3A 1KNQA 3ANLA 3CISA 3X1MA 2MINA 2ATVA 3F6PA 1Y4SA 1W96A 2HHLA 3LVFO 1P7WA 2H8GA 1EFKA 5IF3A 3EPPA 16PKA 2WVJA 2KJQA 4ZYLA 1KDPA 2H1VA 5T8KA 3W79A 4Z8XA 4AJHA 3R5XA 5EERA 2GZRA 3R7NA 4OVKA 1SD6A 1UHMA 2AO9A 1V5WA 2IPLA 3M1IA 2OWDA 2JVHA 3OIDA 3D6HA 3FOWA 4C6TB 3QUAA 4EA9A 2ZE6A 4BCCA 4LA4A 2QR2A 3TL6A 3ZR4B 1O89A 3DQVC 3K2ZA 3ORYA 3O3KA 1NW7A 1QZTA 1E9AA 1MP0A 4PLVA 2QY9A 4MSUA 4P35A 5HNHA 2MLKA 3KJZA 3ZS8A 2HQRA 1O8BA 4GWGA 2VP9A 1MNEA 2IIQA 2GCGA 4CH7A 1G42A 2Q46A 1DOHA 1D4AA 3WX0A 2C00A 1LBTA 4ZRNA 5T67A 5CGQB 5CB4B 2EPFA 3EAFA 3EH1A 3VU9A 2X4GA 4FWBA 1V6AA 2X13A 3SIPA 5IJZA 4XFDA 3ZP5A 3EXIB 3IQDB 3TK1A 1OY1A 3GUUA 4WY5A 1IL0A 1XTAA 4EW2A 4HVTA 4H17A 1U8YA 5DHUA 5AK4A 2CDRA 2RHRA 4OCZA 1DBQA 1E2QA 1X6VA 3QOYA 2A3RA 3P2OA 2RHGB 4BWGA 4CWAA 4YUXA 4GM0A 4YV2A 4OYRA 1CUFA 4N6OA 5A4MS 3AHEA 2Z5LA 2DCMA 1DFGA 2C2HA 1MX5A 5C7LO 1J8DA 4W5WA 4ZVKA 2EZKA 3F9KA 3DE0X 5BSFA 3ZHTA 5D5PA 1Y1KE 5LXTB 2HVQA 1QK5A 3ISVA 3LUPA 3GJXC 1QJCA 3VYUB 2Q0SA 4QLCU 1G4AE 5I4CA 2VT2A 3BD8A 1I27A 4OXKA 3RI3A 3IURA 1QRSA 3S5JA 3OH8A 2BISA 3ZCPA 5LEKA 5IT3A 1T0PA 13PKA 4O6JA 2IZOA 1EUZA 3H3FA 3KB8A 4TXJA 3IPCA 1Z6QA 1JTEA 4CR6A 1RACA 2COBA 3C2BA 3PNSA 4CHGA 4X85A 2WINI 5JW6A 2FF4A 4RF5A 2XB9A 3ZWDA 5F1OA 2W70A 4DIUA 4IJAA 2PZJA 4TYWA 2QZ8A 2JMWA 3PFFA 4IVRA 1ANKA 2E2HJ 1IUKA 4BX2A 5EZYB 1RZUA 4OQMA 4XUDA 1B9NA 1B23P 2G7MC 2H54A 3GUYA 5T5QA 4XORA 4DDUA 4O3FA 3RF7A 3KSAC 1D2NA 3OS0A 3UPDA 3IMEA 4W63A 2NOGA 4YPOA 4D3FA 5KTNA 4MYHA 4DC9A 4N7JA 1XA0A 1GV2A 5COQA 5ICFA 3NT5A 3S3MA 2UZIR 5JYEA 4IVPA 1TI7A 2C88A 3I9V1 3DH0A 2I54A 3UJ8A 2H18A 1NWCA 1WKBA 3FX3A 1LB1B 2ZM6B 4V1CB 3KYJB 2FRHA 1EBBA 5MN4A 3AAFA 1KI4A 4ZJPA 3NC0C 2C7RA 5E3MA 5JVDA 2XOEA 1S7OA 3ABOB 2AS0A 3MTQA 5TJJA 4BU0A 2A59A 1DXHA 3M2TA 3QU4A 5GAGJ 4CMCA 2F3UA 2ZMEB 1QORA 5BSUA 1QQ6A 3LWDA 1C2YA 2HDHA 4EFDA 3Q2KA 4AJ4A 1W4MA 2FN8A 3SHTA 3LKVA 2WBMA 1E9RA 4OH7A 1GSIA 3LBNA 2HZ7A 3OUZA 3KP2A 3NTXA 4LTMA 1P4GA 3CCQI 3CCYA 1J90A 1HH4A 4EF6A 3IHUA 4FE4A 2G7HA 3T0GA 2Y0MA 5EIBC 1LWNA 5K8LA 4R8LA 3GFQA 3CX8A 4RK0A 1Z4MA 1BBYA 4RTNA 3I5UA 3EPHA 4NC8A 3AF4A 1MBFA 1RLOA 2QU8A 4FDTA 1U9ZA 5BOXA 2C5FA 4P93A 2Q5HA 3H83A 4QJ5A 2AWOA 3AR2A 2EWWA 4LVOA 2Y2VA 3CUQB 4IX7A 3OIPA 4QUGA 1Z22A 