4EVIA

Crystal structure analysis of coniferyl alcohol 9-o-methyltransferase from linum nodiflorum in complex with coniferyl alcohol 9-methyl ether and s -adenosyl-l-homocysteine
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
368
structure length
360
Chain Sequence
MDAATAVELLDAQPQVWHHFLGYINSMTLQCALELDIADVIHRHGHPIPLNQLAAALEIPQTKAPFLSRLMRMLVHLGYFTQVITKLPSYWLAPLSRLLLKQNPYNARSLTFCSVHEHLVDPWRQMSAWLRTGKEDGKDTPNAFAFAHEGKKVYEVCSEDANFSQLFSEGMAGDSWLFSRALVSKCRDAFEGLSSLVDVGGGTGNTSKVIAETFPNIHCTVFDLPHVVSGPKQTHPNLDYESGNMFTDEIPHADAVLFKWVLCDWPDEPVLKMLKQCKKALTKNGVKGKLMIADHVLDHESCNDSNSMGTSLILDMLFMSFLEGSLRTEKQWAKLFAEAGFKDYKITPVGGLRVLIEVYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Coniferyl alcohol 9-O-methyltransferase
publication title Structural analysis of coniferyl alcohol 9-O-methyltransferase from Linum nodiflorum reveals a novel active-site environment.
pubmed doi rcsb
source organism Linum nodiflorum
total genus 128
structure length 360
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4eviA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4eviA02
2K4MA 3T7TA 5AIPA 3HCFA 2G7HA 1IN4A 2FBKA 3H92A 4GOND 2K86A 5KQSA 4KICA 5LHHA 1UFKA 3OPNA 4KYWA 4ER6A 3ZQ7A 5HS7A 1XDZA 2GAFA 3QV2A 4D0PA 3G73A 1Q0SA 1XCVA 3G5TA 1BN5A 4UHTA 2XVAA 4M6YA 2HYFA 3TOBA 1R00A 2XRNA 1SD7A 1UHWA 2XHKA 5HS8A 3TLJA 5EIFA 5DTQA 1EQAA 3KR9A 2IH4A 2VP3A 3GF2A 4L9VA 4OQEA 2FHPA 2I6GA 3VOEA 3NTVA 4EQZA 4BAYA 1AQIA 5KVAA 2LF7A 1U2ZA 5HOOA 3OCJA 3T1BA 2L01A 3CCFA 5DYMA 3ML6A 5FQNA 5K5QA 4RTLA 4IV0A 5E1ZB 2G71A 2PX8A 3CJQA 3FPJA 5HLIA 4OINF 1N7IA 2G8NA 2H11A 3SSMA 2OYRA 2PQ8A 2NXEA 4ZYEA 4EJWA 5A2QZ 2C7RA 3KQTA 2ZZMA 2O61A 3JTHA 2JZYA 4DQ0A 1Q0TA 2DULA 4P96A 4M36A 3EEOA 3BWBA 1FWZA 1I1NA 5F2OA 1VPTA 4Q5SF 1O9GA 4XSZF 2QBYA 3QAHA 3I58A 3BWCA 4E31A 1G4DA 1QAQA 1JQ3A 1SMTA 5DRTA 3HVIA 4CO8A 1VIDA 1JTFA 1K79A 4P9FA 1UHMA 1S29A 4MGRA 4RB2C 4MQ9F 3TM5A 2P7HA 3V8JA 1X1AA 4P7GA 1F5TA 4RV9A 1KPHA 3F23A 1WY7A 4MHGA 5EMMA 4MNUA 1FJXA 1V4RA 1NW6A 5GM2A 3F3XA 4EGYA 1D5VA 1WWXA 3GEZA 2BM9A 3KQSA 2IA0A 4NECA 4YV1A 4OOIA 3GJYA 5LGNA 3C7JA 1H1DA 4MEXF 2PXXA 2OA4A 3G7UA 1LEAA 4G7HF 3KQWA 4RSRA 4F85A 2ZZKA 2IJLA 5EC8A 1JG4A 1WI9A 3AJDA 1FT9A 3LKZA 1MJBA 1YS7A 1YQAA 4GXOA 4LGWA 4DF3A 2EG5A 4U7BA 4OBXA 2Q0OA 2PT9A 2R7DA 2CKDA 1A04A 3F21A 3F6VA 3KR1A 5JI6A 3W6KB 1D3YA 1QYRA 3MCTA 5DTRA 4RTPA 3IV6A 1RIOH 2KIFA 5DX0A 3EETA 2IDKA 2EFNA 5BPIA 1K6OA 3HA3A 1YS6A 4TV7A 1DPUA 3EMBA 1S3JA 3C3YA 2BEOA 3EVGA 3ROUA 3EVAA 4PYKA 1GXQA 2ADUA 5K0CA 5HVQC 3QP6A 3U1DA 4IRGA 3OZSA 3EVBA 5C1IA 3V8VA 3KZZA 1FBQA 3I5UA 1FYKA 4QWQA 4ZYHA 5FQOA 2XYQA 1EJ6A 1W4MA 4PIMA 3G2MA 4XUEA 3UA3A 1XB4A 4MWZA 4QTUB 4QDJA 5E1XA 3H3UA 4M72A 3KCCA 3EVFA 2WC2A 3CJRA 1I5ZA 2IA1A 5DUKA 1UWVA 5EZSA 2VONA 4RTMA 2HKOA 2QLZA 4I01A 3LSTA 1HKSA 2ZBRA 2XVCA 3V7RA 3UJ6A 3EQLF 1P2FA 4EJVA 1RJEA 3NDJA 3ERCA 4EJUA 2V1UA 4HLXA 1HW5A 3IWFA 4HX8A 4RTKA 3B3JA 2B9EA 4A12A 3ER9A 4NB5A 2BV6A 4LK1F 4M71A 5AIQA 2ZTHA 4H0NA 1OMIA 2XKOA 1IW7F 1U2WA 1ZGJA 1KP9A 2GIVA 4NHJA 4YMHA 3PB3A 2ZFWA 4PYIA 3CUQC 4U0WA 5D6FA 3BPVA 5BW4A 3FRIA 1IXSB 4RAYA 2QE6A 4OU0A 2PGXA 1H9GA 1PP7U 3IHUA 2Y1XA 4M37A 2MD5A 3TQSA 5LBQA 3TKAA 4HF0A 4PWYA 2OBFA 2YR0A 4G9YA 1HSTA 1KHHA 3CJTA 4EQQA 4XUDA 1O57A 5EMKA 3GDHA 3HHGA 3P2KA 4I7HA 3SGLA 4HH4A 5IT9K 3FMRA 1BOOA 3EVDA 4ENKA 4EVIA 1U6GA 4HOBA 3UWPA 3E5UA 1O54A 2QYOA 2A68F 1QNTA 4ISCA 1WS6A 4KUMA 2F5EA 2Y48A 4RB3C 2P6SA 3RKXA 2F2EA 5FLXZ 3NRVA 4AZWA 1JG2A 2M8EA 3FUVA 2Z5UA 3M4XA 3V7CA 1D8KA 3G5LA 3S68A 2BM8A 2ZZNA 1STZA 3BJAA 4R8RA 1YW8A 5BXYA 3H2BA 2OO3A 3I0TA 4ENMA 3D2LA 5E8JA 3R61A 2CWWA 4LECA 1O3QA 4YUXA 4RTNA 2DFIA 1KYZA 2PVCA 2HR3A 3HSRA 2P1DA 1RZ4A 3T0YA 2JG3A 1W7PB 1XSXA 5EHGA 1K78B 1XTPA 2J5OA 4OIOF 5E9QA 1P1CA 2JTVA 3UJDA 2E1CA 5FD5A 4FT4A 4RTJA 4K2EA 4DZRA 1YO5C 4LG0B 3M6WA 3R0JA 2PJPA 2OKCA 4CTKA 4GOOD 2VC1A 3GU3A 1IZ1A 3UZUA 3FUUA 3FM3A 4KA4A 1ZRDA 3O7WA 4ER5A 2PMHA 4YFNF 4R6WA 3JAMK 4FT8A 2ZSUA 3QOPA 1VE3A 5HOQA 3KR0A 1G55A 3KP4A 2HV9A 3C0KA 3LECA 3CLOA 3PS9A 5D5XB 5EZQA 5GIPE 3KQPA 4P7FA 5FA5A 4U88A 5DUIA 2G72A 1FZPB 1Z6RA 3C1DA 5J8FA 4EMSA 1TW3A 2EV6A 2YX4A 1XGMA 1ULYA 3G8AA 2MBFA 1XCBA 3FRHA 3M33A 5LSAA 2O0LA 4YV0A 4AIJA 3NW9A 2FMYA 1FC3A 2CSOA 4R8HA 3GRVA 3D0SA 1FLIA 4IV8A 4C4AA 3B5IA 1ZARA 4PNEA 3A27A 4RTSA 2AOUB 