4LY9A 3FK6A 4AUMA 2WU1A 1QH1A 4WF2A 4LBVA 3DLAA 3HI4A 1G6Q1 3CEJA 3L09A 1ZH6A 4BO0A 2JD0A 4FMDB 1YXMA 4X93A 1RM0A 3KZNA 5EE9A 2JFZA 4RB2C 3NCHA 1WPGA 1D8KA 5C44J 5LA6B 4HAZA 1RQRA 4RY9A 3NWEA 4GDMA 3OETA 4UNOA 1MC5A 2VDMB 3BRQA 3GUZA 3JVUA 3H9QA 4KQWA 1K6MA 1PAUA 4DM4A 4B83A 2V1XA 2XWJI 1JPVA 2M0CA 3GRRA 3ROXA 3VX3A 1WXFA 1OBVA 1ZD4A 4V2UA 3QVGA 2GOXB 1ZY2A 3B9RA 4QRIA 3QVUA 4YROA 2XUDA 5F52A 3GJZA 1B8OA 1UC8A 2Z9OA 3HCEA 5FD5A 5AHXA 4JHLA 1W4BA 4TS4A 3KO8A 1DWQA 4QPZA 4EJWA 3M5DA 2YWJA 4HPWA 3Q6NA 4KRGA 2A1TS 1W1UA 3L79A 2W6JA 3CWCA 2EP7A 2LKCA 5CDGA 3T6KA 1ZM3A 1KY3A 2PJPA 3VPDA 1T08B 3JWEA 4CM5A 4MRMB 2WG0A 4QUKA 2IEYA 3I6YA 2L42A 1GYPA 3C3EA 1IRFA 3AVXA 4I6JA 4OIPF 2FY8A 3OZCA 3N6XA 3ZWXA 1YKFA 3PEEA 4X7BA 4QXQA 2GM9A 5HW0A 5JOQA 1TF5A 5AKKA 3DCIA 2D5BA 1ML3A 4BS9A 5LVAA 1YNOA 3ZEAA 1CK4A 1A6QA 1PT7A 3RTRA 2PFKA 5AXCA 5KYWA 2JK3A 2PM8A 1NUQA 4B74A 4ZPJA 1SHKA 3BC1A 4MV9A 1N2SA 1M0EA 3B3GA 1WO8A 2PS1A 1SC1A 2CYBA 1O97C 1VSVA 1VCOA 4XRSA 3PUBA 1IZ8A 3WYFA 1M8KA 2OB1A 1SOMA 1Z5NA 3E7PA 1NVFA 1U81A 4CU2A 1LE8A 3GCGA 1JKMA 4WE3A 3VA7A 1WVGA 2M34A 2HY7A 4LWQA 4A27A 4NFLA 5I45A 2ST1A 1G3QA 5DOVA 3OYJA 2D74A 4OK3A 1JMVA 4EGZA 3C4JA 1V47A 2OXEA 1J9EA 3FTDA 5CX1A 1UL1X 721PA 3TECE 4FR0A 4A2PA 2W37A 2GLUA 3C7CB 4BB6A 2XVAA 4ARIA 1O54A 2NWQA 5A4DA 4CU5A 4MUGA 1I32A 1FPQA 5SYMA 1TWFJ 1SVIA 1TZJA 1P9OA 1S1CA 3M3HA 4PWYA 1KDTA 4UUSB 4OAYA 2GYVA 1WMSA 5MGNA 3SYRA 4YASA 3GRPA 1G5PA 4GQBA 1I3OA 3EVTA 2XV4S 4R9UC 1DC5A 2AN3A 3OE1A 4LVCA 2D45A 1TVKB 4C0WA 2R8YA 1KYZA 5IT9A 3BMOB 1IV8A 3V46A 4QA9A 5JSYA 4EJ6A 3Q98A 3F7MA 3GFTA 1YW7A 1XYGA 1F4KA 2PR7A 2DR2A 3WRYA 4D02A 1ULYA 1VOTA 4H0CA 1UBGA 1BJKA 4LDJA 1NTCA 5KYUA 4PSAA 3OR1C 1EK0A 3O2SB 4ZTBA 5MFPA 3TR6A 1P45A 4LY3A 2XBUA 2NXWA 3JVVA 2MC3A 3ZU2A 4ZIRB 4C4ZA 2JFVA 4D4KA 2H17A 5EE3A 5FUXA 4D6YA 3M8EA 4O8CA 2GILA 4DN6A 1U9IA 4MW4A 3TBIA 5KOIA 5E3OA 2LPMA 1TAUA 2GIZA 4A0FA 2J46A 2QUIA 1EGHA 4OIQF 4Z3DA 3C5HA 1U65A 1HYGA 2K4BA 2ZQZA 4FZ5A 2DOKA 5K0EA 1I36A 4EMSA 4QYIB 3TB6A 4MJ7A 1L5HB 2WQZA 1PJRA 1W52X 3NTLA 5FRDA 3FVVA 3Q6IA 1E58A 1Q1QA 2NIPA 3RV4A 4XM2A 1C1YA 2W2OA 4PGGA 4IIHA 1O2DA 3W04A 1L7VC 1HQDA 1RRKA 4WCGA 3AVTA 3DO8A 5B3JC 1O94D 4ZO8A 1MPTA 4O4LF 2LF7A 3R8XA 3BQZA 