5IT3A 4PCLA 2COMA 3V97A 2PX2A 4HGZA 3T5XA 3LBFA 5D1NA 6PAXA 3N97A 4AX8A 5FA8A 1AF7A 3UJ9A 4OX9Y 2IDJA 1O7LA 3LAPA 5LQUA 3VYWA 4BYYA 2NYUA 1OR8A 3ZMSA 2A3SA 1QPMA 1YLFA 3HUGA 3KPUA 2OB2A 3GRRA 5K09A 2W57A 1VLMA 4YUWA 1W7PA 3NWBA 1B9MA 5BQTA 5T67A 1M6YA 3BROA 3HM2A 1C0WA 3T8RA 3GUDA 3LFKA 5CVDA 3THRA 3E5XA 5ILSA 3LWFA 1JQDA 4LG0A 4WX9A 3SZPA 4XBFA 3TDUC 3M1EA 1DL5A 3KPVA 2JPBA 3ID6C 4C07A 2DK8A 5EOVA 5J6XA 3SSNA 2ORED 3DXYA 3FTEA 3KPJA 3K0LA 3E6CC 5K0EA 1PUEE 4KN4X 4EKIA 1XSDA 1KU3A 2ZFUA 3KEQA 3K1NA 4LLGF 4ER0A 1QZZA 4Y30A 3JSPA 1F1ZA 4DA4A 2LNBA 4UV9A 5ERIA 5CLSA 4E2YA 2XAHA 3KP5A 3FUXA 1IAWA 5BS6A 1R5HA 3F8MA 2ISYA 2DT5A 2DQLA 4IXAA 2J5PA 5FHQA 1G8SA 4LB6B 5K0FA 4M73A 1R22A 2PSSA 3LQQA 3R0AA 2Z6AA 4PYNA 5L3DA 1ORIA 2PV0A 2O06A 3CDHA 2CMGA 3TMAA 4X1OA 4Q48A 5E9JA 3PQJA 1DDNA 2EJTA 1Q1HA 3J81K 3BGVA 4Y13A 4MQVA 3P2EA 4QVKA 1MDMA 5LQJA 2ZJ2A 1V39A 4QQKA 3I71A 3FUTA 2ONYA 1ONVA 5L3GA 2GAUA 3P9IA 2HGCA 1NV8A 3DUWA 3ZMUA 4YIIA 1S8NA 5LRSA 3S2WA 1FOKA 1KA8A 2MH2A 1S7OA 5CVVA 3RI4A 3C3PA 2PMUA 4HX7A 3R3HA 2XV4S 4YUZA 3JWJA 2BR4A 3DR5A 3IEIA 2IIPA 2EJRA 5KVRA 1WXWA 1HKQA 3DFGA 1BIAA 4L9TA 3QU6A 3BGIA 4ENNA 3V8KA 5CCXA 1R74A 4F7ZA 2ZWAA 4EJOA 2HQRA 1OPCA 3PT9A 5K03A 5LEKA 1TPYA 2M45A 4DQ2A 4E70A 3OE5A 5H20A 3DF8A 4IHSA 3DXXA 1QZYA 1HQCA 3HYIA 1DUXC 3H3ZA 1XCJA 5DCFA 3DXZA 1QO0D 2OBPA 3DP7A 3VB2A 2WK1A 3LX6A 2IGTA 1FSEA 1KQ9A 5BPDA 1P4XA 1G6NA 2PXAA 2CWEA 4UOEA 2HS5A 3J7AO 3ZMTA 2F5FA 3BDDA 3FXQA 3WE2A 5EIWA 1Z1DA 4P5OA 2BE5F 2M1BA 2UYCA 3T8TA 5D6EA 3EVZA 4FS8A 3KP2A 3I54A 2NP7A 4LB5A 1KPIA 2A07F 5FO5A 4AIKA 3LGAA 4YMGA 2XYVA 5L3BA 4JQFA 2V74B 2UXNA 4KMUX 2YVLA 3M70A 2C7QA 3KQMA 1LVAA 4LLLA 4G56A 2UYOA 2JPCA 1M0EA 1Z3CA 4RX1A 4L0ZB 1I6XA 3J80Z 5T64A 3GFLA 4M9XA 2YXDA 1X19A 3DXJF 5D4SA 3RPUA 4LMYA 1ZAOA 4ESJA 2NXCA 3MZHA 3BWGA 1L3LA 2PT6A 5FTWA 3WTTC 1JHFA 5ICEA 2AS5F 1G6Q1 3F8FA 3U81A 3O3KA 4C06A 5K0JA 1X1BA 4UV8A 3JWGA 1K7AA 2NS0A 3HVKA 4Y15A 2VOOA 1XJ5A 1SQFA 1KU2A 2LDUA 1P39A 4QPPA 5DRYA 5JFRA 1JG3A 3SVZA 2P5VA 3GXOA 2IVMA 5DX8A 3K1MA 4A2UA 2QENA 5FFZA 4K6MA 5CCBA 3HTSB 2G70A 4U7TB 4HRAA 1XDSA 4OMZA 3UJBA 4A6EA 1R18A 2BZGA 3LCCA 2ZXJA 2HTJA 4FHTA 3MQ0A 1HW2A 1Z9CA 4EJTA 3ZPLA 3M8FA 3TRKA 4GO1A 1BKYA 4LFUA 3BJ6A 2MLKA 5E18F 3HVJA 3FXUA 5FFXA 2RV8A 1BC5A 2EFOA 5EKUA 3Q87B 2XVMA 2P3OA 2MC3A 1VP3A 2RDPA 2JH9A 3KQQA 2WTEA 1BI0A 2I62A 4FSDA 4RTOA 2I7CA 1XCLA 2O3FA 1J2XA 4CKBA 1J75A 3FX3A 4M7RA 2ETHA 4OA5A 3N4MA 3QRFF 10MHA 2WWYA 2BR5A 5DLYA 2NNYA 5HIJA 2K4BA 2DK5A 4YG2F 4B17A 5ILVA 1ON2A 3WU0A 3E6MA 3ZMZA 4EM2A 5K1YA 1HXDA 1BBYA 2F5CA 3IWZA 5BW5A 1BJAA 2CO5A 2NAZA 1SD5A 2P6TA 3I4PA 3RJPA 2LKPA 3KP3A 3DULA 4HAMA 2GA1A 3E6BA 3BGDA 4EM0B 1JQEA 2D45A 5FWDA 5DCMA 4HQEA 3HP7A 2IH5A 1O7FA 4UNOA 1YFHA 4MTDA 1EJ0A 5CYVA 3ME5A 3MAJA 4O29A 1KU7A 3GWZA 2YUIA 3TO6A 2FYTA 1TTYA 2IRFG 5LHGA 4V0QA 3TQNA 4LWOA 5E9WA 4HTFB 1FNNA 2DO7A 3WGGA 3IRRA 1I9GA 5L3EA 3T7SA 4L9JA 2ACJA 2PN6A 3AY0A 3P9NA 4CXMA 2D1VA 4KDRA 4L9NA 2AR0A 3P2IA 4MEYF 5E1WA 3WTXC 3TPZA 3GNLA 5ICFA 2MLGA 1GXPA 2HMYB 3KQOA 5D8LB 2GLUA 4HF1A 4MTLA 2PX5A 4ON0A 4ZYGA 4EKGA 1P6RA 1XGOA 3CUQB 2YSRA 3L9FA 5U4XA 5E1BA 2GS9A 3KFWX 1R1TA 1O3TA 2W25A 3MERA 4UXNA 2HKXA 5F1RA 2OZUA 3AAFA 3HRTA 1OKRA 2GA2A 5KK1A 3DMFA 3O31A 3DMGA 4M38A 2EX4A 5DSXA 4M9ZA 1FBNA 2CL5A 1OYYA 1ZLKA 1R23A 4WWCA 1Z91A 1XVAA 1RUNA 2MH9A 4DKJA 1EG2A 4PCQA 4RB0A 4ZZDA 1JTEA 4S05A 1B9NA 1HW1A 3R9XB 1ZGAA 4ESBA 3RKYA 2EFJA 1R5GA 1U78A 1WXXA 4Q4ZF 2W84A 3FYDA 3OU7A 2HOEA 3WGHA 3ECHA 1WG8A 3HRUA 2ADMA 3M9AA 1VQ1A 3HTXA 2NYXA 5E17F 1KYWA 2P5LC 4YFKF 4X61A 2EWNA 1L1EA 1RI3A 3I59B 1SG9A 4JBAA 1G3YA 8MHTA 3BOQA 5FD6A 3DTNA 1R58A 3QPHA 4G8XA 3KLOA 2O6GE 2ESRA 2NNNA 4LJZF 2CMHA 3GFMA 3EUHA 4CGZA 3NDIA 5CVUA 5EEHA 3Q9SA 4HTFA 2GZWA 1HMYA 2CYYA 4RB1A 5DEQA 3NJRA 1B1BA 3FXRA 3EVCA 3EDPA 1MJFA 4FSXA 1GVJA 3KPWA 3ELYA 4BHPA 5DX1A 4BLVA 2ZBKA 4KIFA 5HEKA 5F2KA 4GOLD 3V8LA 1FX7A 4QDKA 3GRZA 2AS0A 3LAJA 4Y17A 5CVIA 3CUQA 1TQPA 3DKWA 3HA7A 3KLNA 4O5VA 3ELKA 3K6RA 4BLWA 2KJBA 1Z7UA 3EGIA 4ENJA 3ABTA 4GBED 1CF7B 1AWCA 3LCVB 4P9UA 3PFGA 4ZZLA 1IY9A 2DAOA 3COAC 4AWXB 4RTQA 3EYIA 2CFXA 1LQ1A 2STWA 1T98A 3J80K 2IBSA 2EB7A 2XKPA 4A0ZA 4FGZA 2A6EF 5KYGA 1MJAA 2VZ9A 1YG2A 1VTNC 3VEPA 1W7PD 1IN8A 1ZG1A 4R6XA 1L9KA 3AWIA 4OIPF 5K0GA 2DPMA 3ORHA 2B78A 5EPEA 1VP9A 3DQVC 5DWQA 4HV6A 