4KICA 2SCUA 3PFYA 4DQUA 2PPVA 1KI6B 1MJGA 3D5QA 4DLSA 4XONA 4HNGA 4DTIA 4ITUA 4HPQA 3VNUA 3GFSA 2J45A 4HS4A 4XJTA 3GVXA 4XCXA 3C2GA 1ZUHA 4P81A 1U1EA 3KJXA 3GLIB 4V0KA 1IW7F 2XBLA 1QRUA 3HN7A 4BDTA 3JSOA 4Y2RA 2DI3A 1JF8A 2FZVA 3J81k 2JZNA 4FGZA 4RA6A 5B2FA 1X1PA 4GT1A 4WBXC 3ZCQA 4PBTA 2ATXA 2QTLA 2W5UA 5F7JA 1V9LA 1GSOA 1TC2A 1W93A 3IHLA 2R44A 4OFZA 4NC7A 3GP8A 3GI1A 3UG6A 4I1UA 1KO4A 3L4BA 2P0EA 2F1KA 3I01M 4NDAA 4MW5A 3M3DA 1RYDA 2G4CA 4P0TA 3JQQA 1D2EA 5IT9K 1TE2A 1GADO 2IXFA 5CURA 2ZBEA 5B3SH 1QTIA 2MMGA 4HNAA 4AO8A 1KZ9A 4XTCS 4ZN6A 4HXEB 2JH3A 3VZPA 4Y1GA 4IHVA 4UEWA 1M6VA 4MIKA 3RVQA 2L9RA 1KU9A 2J59A 3JAMZ 3EEFA 2GN2A 2GN1A 4F4FA 1EZ4A 2E60A 1UQRA 4TKUA 4IEJA 2XWPA 3ER6A 1Z1DA 5JTUA 4RF4A 1PDOA 5ELXA 1Z4KA 4BKXA 4UNQA 4QPQA 3ZLUA 2FX0A 1KVQA 4ZC1A 3V7YA 4EX6A 3HKBA 3IR6A 5FP0A 3O2NA 1J33A 5JLXA 1FMLA 4Y9RA 1C4WA 2LRDA 1ORKA 5KTRA 2ZRKA 2PVSA 3ZN2A 1JI8A 2GYYA 5CB0A 5J6XA 4OHPA 4B3RB 3H2SA 1UT6A 1LPQA 1CRLA 4D4IA 2O8FA 4QPOA 4HR7A 1U8ZA 2C4WA 2QQ9A 3C97A 3A4LA 1ZC4A 4TMXA 5CVCA 1ETHA 2XIQA 3OWHA 4EZIA 3ETNA 3B8HA 2VB6A 1OFHA 3IULA 3LGAA 1RXVA 1JWLA 2WA1A 4TL8A 4CCAA 5MDHA 3OX1A 3NUZA 2B8EA 1DLIA 1DGWY 4XQEA 3T0FA 2A0FA 2Y69H 3FXLA 3L8FA 1IQPA 1DARA 2HA5A 1OH7A 4RM2A 2AR0A 4L0CA 4MLCA 4JJAA 2CVPA 1EB9A 2QTFA 3KDAA 4TS3A 3LDFA 1DJMA 1KDVA 4V3CA 3UC9A 2Z33A 3M6VA 4HSEA 5CP8A 2GK3A 4W1QA 2PRYA 1IU9A 5DPMA 3ONNA 5LYYA 4MQ4A 1CJSA 3WGZA 3USZA 5CJ2A 4MQLA 3R0ZA 3RWMB 2J7KA 4RS4A 4ZTUB 4OL0A 4PGHA 5JH7A 3EZNA 4P84A 1KMHA 1UMBB 2AKYA 2H1HA 5BORA 2O19A 1YONA 4C29A 3TTXA 4CT0A 1P1CA 3LECA 2PAFA 2IA1A 4O08A 1YHQI 1MQAA 5BR7A 4H1TA 3FISA 4O59O 3UENA 1RXEA 5L53A 2A61A 4A9AA 1ESCA 2EJTA 2Q5LA 1SKYE 2HC9A 2BL4A 3UWOA 2X1MA 1H5QA 2R66A 1C0PA 4QGAA 4TWJA 2IHNA 1U2GA 3ZHZA 2RH4A 3WO1A 4RHTA 1XQWA 3SC2B 3PDHA 3HGMA 4ES6A 3NBZC 2IUTA 2VLBA 4ZRMA 5EZQA 4QVGA 4LXHA 3OFVA 5B7GA 4XH9B 3BHIA 4KSCA 1R5JA 3K8OE 3OZTA 1ZZGA 2QSFX 3LHSA 5JCOA 3G2BA 3LKBA 3VZRA 4TMZA 1B93A 4F72A 4IS3A 1FBUA 3F1LA 3DV9A 1AQJA 4AYBN 3KIPA 3X1DA 3KPUA 1PIWA 2ZP1A 1G8SA 3QUCA 5LBUA 5G0TA 2I6SA 4JI8B 2GXUA 2V7QA 2PD6A 1PT8A 5ULLA 3KKNA 1NOKA 3QLUC 2ECKA 2M30A 1A2QA 2XQFA 3NRCA 3GLUA 4PWZA 2QN9A 3GTLJ 3ZDYB 3I0TA 3T7KA 2WFZA 2P4SA 3TO5A 3BTCA 1SMTA 3LSYA 3WTTC 4C0QC 3L40A 1GTRA 3AR8A 3A0UA 3WB2A 1Z6GA 3MTDA 2C0QA 2EF0A 1HT1E 1N34B 2WZDA 5JEDA 3HO8A 1SXJB 3Q7TA 1T36B 2R79A 3WLHA 2BHZA 4CKYA 1EA7A 1XKQA 5DLEA 2W85A 3UPUA 1UBCA 4EZBA 4N9QA 3R1IA 3FI0A 2GH1A 2V7UA 1FVFA 3VO1A 3MLAA 1W8IA 1M10A 3S2HJ 1A4IA 3CR7A 5I47A 3A1YA 1L8OA 3GNQA 4IDFA 4BMXA 3B2EA 1SXGA 3SDBA 1FW8A 2A6TA 3CRW1 3HR4A 3FOEC 3TQQA 5CPBA 5A6VA 4RXUA 5KREA 4LYFA 5EP3A 4H7DA 2NRAC 5BVHB 2ZRQA 1IZZA 2VBXA 2UXDB 4KU4A 4BVAA 2FU5C 3DA8A 4GOKA 1UXHA 3I2IA 1LDMA 2X5NA 5F1PA 2BPOA 2IPMA 4ZODA 4XGNA 3KALA 4DLNA 1CY1A 2XWQA 5F64A 1T4CA 2QKLB 1UJNA 4HLUC 3D31A 1Z21A 1Y8RB 4X97A 1OMIA 1C81A 1Y9JA 3K20A 1GV0A 3ABSB 1FFHA 5AHOA 2O1EA 5F9MA 2PO7A 3NW9A 2JLAA 2GX6A 4CMGA 2FR1A 3WBBA 3S1AA 2DBYA 1CR1A 1V1MB 3L0ZA 3CVJA 1WBBA 2E35A 1OFTA 1C0EA 4CT5A 2YQZA 4EUSA 2HDWA 3OM8A 1DJNA 3H5VA 2QTBA 4XLEA 1FWZA 5HZHA 1G9SA 4MR9B 1FUKA 3TRFA 2CE2X 5AVKA 1ORRA 4IJVA 2RNJA 2PXCA 5KWJA 1KC1A 1ESZA 3RNLA 1I2DA 3DD1A 4F1KA 3AUYA 2W8ZA 3BXGA 3UQZA 5KO2A 1ZLXA 4L5EA 1PGNA 2PAAA 3PA8A 1HX7A 4AP6A 3W3AD 4WK0B 2HA2A 2X9GA 1IY8A 1K4SA 2J4CA 4LJRA 1EXVA 5HUQA 3RUPA 1M1UA 1XTRA 1VL8A 4A0QA 5DX1A 3HBFA 2BVMA 2XCUA 4GXRA 5EZHA 1Z5PA 3ZX5A 3KR9A 2WJZB 2K9QA 1QANA 1V8ZA 4V3BA 5ECDA 1RMYA 3OT4A 4TV9A 2JSCA 2ISQA 3A1VA 1Y8CA 1MJHA 2CW5A 2ALJA 1KYIA 2X7HA 3PTAA 1GHCA 3Q40A 4A93J 1YFJA 2F55A 4LOCA 2PH7A 1QHGA 2GBFA 2IU3A 4C2AA 3UMJA 1L3CA 1X9GA 1HV8A 2Q21A 3EARA 4XN3A 5B37A 1UUFA 2WY2D 3OWOA 3S55A 2C84A 3DLBA 4BNDA 2VQGA 4DILA 1BD3A 1KQ9A 4F5YA 1QZYA 3OMLA 4KE6A 1G21E 3GEBA 4KMMA 1A69A 3B6JA 4HGNA 1MQ9A 3QA3E 3EUHC 3EW7A 2XDAA 3NHAA 2F5VA 5KYNA 1I1NA 2G77B 4RAFA 4JI0B 2PKWA 1RYFA 3AHIA 4G89A 5DDIP 1PYDA 5CBPA 1WB4A 2FN7A 2QYSA 4L3OA 4EYSA 3AJRA 1BMFA 2OQIA 2IEIA 3WXBA 1PZFA 1V8DA 4EQ6B 3NDRA 3N5KA 4LRWA 4NS4A 1Q0PA 1P1JA 3PIOF 2CSUA 2POQX 2V7GA 2QDXA 4Z3OA 5K5OA 3MWDA 4UUBA 5IYCJ 5C4IA 4XQCA 3A3NA 3V1NA 3WGGA 1XRRA 2H4JA 3UOAB 2KLOA 3ZW8A 4EJOA 1BFDA 1HA8A 5DTMA 1FOWA 3C6YA 4PGFA 4EUHA 4HG2A 3QKTA 3ONFA 5LDDC 2WU4A 2PSJA 2WNIA 3O8DA 1GTSA 5KC8A 1ITYA 2CLFB 1N8SA 2VWQA 4RKWA 1ZL0A 4DRZA 2JVGA 4Y3UA 1N0VC 3FCXA 1CUIA 3K1MA 5KINB 4O4JB 3ZMVA 1MAAA 3ZU4A 4YFYA 2I2CA 3IWZA 3HJGA 1OW3B 3ZGXA 2VH5R 4DGWB 4RVGA 5IJ0A 4Q9NA 3FYCA 1FBNA 