2IA2A 3IHTA 2EV5A 4QTTB 3WSTA 4GGGA 2Y75A 3ZMVA 5M5BA 4POOA 1SFEA 4GOMD 1ORHA 4ASNA 3RIRA 3OU6A 3I59A 3UJ7A 4PGGA 4NQWA 1EV7A 3EYYA 3HCDA 1NW8A 3SHFA 2A69F 1WRJA 2VT3A 4XCXA 4OIRF 5HDGA 1UB9A 4WVLA 1N2XA 2LSOA 3L09A 1YZHA 4E30A 5E1OA 2Z33A 3MQ2A 5DV5A 2L02A 2VBWA 1MKMA 3SM3A 4GYGA 2FMLA 2O0YA 4AIHA 2DBBA 1G38A 1AV6A 1E17A 2EA4A 4OQDA 2H6CA 5L3FA 3C18A 5LGUA 4BLUA 2YR2A 1D2GA 2PLYA 2FK8A 2RKHA 1L0OC 3RW9A 2AOXA 2JHCA 5FUBA 5HIIA 1V3FA 1UFMA 2NNWB 4HGYA 1P1BA 2JRTA 5A2QK 3HNRA 4KN7X 5H02A 1CF7A 1FBSA 3FWEA 2YQZA 4O3MA 2NP6A 2Y0MA 2ZCJA 2PFBA 3HOTA 4GC9A 3HCAA 2KJCA 1CGPA 1MDMB 2FK7A 2BH2A 4P7KA 2P7CB 3DV8A 2VODA 2XROA 3NWEA 2A14A 1YIOA 5D5VB 2CW0F 3LHDA 3CBGA 1F38A 3SZTA 1VL5A 3P8ZA 5FHRA 5HIMA 4CKEA 3C6KA 2CQKA 2Z6UA 1WQ2A 1O3SA 5CVRA 1XMAA 5JR3A 3OU2A 5ILUA 3M6UA 1KQ0A 1SFXA 3BWYA 3BWMA 1P92A 1M6EX 2FE3A 2ZIFA 4MHTA 3LA3A 3P9CA 2HQNA 1IRFA 2UZKA 1LNWA 5E20A 2PBFA 3PFIA 2P8JA 4HA8A 4UVCA 3F8NA 4HV5A 3UJAA 2PWPA 2VE9A 2G9WA 3FZVA 3GO5A 3PVCA 3HVHA 3ZP5A 2P4WA 3HIFA 3HCCA 4Q47A 4WK8F 3LBYA 4PYOA 2O8XA 5J8CA 3TM4A 3SFZA 1J0RA 4HQMA 3GZ6A 3GX4X 2YX1A 3E3VA 1DP7P 4HYEA 4R8SA 1DUSA 1H9TA 1I4WA 2AXLA 3UJ8A 3OE4A 4CHUA 3BZ6A 5LQNA 1WSUA 3GCZA 2P5KA 4CDGA 2ISZA 2C7OA 2VBYA 2VXZA 5BOXA 2VT2A 1PP8F 2ZVJA 3R0QA 4QLCU 4PZJA 2P41A 5EHIA 3VC1A 4G6QA 3ABUA 2L4MA 2DU9A 2HWKA 2VBZA 2FQ3A 3K69A 3MB5A 3W6JB 3IYLW 3M7GA 4ZYDA 2E7XA 1MHTA 1U8RA 3QPTA 2QQAA 3WE3A 3ANXA 4O6JA 1TW2A 2AN3A 1QGPA 1R7JA 3RPQA 4CICA 3VSEA 2PY6A 3A7DA 1XSVA 3V4GA 4RGSA 1U3EM 5FCDA 2HTEA 4ER3A 3G89A 5LQRA 1USTA 2XASA 3LA2A 5DM4A 3CTAA 3FPGA 4GQBA 5LEJA 3TKYA 1BC7C 3T7RA 2EV0A 3KR2A 2EFWA 2P7VB 3GVAA 3WG9A 2IH2A 3E8SA 3EMDA 3CVOA 2H00A 2ERCA 2JT1A 4UVAA 1SAXA 1JR4A 3JWIA 2BBYA 2ZO4A 3UA4A 5F64A 4WXCA 1DCTA 2VDVE 4KFCA 3GGDA 4GC5A 1BC8C 3L7WA 3IL2A 4XSXF 3IKVA 2Q2EA 5HFJA 1IUYA 5FWAA 2YX7A 1NBHA 2Z6QA 2Y1WA 2ZIGA 3BPXA 2R6ZA 3RYRA 2DLLA 3ERED 1NKVA 4AD9A 4GUAA 1RJFA 2YXEA 3TDZC 2ZULA 2G1PA 3LDUA 5EG5A 4BP1A 5FB2A 1ZH5A 4I98B 3KQYA 4OBWA 5D4RA 2B0LA 3LPMA 2C6YA 3KP6A 4I0BA 5CVJA 2FEZA 2JJQA 1ZG5A 3LCUA 3LKDA 1HNNA 1G3SA 3GFIA 2DQRA 4LWPA 5CJ9A 1U5TC 2DPUA 2PI0A 4KNYA 3GLXA 1NW5A 4G94A 1KQ8A 3MFKA 3A25A 2A6HF 3L2CA 4WXHA 2HWVA 3F72A 3QU3A 3K9TA 2VDUE 5FLXK 5KQRA 2PEXA 5LGTA 4U0YA 1XXLA 5G02A 1RI5A 5HLHA 5IT9Z 5GOZA 1R6AA 3E7PA 1ZHFA 2BYVE 4B8XA 2A61A 4G7ZF 1B42A 4PYMA 4RGXA 1ZRFA 3Q5FA 3HRSA 2OPBA 2FOKA 3M8EA 3BKWA 1ZLJA 5TJJA 3ULQB 2L3DA 4IKPA 4S04A 3NVKI 1IM8A 3UFBA 1G3TA 4RGUA 3ELUA 4C03A 4RWZA 3BXOA 4WCGA 2QQ9A 5JVTA 5HZMA 3C3WA 2LF8A 1BI3A 3DPLC 2OQGA 2HEOA 4X41A 4I02A 3KETA 4BP3A 2YU3A 3CKKA 3ZN1A 4EK9A 3U2RA 5T6BA 4ER7A 1WKMA 5DCMB 1ZREA 4KRGA 3F8CA 5D8KB 1REPC 5FADA 2IW5A 3SX0A 1IN7A 4QVGA 2UZ4A 4R1HA 4BQAA 5F6FA 3HEMA 3TFWA 2GPYA 4ETSA 3PFHA 2HDCA 1TNTA 3L8DA 2FNPA 4IJAA 1S7AA 3P7NA 2O03A 1RJGA 1ZYRF 3JAMZ 1T38A 3I53A 3LA7A 2RC4A 1R8XA 1XN7A 3G88A 5EMLA 4P55A 5K0LA 4IHTA 3D5LA 4YV2A 3JW4A 2RGVA 2O57A 4CYDA 4L18B 4PIPA 4WF2A 1D2HA 1XGSA 1PRYA 1QAMA 3R24A 3L00A 5EQJB 5K5OA 1LB2A 5P8WA 3KHKA 1TBXA 2ZBQA 2M30A 3CC8A 4P58A 1IF1A 4N9IA 5HDNA 3G2QA 1FPQA 4AZVA 3T0IA 4IWNA 1LEBA 3PX2A 1KU9A 1NBIA 1X1CA 1F3LA 2QM3A 4I09A 5L3CA 2QWWA 4XLPF 4X60A 4YUVA 3SXJA 1IN6A 4EGZA 2HZTA 3EPPA 4IRIA 2AZTA 5K8VA 4L5JA 3ZMDA 2ZNYA 2OZVA 5D1HA 2XGXA 5HLGA 4I0AA 3CO7C 3RIEA 2PG4A 2BR3A 1FY7A 2AN5A 4E2WA 3V7SA 3EGEA 1BM9A 1EAMA 4PYLA 2P3LA 3G8BA 4GEKA 1NW3A 3B3GA 5DDGA 3KU1A 4QPNA 3REOA 5GM1A 3FTFA 3MWMA 5D5WB 5HIKA 2H09A 3FHZA 2EK5A 2H94A 4JXJA 4IPAA 4BHBA 1USSA 2QY6A 3U9GA 1BOAA 4MTEA 3MHTA 3WTVC 3I64A 4C05A 5LQAA 5FULA 3MTIA 3IC7A 1T6SA 2HR1A 4PINA 1IXKA 3E23A 3P9KA 2FXAA 4RVFA 3Q9VA 2KIUA 4WXDA 4HDUA 3FZGA 3SR4A 3F6OA 2JHAA 1EH7A 5E1DA 2L4AA 4UUVA 2KW5A 3THSA 2Q41A 1MD0A 4L0YB 3HCBA 3OOPA 1J9IA 1SUSA 3B3FA 1JXSA 2Q8KA 2OQRA 2PXCA 2VN2A 3MCZA 4RVHA 4FX0A 5DSTA 3EVEA 4BY9E 4YUYA 3FF5A 3OZTA 3NVMB 4E2XA 3GIWA 3DOUA 3HTUA 5K0NA 2IBTA 3I9FA 2O07A 2ZWVA 1JE8A 1SVUA 2QVOA 5KS2A 2M87A 2X0LA 3TO9A 1OYIA 2OD5A 2E5WA 1LDJA 3VFZA 4FX4A 2RQPA 5MHTA 4RS8A 2ZNZA 1I1GA 4GF5A 3WTSC 2BGCA 2FSWA 4XRFA 3SMQA 2OB1A 3O6BB 1FYLA 7MHTA 3J81Z 5GWXA 4CKCA 1SD6A 4IF4A 4KIGA 1L3IA 3GYHX 3EEYA 5JUWA 3P97A 4HSGA 4HZFA 3CUOA 4Y2HA 3GFJA 5B1SA 1SMYF 3JWHA 3P71T 1ON1A 4R79A 4N9HA 1YFJA 2OZ6A 5AONA 3E97A 5GINE 2D1HA 2DW4A 4N0BA 2STTA 3CGGA 5ICCA 1UIRA 1OR7A 3RDIA 4DNCA 1FBUA 2A5YB 2ZKZA 2IPQX 2XIGA 2V79A 2PX4A 3KQVA 2CGPA 4C04A 4DM3A 5CVEA 1TNSA 5K0BA 4PYQA 3TR6A 4RTRA 2PLWA 3BZBA 3KKZA 1OYWA 3BP8A 2WA2A 4B09A 1S6LA 4KMFA 4U7DA 2D2WA 4CWAA 2E1NA 2HYGD 2P40A 3FYCA 4KDPA 2XAGA 1RJDA 5TRDA 5LR6A 5FGMA 1X3UA 1IXCA 1NE2A 3DEUA 1G60A 2LD4A 3OFJA 5DM2A 4RYLA 1XDUA 1YB2A 2K4JA 1MJ9A 4LLNA 1R36A 3E05A 2RNJA 3GRYA 2DTRA 3SXYA 1HSJA 3E5QA 4HLYA 1YUBA 2EJUA 1YYVA 3VODA 3LL7A 2PWYA 5H6QA 1ZRCA 4PGHA 2HTSA 1SUIA 2FA5A 3K1PA 1R8YA 3LDGA 2PKWA 2ZMEB 4M6XA 4R05A 3SSOA 2ZBPA 1SQGA 5BP7A 3G3ZA 3PTAA 4KWCA 4E32A 1W5TA 2ONZA 2XYRA 1W5SA 1AOYA 4LD5A 2C7PA 1EIZA 1RI7A 2GB4A 3BY6A 4IVNA 4HDVA 1G8AA 1B59A 4FR0A 3OFKA 1FP1D 1B4AA 2FF4A 2OU2A 3CJNA 2ELHA 5EGSA 4PCAA 2AVNA 2WV0A 2FCAA 1INLA 4GYIA 3M6VA 3HOSA 4FZVA 2XBMA 3G2PA 4AUKA 3TGNA 3R60A 5GIOE 5LRRA 2ESNA 3GRUA 5DD8A 2V7EA 4BXUA 3WU1B 3TOSA 3E6DA 3FPFA 2CG4A 4JK1X 1NHAA 4RVGA 3B89A 4M74A 1ZG3A 3NMUF 4M9SA 5E8IA 3WGIA 1IXRC 3FPEA 2Z9OA 2FBHA 1SKMA 2P35A 4KIBA 2AOVA 2JHPA 1Z05A 2B3TA 3FPHA 3HCEA 5DXJA 2EA2A 5LLQA 4DCMA 1Y0UA 3ECOA 5E8RA 2FPOA 3IRQA 3FTCA 1F9NA 2FNAA 2V9VA 5C9ZA 2JSCA 1IN5A 2VDWA 9MHTA 5GP1A 3WODF 2V1DA 5HDKA 3ELDA 3HSFA 2DI3A 2R7FA 2UWMA 2IFTA 2OXTA 5DM1A 4F84A 2G7UA 2AOTB 1YF3A 1ZQ9A 3F22A 2B25A 2Z99A 1MZBA 3NEUA 4A0XA 2UYHA 1QQIA 2YXLA 3O2PE 3QOXA 4F86A 2QUFA 3WTZA 1FSHA 3FM5A 2ZMEA 5DM0A 3MTEA 5DTMA 3MGGA 5EMJA 3TO7A 3F4KA 1KPGA 2GXGA 1VBFA 1RNLA 2K02A 1EH6A 1RUOA 2VBXA 1J59A 2AOWA 3A4TA 3DMHA 4X63A 3RODA 2YPRA 4OIQF 2GH1A 4EV0A 4U7PB 2KIMA 1IRGA 4E2ZA 4A5NA 2ZCWA 4P7JA 3PLAE 2I9KA 2UXXA 5ERGB 4LG1A 1P4WA 5IH3A 5LQCA 4KW7A 5H6RA 4L5IA 1NV9A 5E8GA 4ZTBA 2VS1A 5EEGA 1QBJA 2ZW9A 5DT2A 2AVDA 4CTJA 2NXJA 2VOPA 3PX3A 1LJ9A 4YIFA 3A26A 1PJZA 2P8TA 1JHHA 2H6BA 3FTDA 2O05A 3F8BA 1HBXG 1YW9A 2ZIEA 2V6CA 4MQ4A 2TDXA 3K0BA 1Y8CA 4OA8A 2FU4A 1T43A 1DPRA 3DLCA 1LDKB 2RVCA 5CM2Z 3ZN0A 1PDNC 2HFHA 3BKXA 4BNCA 2XAJA 3IKTA 3MZYA 3AXTA 5E1MA 1K78A 3A7EA 3OV8A 2VC0A 5EVJA 3KEOA 3WTYC 1L3CA 2IPXA 3WTUC 5C0OE 1TLHB 1XD7A 1BIBA 2WA1A 4FT2A 1EH8A 1KIAA 3OZRA 1R1VA 2NXNA 4HW0A 4A0YA 3MAGA 5CD1A 3Q7EA 2AOTA 3VC2A 1O9HA 4KT5C 3BT7A 4RVDA 4HG2A 3R6SA 2QQBA 1FP2A 4YFXF 2IT0A 1Z6TA 2VE8A 3G2OA 3LDFA 3QP5A 5LQKA 4GCVA 4A6DA 2B2CA 2XAQA 4RGRA 4PYJA 1B6AA 3HSEA 3UBTA 4UVBA 1T39A 3K2ZA 4C08A 2R3SA 5ED4A 2YTZA 2PJDA 2V1XA 2DPDA 1RI2A 4PONA 4PDKA 3X0DA 2FRXA 4BHCA 1D2CA 1ZKDA 4HC4A 1FYMA 5ICGA 4H0EA 4I2OA 2N47A 4DCGA 3BJOA 1JG1A 2OAZA 1T0FA 2AOUA 1TQMA 3FMQA 5K05A 1J5YA 2QRVB 3ELWA 1JSZA 3ER8A 1ZN2A 4XUCA 2ESHA 5HILA 1XGNA 3NQOA 4U0VA 5E2BA 3KPYA 3QOWA 3UJCA 1U5TB 4BH9A 3B73A 3KE2A 2E7WA 2EFPA 1TQIA 4HX4A 2H1RA 1BI2A 2F8LA 3RTRA 2P7IA 5HS9A 1R1UA 1F4KA 1T2KA 3R4KA 4ATNA 2K7LA 3HHHA 2MA3A 1YTYA 1P91A 5IKMA 2W24A 1KGSA 1YFLA 2GWRA 3ISPA 1QANA 2HNKA 4XLNF 4ESFA 3AXSA 4V0RA 5DXAA 3HA5A 4IRHA 4MIKA 3EGVA 1RI4A 1I1SA 1N7JA 2KRFA 1P4AA 5D5UB 1X1DA 2RN7A 4L7VA 4CZZA 2EFQA 3GW2A 3GZ5A 5LHIA 1BHJA 3SQNA 2FRHA 1SFUA 1E2XA 4RAZA 1WZNA 2K27A 3O4FA 1YZ3A 4KDCA 1RI1A 1AQJA 2IP2A 4FP9A 2JH8A 1KR5A 1XMKA 5K5RA 4ZH4F 1O3RA 1NW7A 3B7PA 3GO4A 4E33A 2H27A 1ODDA 1UCRA 3JSOA 2QZ8A 1HKTA 3DLIA 3FUWA 5DD4A 1QAOA 2F5DA 2GQQA 2L54A 4KVZA 4AZSA 2GA9A 4HBLA 1H0MA 2UYQA 5CIYA 1D8JA 3DPTA 2NRAC 3B02A 5K01A 1BI1A 2M5WA 4AZTA 2XUBA 3HRMA 4EM1A 2KKOA 4HF2A 2Z3YA 3JTGA 3DH0A 4LK0F 3LQRA 3M6XA 1G3WA 3FMSA 1L3BA 2QRVA 1SD4A 3BUSA 2X4HA 2ZLBA 1LDDA 4OMYA 3CO6C 4Z2YA 5CUQA 2GXBA 3PQKA 4DMGA 5BMZA 5F2NA 1U5TA 5JHUA 1GHCA 4AVPA 5E2AA 2PBIA 4G7OF 4A5MA 2OY0A 1YW7A 3R6TA 5DPMA 3WTWC 4CXFA 2QBYB 2AN4A 3KZYA 3RYPA 4QQNA 2W85A 2FBIA 2XAFA 3KP7A 5EKXA 1I27A 1NT2A 1JSXA 1MGTA 3TOAA 1KXZA 3MEXA 1J7KA 4G6DA 1JGSA 2P3QA 3C6MA 3RKWA
chains in the Genus database with same CATH superfamily