1BMFD 1MB2A 2ZWVA 4WD3A 3QW4B 1SKUA 1L4UA 1YHNA 1ODDA 4BP8A 2ZJBA 3SE0A 3LA8A 1X1QA 2F17A 3VR4D 4PAGA 3BUSA 5CG2A 3TN7A 5DNAA 4HLNA 1U63A 1WXDA 3C2HA 1X9IA 1TT0A 4L73A 3AY7A 2GWRA 1P0IA 4TKZA 3K4QA 3W5JA 1SQ6A 4HF2A 3ZKAA 1W5EA 1HKTA 5BR1A 1UELB 5IXYA 3EVCA 1KRXA 2E55A 5CDYA 2BEVB 4J3JA 4YLGA 4B7CA 1TTHA 3ILSA 1PBNA 1A9RA 3KZIC 1QP4A 3W9UA 3OZUA 3SNKA 1XTPA 2EFNA 2JIZD 1PNVA 2AOXA 1R6RA 2C0CA 4UAGA 2LD5A 3UYKA 4FC7A 2ZSDA 2PGJA 4KRYA 4L8GA 1YHYA 3O93A 1GTJ1 5A3SA 3TDNA 3IE1A 3DWGA 1I1HA 1RQGA 4J1NA 3TZHA 5K6RA 2WQ7A 4C0AC 3OTQA 4WN9A 1N0UA 2PSEA 4QPJC 2XRNA 2V0CA 4MS3B 4RTJA 3PI7A 2WDPA 2X8JA 2EW8A 3CNNA 5ETJA 4G56A 4UUQA 1JDZA 2ZI4A 1HDGO 2HK8A 1DB3A 1Z77A 2VBZA 1CUWA 1XI2A 5LUAA 1OT3A 3NXKA 2LZ0A 2A5DA 4AN1A 2PUWA 3KUKA 1HSTA 1YJ9I 2VSQA 3OIGA 3HB1A 3T7SA 4HHEA 4I0WB 1R64A 3EVZA 3LYHA 2E1NA 4BMVA 1XPOA 2ZJ2A 5EE0A 2ORED 3Q1LA 3SR0A 4Z0HO 3H2HA 4F1JA 1C7IA 3ODGA 4IDDA 4CKXA 3AZQA 4JGBA 1WHSA 5FL7A 3UC5A 3F74A 1KU6A 1NH3A 4YCJA 4PZCA 2V5VA 2ZRIA 1XD8A 1WCXA 3R74A 4JZKA 2YNMA 4LK1F 5ADHA 1DIRA 2EGUA 3GFVA 1NM5C 2YBEA 4JKIA 3EQ7A 4JVMA 4AROA 1QCYA 2HNKA 2CCKA 3MF4A 3DB2A 5DRTA 2HTFA 3JD2A 1BW6A 5EG0B 5EUMA 5IN5A 4M7PA 1W2WB 2WVAA 4TTSA 3HC7A 3VO2A 1PVOA 4AI6A 4KO4S 2O50A 2TECE 5D7NA 5AW2A 2OGSA 1SUFA 4MP6A 4J0GA 1DRWA 5LD2C 2Z4SA 4B8XA 3QYJA 421PA 5KYXB 2R7DA 2QRHA 5JDIC 1JDVA 3GT7A 3SYKA 4UM9B 3UW1A 1S89A 3PPWA 2Q4TA 4QZVA 1PEDA 2ZJFA 4JLNA 1Q0HA 1WPXA 3LUGA 2WPNA 4WOJA 4EH1A 2RH9B 3GDWA 3FOBA 4Q00A 2AQ8A 4MO2A 3G49A 1GARA 1KJZA 1CFZA 2IXTA 4FSHA 4LITA 3L4EA 2QSJA 4LK2A 4E4RA 4Y2TA 5EXEA 1JAIA 1QM5A 5D85A 1BKDR 4L9VA 3GFJA 4Y0AA 1XR3A 4M2LA 2YKGA 2B2XA 2E85A 4HF1A 1VQ1A 1ILWA 4JLMA 2WJIA 2KQUA 1QFYA 1TK2A 4S2UA 5TX7A 1LRKA 2DSTA 4RBNA 4E2ZA 3R8CA 4X63A 2HIMA 4O2AF 4BN4A 2X22A 3B12A 4ZI7F 2PEXA 4XYMA 1XZDA 3ZDRA 1HKUA 2BJVA 3ETHA 3GEIA 1OX5A 1JKOC 5U1PA 4LRUA 2GAJA 1P2FA 1RSZA 4EHNA 3P27A 2P4WA 2ZTMA 5JSQA 1C30B 1Z37A 3HRMA 1UKAA 3H4TA 4D9FA 5B3AA 3C5EA 1FUYB 3CSUA 1SUDA 1U2PA 3H18A 1BXGB 3OECA 5K7FA 5FLVA 1T6YA 4KTVE 1EP9A 2YFHA 3YASA 3AETB 1T9KA 1RW4A 2OSVA 3KSZO 5FQNA 3LDHA 3IIEA 3KE2A 4FGKA 2LCFA 2PX9A 4TV8B 4N5LA 5C4XJ 3INGA 3GHYA 1X2BA 4X94A 2XSJC 2RAUA 2Q3MA 3NP7A 5E4TA 1KBZA 4UQLA 3DAPA 1K7XB 3GY0A 