5AIPA 2QSUA 5KQSA 4BV2A 4XOTA 3EHEA 2YJ4A 4CF7A 3CMYA 1N6HA 1XCVA 3PLRA 3D5RC 4Y0AA 2CFCA 5BV1A 3ZY3A 5DTQA 1P5RA 1B3RA 2QTGA 1SK9A 3O3NB 3R9WA 4V02A 3AVQA 5BMVB 2LF7A 3VH1A 4PGMA 3A05A 1WEHA 4F2DA 1XROA 5K6TA 4UDNA 4AX4A 4P3XA 4OINF 1ISRA 3L1IA 2NVBA 4R5HA 2H57A 4DGQA 3OX1A 3KNZA 2ZZMA 3FB4A 3TSZA 2JZYA 4GKBA 2JA6J 2CE7A 3DZBA 3NYIA 1J0CA 2HOAA 3S2DJ 4Q5SF 1O9GA 5DI3B 4WOPA 2RGWA 3RJZA 2CFRA 3MINA 1R0SA 1A9PA 3L92A 2YWJA 1DQNA 4P9FA 1A8PA 1CYDA 5A5DA 1O0BA 4MHGA 2ZR8A 3QVKA 1ULBA 2ZUTA 2OLKA 4LRQA 3L2VA 1NW6A 3AZPA 4OHBA 4URYR 1FTWA 4XLLA 4NECA 3DEEA 2GZAA 4OOIA 2OE2A 3JTEA 3VHLB 2LBPA 2LY2A 2ZZKA 4UM5A 1FY2A 5BYAA 2O8FB 3FFBA 2QG6A 4RA2A 5IJ9B 4MV8A 2DB3A 4TYWA 1WF3A 5CIQA 3QMMA 1TM4E 2XMGA 3MCTA 1KGDA 1PFQA 4N0EA 1CUWA 3WHIA 5DNUA 5HJ5A 2EFNA 3JD0A 3CJTB 3HA3A 4YEDA 3W8FA 2C96A 1Z83A 2R8BA 4EYQA 1Z73A 3E9YA 4ND7A 1FYXA 2ZSHA 3PC8A 4XPIB 1W4MA 2UAGA 4ZREA 3H3UA 4M72A 2AD1A 1W1WE 2VONA 4XYGA 1GPKA 4GBGA 4ZJUA 3V7RA 4YT8A 3ZQHA 3ERCA 1V48A 4G85A 3IMCA 3AB3A 2ODPA 3IWFA 3QXHA 1OKKA 1K2WA 2SHKA 3ER9A 3CP8A 2ZTHA 3ZH9B 5BUZA 3V2IA 3HACA 2BXYA 1FXUA 3EZNA 5CHYA 4OU0A 1A9SA 1IIBA 3K9HA 5AKYA 2MD5A 1GNLA 1G5IA 2LRDA 1JJVA 2OAQ1 2GEVA 2RHLA 5FBWB 2XCOA 3DBVO 4ZEWA 1EFVA 4BWGA 4YB8A 5EXEA 3E8MA 4HOBA 2GCPA 4F6LA 4DBQA 5KHOC 4D42A 1RP7A 1PNTA 5CM8B 1SBNE 3NRVA 2YY7A 2AMFA 5FP0A 3TW8B 1J9EA 2VDQB 3MWYW 2HHAA 3V7CA 1PDOA 4ARVA 3OZVA 1LRLA 3RUCA 1YVUA 3NR2A 2V9CA 1E1NA 4MHSA 3B8HA 2B9SA 4AMBA 2WSIA 4K2EA 3U5ZB 2DLDA 1YB5A 1GGFA 2PMHA 2AZ4A 3L49A 1J1ZA 1CDZA 3B1XA 1WXHA 1I3AA 2Z8XA 2GRJA 2AKYA 1G55A 1F8XA 3O9MA 4MO9A 4M87A 1NVEA 1CRQA 3TSCA 3N87A 4O8CA 3P32A 4XSGA 2NZVG 2FUG1 3ENZA 1WXGA 4S0HB 1H2RS 3PHIA 6REQB 4XYBA 3AO0B 4OQLA 4KQ2A 2H9YA 3DCIA 2JIRA 4FDTA 4FW9A 3Q1LA 3LAPA 5HF6A 2J7PA 3VKVA 4BYYA 1T5HX 3K32A 2COBA 3KQKA 1IQRA 1DTWB 1PW7A 5CX1A 4ZPXA 2HIAA 1XPUA 2BI4A 2C57A 1WXIA 1UJBA 5CLIA 1CIJA 3DMRA 2XMZA 4IOMA 2BDUA 3BG3A 4JT4A 3ONWA 2XBLA 4W9MC 1VIAA 3FSGA 3W6VA 5J6XA 3UJPA 2XCIA 4KAXA 3N53A 4ZCQA 3JYPA 3RYFB 3KEQA 3A1CA 1U9IA 3CVVA 4XQFA 4V0LA 3U39A 4Y30A 2DOEA 5CNMA 2JAXA 3AHCA 1Z35A 2MSNA 1PWEA 3HWRA 2HMSA 2O59A 4JI0B 2H1HA 1UZLA 4HEA6 1ISSA 4DMCA 3TTTA 3E58A 3WWEA 3U0VA 4A6PA 4RABA 1Q0ZA 2QD5A 2J0UB 3DLTA 4QVKA 2PA0A 1I0LA 1E0JA 1JKJB 3H35A 3Q8KA 3MJEA 5JXIA 1UMKA 3ET4A 5LPNA 1DGWY 3QKTA 1G5FA 4W7HA 2R5YA 2QXTA 2XWBF 2ENUA 4TL6A 4UEJA 3QKIA 3IGFA 2R7QA 4HO1X 2IIPA 4KI0A 1GITA 1M6NA 4ABTA 1LNQA 3CG0A 3OX2A 2WUWE 3T3IA 3OH8A 4M7WA 3FOAA 3QLTA 4C22A 4WW0A 5AWFC 3DXXA 3HV0A 2VZLA 1QU3A 4GI7A 2HIMA 1NASA 1II8B 2W6NA 1NPYA 1RPNA 1FRFS 3A9SA 1K1EA 5DNEA 1CQTA 1YS1X 3R5HA 2IYAA 5EP3A 4M3EA 3C24A 4XFKA 5FO5A 2ZSAA 1Q11A 4JQFA 2DA6A 2WWWA 1U0RA 3KWJA 4XQCA 2NZUG 1QLJA 1OH8A 2UYOA 1Z3CA 1Q7RA 1IUFA 3P9XA 4MAFA 5LDDC 4DJFC 3VR2D 2P4EA 4JHLA 3MZHA 4Z3OA 3TXAA 4L73A 2EGHA 3ZNPA 3IT0A 2AO9A 4XB2A 4C06A 3MWDA 4MRVA 3IAAA 2TMGA 4WT7A 3HDQA 4CLHA 3B2QA 2P5VA 1VKZA 1NUHA 4IUYA 5C4JJ 3EXHC 3HB0A 2D5LA 2Y99A 4J43A 1D5CA 3KV1A 3WTBA 3M6MD 3PJRA 3IP8A 1T0JB 1G4HA 3AEZA 2OM2A 2J31A 3B20A 2MLKA 3L77A 5B7PA 1Y1RA 1EX1A 5C3EJ 3K4QA 5DHQA 3KQQA 3RSQA 2HCTA 2I7CA 3D31A 1XCLA 3SU8A 1E9VA 3GH1A 1AJEA 3CVYA 3NWSA 2OAP1 1TVKB 4B17A 1D1TA 1F2UA 4B4UA 3DV0A 5K1YA 4X6AJ 3IWZA 4MMZB 1TUGA 5AKEA 4AKSA 2AGVA 2I2DA 5FPHA 1BCSA 8AT1A 3BQNB 2PV7A 4DVGA 1ADYA 2BY0A 3FJ1A 5JS7A 3UKOA 1KU7A 3HM5A 3GYGA 2XRYA 1G9TA 4DUYB 3KOUA 3OJFA 3N8DA 3TQNA 3LY9A 1FNNA 2DO7A 1NUPA 2WWTA 2WT9A 3AJ9A 1PL7A 4KDRA 4L9NA 1PSZA 1F48A 4QAQA 2VUSA 5KHDA 2RC5A 4WOKA 5AKLA 1SR8A 1MZPA 3PUXA 1NFQA 2QSYA 5AXCA 4D0NA 2ECCA 4X6UA 3L9FA 4CLDA 5E1BA 4LNHA 3WK5A 3KD2A 2GD6A 5ESWA 3CNLA 4XR4A 3MERA 3F6RA 5F1RA 4GPAA 4E08A 3KJXA 5E3NA 2EX4A 3V9PA 4HDSB 3BE4A 3BRSA 1OROA 2VNAA 2OC4A 3SE7A 4OUDB 2PGDA 1TQ2A 2ADMA 1U11A 4EEXA 3DTYA 2X6TA 2EWNA 1QMPA 3IV5A 3I59B 1SG9A 4GM4A 1SUAA 1XAJA 4JLWA 3GFMA 3DTVA 2VBCA 3IRVA 5EESA 5ALEA 4Y2YA 3UR3C 3MMXA 2GN2A 2VP9A 4ZU6X 5K8JB 2H85A 3VXKA 2MGQA 3ELYA 2HLDA 4OFBA 2YZMA 4WKOA 4MV0A 3P4XA 3TL3A 2AS0A 3LAJA 4AJNA 1K27A 3NBUA 3DKWA 4AJOA 5CB4A 3S32A 4RQBA 4BLWA 1TKAA 2HCRA 3EGIA 4EB6A 1SVOA 5IUNC 1IY9A 1IJBA 1M3SA 3GPBA 1Z6GA 2WTNA 1JFTA 4XNFA 4NATA 4RQTA 2K2WA 3WKDA 3LT2A 5KYGA 3CXRA 2M1XA 4Z5XA 1YG2A 3CH7A 3Q3GE 4C0WA 1ZD4A 1ZK1A 5DWQA 3PDJA 2H48A 3L7LA 2R4TA 1M2EA 3PO2J 1TADA 4UB8C 2FEXA 3H2YA 4OGGA 5CT8A 5F23A 3SHFA 3ESAA 1ULHA 4KXVA 4ZQBA 5ELMA 1L4EA 3VR5A 3BZKA 4DYQA 1MLDA 1G3RA 1WX1A 4OLJA 3S44A 2IYYA 3EY9A 3CZRA 3GK3A 4OG2A 1XA3A 1I4DD 4J1QA 5A2QA 1NJ5A 5KX5A 1UFMA 1AHDP 1V7CA 2M9MA 5ALLA 1ETWA 3ZOBA 3SHWA 3P27A 3CPSA 1KFEB 2UXCB 1WVRA 1E0DA 3TUIC 3KJNA 1WB4A 2AJLI 5FPSA 5C8ZA 4LOKA 2HQAA 1ODTC 4XGKA 3AIIA 2VDMB 5SICE 2F6CA 3SP1A 3R0IA 4D81A 3TM4A 4XIGS 2ONJA 5DM6F 2DFDA 4YMSA 2YX1A 3MWJA 3JXEA 4IGAA 4BU1A 3GBGA 1CFZA 4LJYA 2GAAA 1YCDA 4BP8A 1MCZA 5JPDA 3ZU2A 1T0FC 4BUPA 4MDFA 1ND5A 1HKHA 1AXRA 5JAIA 3K69A 4YVFA 1CZUA 2GOXB 1Y4ZA 3IEPA 1MVOA 4CH7A 1NNUA 3K6KA 4MRAA 1ZBDA 4EJ6A 1UDCA 1QDLB 3OEHD 3CP2A 4AUNA 1XSVA 1Z6QA 3T1QA 4WADA 2LP4Y 2HTEA 3RC7A 3EIFA 1I5RA 4UMFA 1Z0SA 4L1KA 1BC7C 1U4NA 2JT1A 2CMFA 4M4SA 4BYMA 2BZTA 5CAEA 2FG6C 4HCJA 2X76A 3BTLA 1ZS9A 1POGA 2JAUA 2FJ1A 2RNGA 5H3HA 3WGOA 4MI1A 4GUAA 1SB8A 1PBNA 3TDZC 4ALKA 3K9CA 2F1HA 3HKEA 2GJ4A 2W22A 2DY0A 4FI3F 1CUGA 3HEFA 3REFA 4BZWA 1K4MA 4OSEA 1KVRA 1ZG5A 2RGUA 1G98A 2FY8A 2OZLB 1FFSA 1M6WA 4WXHA 1SVWA 3EGCA 1LPSA 1NQWA 3PPVA 3L02A 2Z2XA 3S55A 2VF7A 2XA2A 5TJJA 4JJIA 3NHZA 2XUDA 1IM8A 2GZDA 2G1AA 1GU0A 5K7FA 4WCGA 4MUMA 3R44A 3QEOA 3C3WA 4HX5A 2A30A 1K5HA 1NLYA 4MR8B 3E2PA 3ZN1A 3RLIA 2G4CA 4JBIA 1OAOA 1JI0A 1HG0A 1NVAA 1JLLA 3BSSA 4ANJA 1N2IA 4E1AA 4WN3A 2Y0EA 1O87A 4NU6A 1G6OA 4IJAA 4HAIA 3WNVA 4Q7MB 4A69C 1YL5A 1GAQA 3I53A 3PU6A 4PO3X 1Z5OA 3PUHA 1N4DA 2ANCA 5AW9A 3LX4A 4ND8A 4B4DA 2RB5A 3MJCA 3LLSA 4MQEA 5DK4A 1XAIA 2OK8A 5GZ1A 1EFUA 1KXJA 1V5GA 4P58A 3VR5H 2ME6A 3A3OA 1OI2A 1ARZA 5CU7A 3CW9A 4OHYA 3R74A 3PHGA 3DL7A 2DR3A 1AE1A 3JQ8A 2EK5A 2GNPA 2HREA 2N3ZA 1G21B 4MTEA 1SHLA 5F2EA 2ZB2A 4Q4JB 3BJEA 3P9KA 4KQMA 1DC8A 4KNVA 4I50A 1F7VA 3FLEA 5JADA 1J5PA 3KKKA 3CDIA 4H31A 1T1RA 2P4UA 2VYCA 3WQRA 3EE6A 3LSHA 3THXA 2J8ZA 2BTOA 4BNNA 3LE8A 1QQ6A 1YHNA 3FF5A 1XEAA 1RPZA 3DOUA 2BFFA 3FAZA 1P73A 1C0KA 1N2BA 5JXJA 4K88A 4F52A 2M4GA 3VFZA 2G6BA 2RQPA 4J16A 3SI7A 5TDHA 5EXDA 1BROA 4J1NA 3PENA 2BGCA 3M5CA 3HHPA 2WAYA 4X0GA 4UEOA 1XXHA 5JO9A 4KIGA 4OOEA 1WQ4A 2XWSA 3EOBI 1QCDA 1D6JA 4HZFA 5DP1A 1BOFA 2HQBA 1BW9B 5GINE 3IVCA 2OILA 2OBXA 2DEUA 3VRHA 1ETOA 3A9RA 4GD3Q 4WCVA 4U8GA 3QWLA 3TR6A 2QN1A 1NGSA 2DH6A 2O8CA 2VXOA 4B09A 2YN0A 1YS2X 1C0PA 4R7TA 2CLFB 2IYQA 3FVRA 1TCVA 3NH6A 2OR3A 4IDAA 4ZV4A 3GRYA 3RVMA 4WESB 4JL5A 5EWJB 1UZUA 2HTSA 5JDCC 3RSGA 5AI5A 1GPAA 1S9DA 3DA8A 2KQRA 2ZM6B 2VHTA 4DILA 4G1EB 1SQGA 3HPQA 5AUNB 2XWQA 5EP2A 1W5TA 1FFHA 4HPJB 5LCXA 4Z4IA 2EP8A 2L7MP 5IYZA 4R2IA 2CSUA 3QG5A 2ZCUA 3D5EA 1EK2A 5ITZB 2VTBB 2XUKA 4DA9A 2IPMA 3TQTA 3ENQA 3G7NA 2AJDA 5EIOA 4O1HA 4GWGA 4B3XA 4M0KA 5KTPA 4BXUA 3ML1A 3PTZA 1W5CC 4LXIA 4DLKA 3HL2A 1HRDA 3WGIA 4F91B 4LTNA 1DIRA 1CRPA 5LL6P 2P35A 4XRSA 4YRNA 1RYHA 2Q1UA 2B8EA 5ALWA 2R7ZJ 1P18A 1XRQA 1HL7A 2E5FA 2G1UA 4Z0PA 1M6HA 2VDWA 2FDCA 4QGHA 3WJ1A 1K63A 3ZVKA 6ADHA 4FMCB 3QTLA 3D59A 4A0XA 1DMRA 2VQHA 1M2OB 3F6YA 2YV4A 3MJHA 2EEZA 1EVZA 1T5OA 3A4TA 3H99A 2EHJA 2P11A 3IJ5A 4J49A 1M72A 2GH1A 4IDFA 3T3MB 4XD2A 3NAZA 1AO0A 4X3OA 1PNOA 1QIEA 4H3VA 1NG1A 4I4CA 4DLNA 4YELA 2J09A 5LQCA 1KMCA 1NRWA 3VDXA 2ZW9A 4CQJA 5EJMA 1MBEA 1RM4A 2X1LA 1VCOA 1M34B 5CD9A 2H6BA 1LDEA 3MKLA 2GX6A 3FSEA 1JQAA 1V4VA 1IEXA 3D2AA 3GXBA 3C3JA 1S2IA 3R3ZA 4C2AA 1L3CA 1XUOA 2WW8A 3ZDCA 3C41J 1PSWA 3W5IA 2GCOB 4U0KA 4XVQA 3BN3A 4I3GA 2XOKD 3EIXA 5BNWA 2QQ0A 1ECCA 5K2MA 3M4ZA 1IU9A 2PSDA 4GCVA 1SZCA 1Q15A 4RGRA 2ZJYA 3K4BA 5EE3A 4QOSA 3ORRA 4PDKA 4BHCA 2BZSA 5REQB 1NMSA 1KRXA 5JQGB 2Q1WA 4DCGA 2OAZA 1P6UA 3RK0A 2XYHA 3C14C 1RXVA 3FMQA 2O5EA 3ER8A 1V16A 1RXEA 3KPYA 3KE2A 1WJ5A 4HXEB 2H1RA 1XLTC 3RTRA 4RAOA 5D86A 1JALA 3L0BA 2VHWA 1IOZA 2K7LA 3T8YA 4WACA 3V8QA 2FX3A 3DZ8A 2W24A 5J4YA 2GWRA 1O6CA 1SQSA 1L8XA 2F4OB 3WZ2A 2Z30A 4ITRC 2HNKA 1H2AS 3TQRA 3EGVA 4MKGA 1OW3B 1XZMA 3VZSA 4NI5A 2IEAA 1GQ2A 1N7JA 2PNJA 5HKLA 1JZTA 4RMJA 5EWLB 1F6BA 2WB1N 4NYJQ 2WJJA 1U9CA 3UUWA 4JU8A 3AUYA 1ZYUA 4MSUA 1B23P 2UUBB 1DJOA 2AFRA 1FPMA 3IOMA 4RFLA 5IBPA 2Y0PA 3D3EA 1A4UA 1HKTA 4IMRA 2JGJA 4FISA 3NBAA 1Y42X 4XEHA 4HBLA 4FJ1A 2QRVA 3IUSA 5FWXA 3A2KA 3FLAA 5IC5A 5JC1A 2D59A 4FVTA 4A5MA 1UKYA 5BQ5A 3KZYA 2HSGA 2PWBA 4ZO6A 1JGSA 2DSTA 1E9DA 1W2GA 4ZCPA 2FN4A 1WSDA 4TZTA 4QLBA 1WDTA 4EATA 3I05A 1NZDA 1AZWA 4ZT6A 4BO6A 2HYFA 2MDTA 2XRNA 1UHWA 4ND2A 2X8JA 2OLJA 1X1RA 2O2YA 4OLFA 1Z0IA 5PNTA 3GF2A 2I7DA 5MGNA 3INYA 3P4UA 1ZM3A 3DD5A 2I4NA 4LCJA 5IZCC 2PKQO 5C31A 4D9KA 4O4HF 2ZDQA 5E1ZB 3K05A 4J4HA 2ZJOA 4EJWA 2C7RA 4RXTA 4YDHB 5LUBA 2AFIE 3TXYA 2WICA 5AM1A 3TLMA 1XA4A 1NONA 5JNRA 1KEZA 1MH3A 1VPTA 1VXRA 4B47A 1H66A 4EQ6B 2KP6A 1FMWA 1P7VA 3N2YA 5E2IA 3HVIA 1GRQA 1H89C 3VR2A 2H5LA 1VIDA 3ZS8A 1SVSA 2J9XB 3I9V2 4QGGA 1PJLA 3JX9A 2EFHB 1EDOA 1KO4A 1U65A 3P9QA 3VDRA 1X1AA 4XFDA 1PZNA 1FJXA 3EMVA 3FMFA 4KO2S 4MQ5A 3GLFE 1STOA 1NN0A 2C1XA 4ML3A 4Q6WA 2XCSB 4MCIA 5AW6A 5K7ZA 3B85A 1DKOA 3M3YJ 1OCEA 1V96A 1UWCA 5CXQA 4LAFA 