4ETSA 3UEOA 2DM6A 5CLHA 5A2QZ 2HQAA 4HWTA 1ZK1A 5F1JA 2QX7A 2FEPA 4O1HA 4KOAA 4IZZA 3NFRA 3NT4A 5JSZB 3Q8MA 3DBLB 3OIFA 1WDKA 1H85A 2IXAA 1CXZA 4CE6A 1OXVA 3I52A 3P9ZA 3HGTA 2BI4A 1AY0A 1DAMA 1USVA 3GLSA 3UHJA 3QU3A 3NIWA 3TW8B 5JWHA 5AOCA 2ZYSA 1MSFC 2PX3A 2IXDA 2M9MA 1RE0A 2IYSA 3UJ3X 4C76A 2F9LA 3WG7H 3CN9A 2ELJA 1KYVA 1HLDA 4Q3EA 4KOEC 3DUWA 4OQLA 3RO7A 1DU4A 1I8TA 1E8MA 5JJLA 3B85A 2IZ6A 4P4SA 3RYIB 3ESYA 4PS1A 3RS7A 3DBOB 3AR9A 2ZYAA 2NSDA 1K86A 4M9RA 4MCIA 4NG4A 3L00A 2JFFA 3BQ9A 1WIWA 1E7QA 1DCTA 2D1QA 1JG3A 3W5UA 3OC0A 4XOIA 5EIWA 4ZOQI 3WIDA 4G1VA 2VPRA 4UFOA 3HO1A 3IOMA 4WK8F 2AJBA 3MJRA 4E15A 1CQJB 3DF8A 4LIUA 1R0SA 2AQFA 1DDOA 4KBFA 1COWD 4GMFA 2FRDA 5K0BA 1WXWA 1QRDA 3ZWKA 2F8MA 1V8BA 4IDHA 1I7DA 4MRRA 4LMPA 3DB1A 4PCLA 1PVDA 3OCXA 5EJCA 1YITI 1R0ZA 2FQQA 4UVGA 1W1IA 4LPSA 2AWNA 3IXMA 3V8PA 4W1UA 2X7JA 3L7MA 1GFSA 3G89A 2OESA 5JAHA 2YVKA 4L74A 4OHOA 1S5LC 1YMUA 4ITRC 3FM3A 1VQOI 3QITA 1LKXA 1E66A 1Y4AE 3CURA 2M0MA 4H0EA 2J4FA 2H5IA 3FXMA 4KKVA 4QODA 2QE6A 4ALMA 4FGJA 2OCIA 5IJAA 2ADFA 1Z8NA 5FWNA 1S9HA 3P4XA 5DYGA 2YWFA 4DPLA 3MMXA 2P3OA 2VJYA 1ZAOA 1EV7A 1RPTA 3H9EO 3RDPA 3K09A 2VWGA 4BWVA 2ATIA 3I12A 4HQFA 3BCAA 4ZO7A 4GMHA 2O9JA 2FGKA 2QTVA 3PX3A 1IOVA 4CM4A 4MW7A 1TF2A 2E0IA 6PAXA 4P4NA 3CRVA 3PJFA 3ZDDA 1QIIA 2AVDA 5K7HA 3JQAD 2Q3BA 5EHNA 3IC7A 4C03A 3OTHA 2ZXIA 4V2IA 1DBPA 3NIGB 1Q7GA 1WY7A 3V8QA 2DODA 1P7PA 2MIIA 1RXWA 2DHDA 3G2MA 4FWIB 1CUDA 2AKAB 5GPBA 1WSDA 2F1HA 3HH8A 4ENNA 1PL8A 5IYZA 3ACBA 4DJ5X 3PA6A 3VUEA 3GLGB 3OJ0A 1II8B 5M2QA 4WLOA 1PFQA 3U9SA 1Z47A 1JU9A 2B30A 4WXEA 2QLFA 1XLTC 5HNKA 5LHIA 1G3TA 2PZFA 3P52A 4QATA 4Q1FA 4FLMA 3AQ4A 3TNDA 3GLLA 2R8OA 1NUUA 1C3EA 1EXNA 3TSAA 1I4EB 1QXSA 4FR5A 3IUEA 4MWOA 1D04A 3U49A 7ABPA 1OMOA 3VGPA 1TU3A 1FNBA 2R9VA 1OHHA 3OL4A 3CG4A 1P6QA 2NO1A 2XF5A 3GTKJ 2BLNA 3ZN0A 4MZXA 2D1VA 1FFDA 2TS1A 4JP3A 1D9XA 1MBEA 1FP4A 5A62A 2R92J 1J20A 2YX1A 3I0NA 2GF2A 2D3TA 2BUCA 1VECA 3K4PA 2C8JA 4B32A 4UMEA 2JPDA 2HKOA 4TROA 2XGXA 4NJEB 1ML4A 1XD7A 4GSKA 2ADUA 2LSOA 2NP6A 1HE1C 1JBEA 2C4UA 3DVSX 4EBBA 5TGDA 1MB9A 2AX3A 3QMPA 1FMVA 3KVOA 3W4IA 4IILA 1BC7C 3STXA 1UZAA 4JDUA 4G3XA 2LIPA 3GFIA 3D3KA 4LOIA 3FHLA 2NU9B 3D1NI 1R5ID 3OURA 4AKTA 5BSVA 4EI7A 1DKRA 3UKDA 4OBEA 4G0NA 1AKVA 1GFIA 3K9LA 2GSWA 4RA9B 4HUTA 2QD5A 3OEEA 1XVAA 2AE2A 3F90A 1NR1A 2FDXA 5DCLA 1VPTA 4AC0A 4AO7A 4FFMA 2CDBA 5FADA 2YXPX 3KKEA 4AZ0A 4MS4B 1HDRA 1JAHA 1II0A 3L1VA 3ZXXA 1D0ZA 3OIUA 3D2AA 5EUCA 3CZ5A 1BS2A 3LW8A 4MKRA 3G8BA 3T5CA 2WQ6A 3FUUA 4Q9HA 3H0DA 3CYFA 1DRVA 1ODFA 4ENRA 4YG2F 2P40A 5ERIA 2WJGA 3OSUA 2OZLB 4B3TB 2REOA 1KOJA 3Q3IA 3MUNA 1YV9A 4RTMA 4CMEC 2ONCA 1OYVA 3DKXA 2Q2OA 1VL5A 4IIJB 2A0YA 4UDOA 2J85A 4NPCA 1GPUA 1Z08A 1ID1A 3G8DA 3FM9A 1M34B 1MJ9A 1AT1A 1LV8A 4TQAA 4DANA 1GAEO 3VVMA 4LSZA 3KG2A 3SP1A 5KQLA 1GRRA 1UMCA 3P7MA 3LKDA 1IZ1A 1R1VA 3K9TA 1T43A 4G23A 2QTMA 4M83A 1BW9B 1I2AA 2WDZA 4G0UA 2WD7A 4KSBA 4DNQA 2RK6A 2KBFA 2ZYIA 3G8CA 4MGEA 3NTVA 4QWWA 4OJMX 2F9MA 4PM4A 3KL4A 2OHOA 2PD4A 1V37A 3OT1A 1YC5A 2WYUA 4IJKA 4A6DA 1XNJA 5KKCA 3WR5A 3F6SA 2V7BA 1ST3A 5DD8A 3SYLA 2VZ8A 5JZOA 2HIGA 4HQ0A 1UJ4A 3K0CC 1EK2A 4PSDA 2BUBA 3KQKA 1ISRA 4R81A 2XB5A 4LB6B 3QBJA 3RS4A 4IHWA 4W5NA 4J2TA 1GA4A 2P6RA 5I7UA 1W46A 4PRZA 3OYAA 4LGWA 2O0YA 4X1YA 2G70A 2CNWD 4ZT3A 1XL1A 1X58A 3K16A 3QVWA 2ZSIB 5FULA 4HP8A 4MDFA 3B1XA 3ODPA 2NVQJ 4Z8YA 5FLXZ 4JLPA 5BSKA 1TTTA 3FM5A 4IDNA 4QYMA 3QKSB 3WU2C 3KJQA 4Z4HA 2XOKA 3IIIA 3MGBA 3QFSA 1Q5PA 4ZDIA 3QX8A 2YDYA 4HNTA 1BWRA 1MG0A 3B48A 1CRWG 1Q1AA 4LFBB 1U0FA 4C01A 3NC1C 5E6UA 1S96A 5HIAA 2XY4A 3RR2A 3OF5A 3E6CC 3HOVJ 1GEEA 1MTOA 2H2IA 2ZREA 3QRWA 5J1RA 3VB2A 5AO9A 1K7AA 3SG0A 1YQTA 4QE3A 3R4CA 4RB3C 3CW2A 4K2AA 4BLWA 3VOBA 4D5FA 3IJ5A 3DW1X 5REQA 2BTEA 4P3KA 1XDBA 3NBUA 3OMWA 3ZJVA 4JX6A 1IUNA 5MGBA 2PSDA 3AGQA 2VDWA 3EXHC 3P5SA 4AL4A 2OUMA 2G9NA 2EA2A 4XVQA 2NUAB 1NQ5A 5G0VA 4ZDWA 1NVTA 1CS0A 3JYOA 2OLEA 3TFQA 2ZS9A 1BXZA 4UREA 1IZ0A 3ILVA 2YMMA 5HTOA 4JQYA 4EB8A 1QLHA 4BHPA 3PQ2A 2XOKD 3RKWA 2D2WA 3ZY6A 3R61A 1YQGA 3ES9A 5CH3A 5AM1A 2PYIA 2BV3A 3UB3A 3MQFA 1JJFA 4U6SA 3IOEA 2B98A 4WADA 1PJZA 2QDKA 2AVNA 4PEVA 3CCRI 2JGDB 2BFBB 4J1SA 4LTNA 5DIFA 3L7AA 5HQTA 2KWIA 3FDZB 1KIFA 3I3OA 4H4EA 4BO2A 3OVMA 1VRVA 3WHLA 2CDCA 5FFFA 5IEBA 2CXSA 4F4DA 3MWEB 2I0FA 3ZX4A 2I1QA 3D8NA 5EAIA 4Z9FA 4RXTA 4BB5A 1T5BA 4XYGA 2VHZA 4F9TA 3CC2I 1G8HA 2IU0A 3K4LA 3WSWA 2VXZA 4KO2S 3AMVA 2OHGA 3TOZA 1JKQC 4Q9AA 2NZJA 2VUMJ 3TO6A 2FEOA 1EVQA 2WB1N 3EY9A 1I0IA 5GPAA 