1F4VA 3T5MA 2WHYA 1BVUA 1OILA 2QRGA 4OBXA 1ULAA 4G4SO 5SZJA 2W37A 3D8RA 1FW8A 1QYRA 4BE0A 2WUGA 1P7JA 1Z2CA 1BMFD 1DHTA 1WTCA 2O2HA 2WJVA 4RHTA 5BSRA 3MD2A 2QD1A 3KK0A 4G84A 1QK3A 1TIPA 1HBJA 1ZZGA 3QP6A 3O8RA 5B66C 4MUNA 5F77A 5CDFE 1YRNB 3JQGA 3DONA 3T9BA 2UDPA 3ZZUA 1UC9A 3MS7A 1A71A 4DLWA 4QDUA 3EZGA 1WBJB 4RDIA 1QZ3A 3B3JA 1M2GA 1IZ9A 1UMDB 3VI4B 4KFTA 2ISCA 4MUEA 2OV7A 1ENOA 1AMNA 1DHRA 3PB3A 3C15C 2B20A 3STHA 3JYOA 1I33A 3PSIA 2IITA 3GQBB 2SKEA 2ZI4A 4C7OA 1ZN7A 2QQ5A 3ET5A 1Z33A 1TECE 4DPKA 3DG9A 5CLLA 3TP0A 1MG0A 4DARA 5IT9A 4E13A 3EVDA 4I1OA 3OPYA 1Z7EA 4KIUA 1X2NA 1KQOA 3LI2A 1V3UA 3M9WA 4XARA 1SCUB 1MC1A 2XCUA 2O1EA 5K8UA 4N0PA 5BXYA 2REQB 3G0IA 2NUTB 1KO8A 4TTSA 4RTNA 1ULTA 3HSRA 2YY5A 1G5RA 5I4KA 3CLRC 4E12A 4M8SA 2HBRA 3ETEA 4U9UA 1S5PA 4ZO4A 1KHTA 1V37A 3FPLA 4I4IA 4KA4A 3O8OB 1EX7A 4QM6A 3TZEA 1XN1A 4IDBA 2XODA 1VE3A 4G5FA 1VJTA 2G9VA 3NP9A 4TX1A 3C0KA 4JLUA 3IAFA 3IFSA 3WIEA 5K3EA 4HDQB 3K16A 1XMPA 4NENB 3KLBA 4TRJA 4N3CA 2O2GA 5DV9A 4R8HA 1HF3A 4FYVA 2Z9CA 2FAXA 1RIFA 4C0SA 2W6ID 3A6ZA 2AC4A 3E2IA 5DW3A 1GNTA 5K45A 3MT7A 4LJ9A 1YLFA 3ZIUA 4C9BA 4DIUA 4NOLA 3VYTB 2WUEA 1WVGA 1G6KA 3BYZA 3DVAA 3M4YA 4FFOA 3AVXA 5T67A 4PG7A 5IAJA 3UXMA 3RVBA 3THRA 2AEMA 1JQDA 2V8OA 5KYWA 3I56I 5M2QA 1RTKA 3RSOA 4XBFA 4ZIRA 1DL5A 4AMZA 4AYXA 2JIPA 1U7DA 2AW3A 1HQKA 3O03A 3FTEA 1JA0A 4P5EA 4DANA 2GCEA 3GROA 2C9CA 1H0HA 3UH1A 3LLCA 4BVFA 4DN6A 4IIHA 3C8DA 2QVZX 5HBRA 1PD1A 4N7MA 2QMOA 3A9WA 3ZQJA 3FFWA 3IJEB 4LJ7A 4WGGA 3IMGA 3PQJA 1IHPA 1Z5WA 1Q1HA 2Z2SB 2OHIA 3HRHA 2X5OA 4Y67A 2VDKB 4X64B 3OYCA 5L3GA 4NV3A 3B5EA 4MICA 2HGCA 5AW0A 3DUWA 2R60A 2H1LA 2H7YA 3C3PA 1EXMA 3VOAA 4F5WA 1I13A 2B3DA 4DSTA 2HHJA 1DEHA 1E2MA 2E89A 1ZGCA 2VRCD 3NHFA 1QIMA 4L8LA 2UXDB 2NOJB 1ACLA 1N2CB 1T2EA 2CNOA 2M45A 1HQCA 1XCJA 1QO0D 2CNDA 3RRNA 1T4CB 4A2CA 8GPBA 3O6VA 3LY7A 2BBWA 3VO9A 4H7FA 3FXQA 1U9JA 3COYA 1CJSA 3G0HA 2OVFA 4KWTA 4JP2A 3BTOA 3CJQB 3OC0A 3HWWA 2O52A 3M70A 2Z2KA 1XELA 2V58A 4KQKA 2HF2A 5FF9A 3V7WA 5GTHC 2P90A 5I9BA 3TLZA 4G56A 3PKIA 4PW0A 3WYGA 3ST7A 3JALA 2FP3A 3FHOA 4KRXA 3P5BA 3G4SI 1GVDA 1ENPA 1GZUA 1YDEA 4L8WB 3OEHA 5HW0A 2O14A 2FFQA 4GOKA 5ULLA 4X66B 4DIKA 4UV8A 4V38A 1I8TA 3EWSA 4RNDB 1XJ5A 1N6IA 4BO9A 4P4NA 1YGYA 3P2OA 4X20A 4NLLA 2IVMA 3WP1B 3U3JA 3AC0A 5AJZA 3BL8A 4E0BA 2G70A 5EWMB 4A6EA 2B4TO 1Z6ZA 5M34A 4BE1A 4FHTA 4ZRNA 1ISIA 4D98A 4UZSA 1YR2A 4EVSA 4FNAA 5FV4A 3AKYA 5ICSA 4B74A 3B7GA 4CMAA 1E2JA 1JHAA 1J6UA 4YJGB 3CR3C 2O3FA 3QELB 4A3DJ 4HNAB 4EZBA 5F1YA 3QRFF 4LZJA 2R8YA 2O0KA 1XNQB 4AMVA 2I3GA 3NDBB 3HFRA 1QIDA 4ETMA 3OKAA 4LIPD 2WU4A 4RZIA 2F5CA 3DHWC 3DT6A 3MD0A 1NP3A 2NV6A 2FSIA 5BV2P 1ZWLA 3IP6A 1DO0A 3M6IA 2HK7A 4PFOA 1JQEA 4D9GA 4QBIA 2VLIA 3OOJA 1YU9A 4QC2A 1FIPA 2G17A 1MO2A 1NP6A 1SVMA 2WF8A 1Z28A 4PC1A 3UWDA 1WSBA 5LHGA 3Q5GA 4R81A 5EN4A 4MLDA 4B3TB 2ACJA 4FYPA 4Q3OA 4J0KA 4EWLA 5BSTA 3LT5A 5AOVA 1OH5A 1BDHA 1CUIA 1JLKA 3SFTA 4ON0A 4EJMA 2JI4A 5JRDS 4Y3OA 2BJVA 1GN8A 1YKFA 1O5TA 1AF4A 4A3FJ 4QEKA 5JD4A 3SFVA 1MC8A 1UC8A 3WSVA 5HK8A 3OYMA 2XGCA 5KOIA 5EHZA 5HRAA 1M8FA 3D4LA 2FMUA 3HBNA 3IUJA 4AP5A 4BEJA 1R23A 1AN0A 4H3SA 1RUNA 3D7LA 4JP5A 4PCQA 1Q7BA 4L8YA 2DOFA 1ZUD1 5G3ZA 4ZDOA 3MELA 4UMDA 2AFVA 1Z4NA 1ZIPA 4JITA 1NYQA 4QGAA 1R58A 1PJSA 3M4JA 9LDTA 1IZ7A 2FW6A 4RD4A 2C2ZA 3OFVA 3SZRA 5E6RA 5JV5A 2DA7A 5EI5A 1Z29A 2FSSA 1EH5A 2CZQA 4P86A 4PBTA 2HBQA 4FBLA 4H3KB 5F2KA 1D04A 2FW8A 4W1UA 2I29A 4BFZA 3FWKA 2HAEA 2JKYA 1CF7B 3MMNA 9ANTA 1OTXA 3PZRA 3C3AA 4R1NA 5EE5B 3E22A 1KS2A 3EBPA 2VZ9A 4GP6A 1H42A 4LHEA 4CKEB 3A01B 2CUFA 4DXHA 3AWDA 4ZT3A 2HADA 4HV6A 3O4JA 1MW7A 4A3LJ 2C00A 3L01A 4GOMD 1K86A 4WNAB 1U8UA 2QN2A 3EYWA 3I3OA 1NW8A 3NBXX 1PT5A 5HFNA 3UJ3X 5EJ6A 3OZXA 2XXAB 3IOCA 1T8YA 3QPWA 4G89A 3L43A 1H2FA 3OPQA 5ISMA 4IAOA 5A02A 4OI1A 3V8BA 1G2HA 1EJ2A 1XVTA 1AV6A 2BBSA 5LB4A 1F43A 3KOOA 3IUNA 5BW6B 2EA4A 5LGUA 1IHUA 3F2VA 1HE4A 2BFEB 4C3UA 5CGZA 5FUBA 4DYCA 2WB2A 3HNRA 3I9V1 3D8NA 3GLRA 1X9HA 3WV5A 3I1JA 3JQ9C 4BTEA 2BH2A 3DV8A 4TMYA 2XROA 4NSNA 1FJGB 3M3HA 2PO7A 2HYIC 4ZHQB 1AZTA 2A6PA 4B87A 4LXHA 2F4IA 3LUFA 2QLTA 1TKBA 1O3SA 5TGDA 3GNQA 5JR3A 2RGNC 1D0XA 1TM7E 2Y67A 3HYRA 2PIDA 3KJQA 5JLWA 1BGWA 4X8LA 4BLPA 1Y4UA 1E1DA 1J2EA 3WLAA 2PBFA 4IJ5A 5FPYA 2I22A 3JPWA 4UY8I 2H29A 1VLZA 2XY4A 3HA2A 5EMNA 3HCCA 1ORTA 3JR3A 2PTHA 3E3VA 