1GO2A 1L7QA 3QQ5A 3KQHA 3BG3A 2BXZA 2WHPA 4JQZA 5D8LB 1A88A 2QN3A 1H6BA 5J2TF 5BVGB 1YMVA 4I81A 3BGOS 4Q93A 4JC4A 4CLHA 3KKZA 3VPRA 1HNXB 1XB4A 1IN5A 1E4EB 2ZB4A 2ZTVA 4H4KC 2Z8YM 4RUKA 2A86A 3N2GA 5BQFA 5EEAA 2PBFA 2HHAA 2WZBA 1GRQA 3BOQA 5TPZA 1M7HA 4TKLA 3H13A 4QUAA 1ATIA 2NYRA 2VXYA 1H05A 4HDQB 3RHTA 4J7CA 1NQWA 3EF0A 1ZICA 1RM4A 4N65A 1WU8A 5B4UA 4HRIA 3ELBA 4BKUA 1ERDA 2XYGA 4CGZA 3WTYC 3E18A 3WQRA 2ZI6A 3QYBA 1DQUA 4OO3A 4QECA 5AT1A 4YMUA 3LNTA 1ISIA 3N2KA 1HQCA 1P7IA 1D0IA 1OWMA 3E70C 1A8QA 3B78A 1I5RA 2XBMA 4DR5B 3LK6A 4GPZA 1M75A 2EQ5A 1QHSA 4QGSA 1RI2A 2G1PA 3VMMA 1Q22A 4U7FA 3AM5A 4C88A 2VJLA 3HU1A 3B9PA 5TPZD 4WCVA 5TGTA 3CJRB 5JZBA 3BMNA 3ADBA 1GZ4A 2P6UA 1VXRA 3KUDA 4ZMRA 1P39A 2FJPA 1JXOA 3EQ2A 2GOMA 3E6MA 1RWPA 1GDTA 3EPLA 2IDKA 3GMDA 4X45A 3NWSA 1N0WA 4G2NA 4G0VA 3B02A 3U4GA 2F4IA 3GAAA 3EYIA 4DBZA 3KAJA 2RGRA 1X2MA 2XQIA 4B2YA 5FHQA 3E5QA 4KN4X 2C4TA 1Y39A 1OLXA 4REOA 2DA7A 4OHMA 5CAEB 1FK8A 2Q49A 4B4WA 1VLMA 3GA5A 1ZK0A 2CZGA 3FY4A 4BU1A 2EARA 1D1QA 3EGVA 4TRRA 1M1NA 1G18A 1J06A 2XGMA 1QNTA 3KKOA 3R3YA 4A6PA 3LPLA 3TFOA 3HM2A 1LPSA 1F9NA 2CHVA 1IC6A 4JA2A 3BROA 1KJQA 3A03A 3PIIA 2UZAA 5F7ZA 1B6AA 3EW9A 1JT0A 2JFNA 1DPFA 1AE1A 3DXFA 3ASZA 5TQJA 4K81B 4JC0A 3ICWA 1A8UA 3IV6A 4JT9A 2XPWA 4NDLA 1SOUA 1J99A 1ZGGA 3MVEA 2NNWB 3GRZA 4NV3A 5F6FA 2XSDC 2X9LA 2BW3B 5FFXA 4KWEA 5HKKD 1J8FA 1Y89A 1N36B 1P7ZA 4DR1B 5JVGF 5LQDA 4QYTA 1T5SA 2DA3A 4QU0A 1NFFA 4OJYA 4U2GA 5F73A 5M5XJ 3R3SA 3TLZA 3P5JA 1TD9A 4C4PA 3U7JA 3KTFA 1ZBDA 1GL6A 3DNMA 4XLHA 3K92A 4DM3A 2IEDA 1HE4A 3HU5A 5DRYA 4B1RA 5FORA 3OPQA 1B8VA 4LF6B 5K0CA 2ZJ3A 4BFVA 2H8KA 3L7LA 3VKHA 1P2GA 2Z2JA 4UFPA 3KP7A 4YMGA 4FKMA 1AMOA 4Y2JA 4FHTA 2FHPA 4BVEA 3BFXA 2VNJA 1RLJA 3N28A 1EZZA 1KEEB 3PKJA 2GZSA 4FCCA 2RK3A 4GX0A 5KOHA 1MT3A 2VSXA 1M6HA 1OFUX 1G20B 5DP1A 2QGUA 2FZLA 1ZJ5A 5TY0A 3P9KA 2PX8A 2AG6A 1WGXA 4G0QA 3ZD7A 4K6CA 1CKEA 4DZRA 3MWLA 2YJTD 4ND2A 3FH0A 2BY2A 3LP8A 5AQ1A 3IRUA 3R7DA 3QPSA 1KH1A 2YVAA 4JOQA 4CMAA 3HCPA 3D3NA 1CUAA 5IVKA 3P97A 3DV0B 5E2BA 1W88A 4Q1CA 1WCIA 4QXRA 2PRIA 4HATA 2WWRA 3K4BA 2QD1A 2P4HX 1IXRC 3KQWA 1YKSA 5DN9A 2YXLA 1NF9A 3PNYA 3IKLA 3ZKWA 4Q18A 1VE7A 3J7AC 1IJWC 2HF2A 5B6JA 2CMKA 2VYVA 1ECCA 4J1TA 5BMOA 1MW8X