4L7QA 3VH2A 5HFAA 1EFRD 2FVXA 2XZOA 2ZU0C 4DOZA 2FN3A 1AHNA 4H7IA 2PH7A 1BYUA 2HWKA 4DIMA 3G23A 4DDVA 2KJQA 2G9NA 3KB6A 5IFLA 2L69A 3C7DB 5EJAA 3N75A 2VEOA 1Q7EA 1WH5A 2IXTA 4ID9A 1U04A 4XRRA 3E5HA 1AT1A 4IJQA 2Z6VA 1UJ2A 4JUDX 5SY9A 3ON5A 4RGSA 3KKMA 2XYGA 4F3KA 4AWBA 5M3FJ 1GZHB 3EXEB 3BIWA 2IH2A 4YAGA 4UVAA 2LDXA 4F9FA 1N34B 6YASA 1JGGA 4DY6A 3DFZA 4YGYA 5K6RA 1GFZA 4UCXA 3ROPA 3ERED 2PQ6A 1P1IA 1G5QA 4ZMRA 2ZULA 1YU6A 1V4BA 4RGBA 2XOKA 4FEAA 4I55A 2AJ8A 1X94A 4EYKA 1Y6FA 2VI6A 5JAHA 1EP9A 1QPGA 3AF4A 4L75A 2DQRA 4DRXA 3ASNH 3V48A 1XTTA 1KAEA 5KQRA 1KMIY 3OQPA 1AGRA 4WZBE 3WXMA 5G02A 4URXR 1XYYA 2JEYA 3E3OA 2BFWA 1ZHFA 1SVNA 4WHMA 1PL6A 3AESB 1OJ7A 3R7FA 2QX8A 3F97A 1IJKA 1U98A 4MV7A 4B4CA 4IVRA 2FDRA 1JW9B 2F7SA 4DCUA 1GLGA 3NDRA 3H0DA 1J0DA 4TROA 4X1YB 3K70C 1UMBB 4F96A 4C7VA 3B6IA 1RYDA 4Q39A 2C3MA 1DELA 1DAGA 2Y3IA 4KRGA 5EA2A 1KJJA 1GZSA 2PKXA 5BYKA 4ZZ1A 3AIOA 4YV7A 3WQBA 2YUTA 3AGPA 1ZLYA 1OBOA 3B1JA 5E7QA 2X14A 2BZ1A 4GYWA 3VMMA 1NDHA 3A6FA 1OGIA 5THQA 1YULA 4EG5A 4R40A 4K3UA 5KPJA 3R24A 2ISSD 1LB2A 1U63A 4MKXA 2PZ8A 2ZBQA 4LJ6A 4N9IA 1FDIA 4IWNA 4OL9A 1X1CA 4YRLA 2VP2A 4IIUA 4XI9A 2CLDX 2X13A 1J39A 2VAXA 1Y6JA 4NKRA 2WWVD 4JI2B 4RSHA 1EAMA 2K7FA 4ZCIA 5GM1A 4BQOA 1Z0JA 2H09A 2ZROA 3FDYA 1O95D 3WTVC 1XHLA 2RARA 3FWHA 3KB2A 4OUKX 4PR0A 3UMGA 4B3JA 3SYRA 4DMFA 2DWCA 2X3YA 3MG9A 1ACJA 1Z0XA 2OQVA 4JODA 2HK9A 4DMHA 1YJCA 4WZ6A 3W7VA 4S1TA 1EM6A 1O94D 3HE3A 7REQB 1IG3A 5AUOB 3MD9A 4RVHA 5DSTA 4REQB 2JARA 3V2GA 4BY9E 2JKVA 2EIJH 4AXBA 4E2XA 1GPYA 1NATA 3VVLA 4L72A 4K8OA 1OX6A 2O07A 4LOIA 4Y1RA 2OD5A 3RRZA 3VSBA 1ZMXA 2Q4BA 3HEBA 4YJ3A 1PL8A 3KXKA 1Q84A 1CEQA 1Z9BA 1JAIA 2WG1A 2WDZA 3GYHX 1WP9A 4G1MB 3QOYA 1C1XA 3SD7A 1I2ZA 2PCJA 4WD3A 4UPDA 4N9HA 3E97A 2D1HA 4OGKA 3O3MB 1XD9A 3ZOKA 4B3AA 1KR2A 5JARA 3AUFA 3VBCA 3LP5A 5KUTA 2WFLB 7YASA 4CWAA 3GEMA 2EBUA 3FYCA 4KDPA 1UP7A 3OFJA 2CHFA 4EB8A 1B7GO 1J4AA 2K85A 1R36A 2R751 3LL7A 4M21A 3TWOA 3VNRA 1DOZA 2KDOA 3KSUA 2KT0A 1FJHA 5JVDB 5CT9A 3LSMA 1W34A 2JFZA 1XZIA 1BMFA 1KI7A 1E98A 1EXVA 5FI5A 3CTPA 3PXXA 4FYMA 3HU5A 4YJ2F 1YZQA 1RFGE 4QAJA 4RDUA 4AUKA 2EW2A 3WU1B 1DWOA 2NQ8A 1MU0A 1Y6RA 3B89A 2A0WA 4NZNA 4O2BA 3UUGA 3UFXB 5KJ6A 2YOGA 2QL9A 1TC3C 3AFNA 2VXDA 1SCAA 3O0TA 5LLQA 1YC5A 3DM9B 2OGSA 5C9ZA 1IN5A 4GM1A 1OLUB 3VKGA 4JQOA 4HDRB 1P3DA 4US2R 1AXEA 2IFTA 5DM1A 1KRWA 1YF3A 5CK5A 2AG5A 3BZCA 3HXKA 1XTAA 1FSHA 2COEA 4EUEA 4FLEA 3CT6A 4OPMA 5D6OA 4HVTA 2ZCWA 2FOIA 2H31A 4FE7A 5B1BH 5D3QA 1EM8B 2O0HA 4ZYLA 1JYFA 1Z7BA 4DNQA 2IIQA 3GCXA 2ZIEA 3KYLA 2EZTA 3ABIA 4IHQA 1ZLXA 4FKBA 4JYKA 3JQDA 1LDKB 4B6RA 3ZN0A 2X2EA 4DSUA 4RC9A 3LSJA 1EP3B 3A7EA 3FGZA 3QXSA 1E9CA 2HMWA 1W88A 4EHKA 2OZKA 4WN9A 1R5JA 1EP1B 3CCUI 3EQ2A 1C7ZA 3QPVA 4CMEA 4A0YA 3SWWA 2YYYA 3R6SA 4UM9B 1GPBA 5KNDA 1N25A 1ZVQA 3ISTA 4WSOA 3SJUA 3JZFA 5JNWA 3PFKA 3QFRA 1HDZA 2AFHE 1YV9A 3LBIA 1B6SA 1FYMA 2EH3A 5ICGA 4BO4A 2HK8A 4DBLC 4FB5A 1JE1A 5KAIC 1KK2A 2ZAIA 2RK4A 2HWUA 5GOTA 2ZGVA 1AIPA 1U5TB 2W6IA 3QVOA 4OATA 1I14A 3LSYA 3ETJA 2WYVA 2Y1DA 1YS4A 2DBYA 2VI5A 5LUAA 1I1SA 5JW6A 2C2MA 4LBZA 1W47A 2EFQA 4R2XA 5JLAA 1LFAA 5JWHA 4HRXA 3TLGA 3QU5A 721PA 1SFUA 1R37A 2EIKH 1RI1A 1QRAA 4XIIA 3ZE9A 2PR2A 2B30A 4KO8A 4QBHA 2JIDA 2P0AA 4DLUA 1A4IA 3GJ0A 1N6LA 3FUWA 3CNNA 1Q74A 2F5DA 1ZESA 2L54A 4H6PA 5I8PA 3PPYA 2NRAC 3B02A 2GBLA 1EUZA 1FFBA 2J3JA 3I9JA 3RUDA 2UXBB 5IKXA 1K06A 1THTA 2YINC 3NQ41 4D99A 4G5XA 4X65B 1RCFA 3EPZA 3GT4A 4QDTA 1UPBA 2BMVA 2YICA 3PQCA 3PRJA 5JSFA 4QO8A 4WBSA 2AN4A 3NHYA 4OAZA 3OT4A 2H7VA 2PUHA 3RFFA 4XORA 3AOEA 3OR1C 1SCNE 1W76A 3NM5A 5ERXA 1XNRB 3LK6A 4RELA 1W8DA 3CSUA 4UTVA 1ZRNA 4LE1A 5A06A 3JVIA 2VRCA 1GUYA 3NAMA 1E8DA 2XVAA 3V7NA 1R00A 1N78A 4QL3A 3ZHXA 3KR9A 3ND9A 4CYCA 1ZXBA 4EJSC 4UVGA 1QO0A 2XB6A 4HDMB 5F4BA 5AW1A 1YR9A 4RZHA 5LYJF 4H2DA 3MLAA 3RAJA 1ZO8A 4ZTUB 3ZWXA 3SSMA 5ALFA 3QLEA 2I8LA 1O96A 1K2VN 5COAA 2XDYA 3F3YA 5LZ7A 1C9KA 2AJTA 2HN9A 9ATCA 1LQUA 1U1FA 2L9RA 4G8BA 4N41A 4ARZA 1N9KA 4Q9AA 1O97C 3MN1A 1PU2A 1G63A 2VYVD 4D96A 1S29A 1XRMA 5HCUA 3TM5A 1F5TA 2QW8A 2XNDD 3TF5A 1ZU4A 3TXXA 4E4RA 1BE1A 1ENZA 3SDGA 4WL0A 2ZRAA 2OA4A 1PYDA 2COUA 2FWAA 2RHMA 1LEAA 2HC9A 3HP1A 2GAOA 3CUKA 1ATIA 4ZCSA 4Y2GA 1YQAA 5BMVA 4LGWA 1KL7A 4LS3A 1KJQA 4IPTA 4CBVA 2CKDA 3F21A 1KC3A 1S5LC 4TTJA 1KERA 2OSBA 1KZ7B 3GHHA 3HCOA 3RIYA 1LPOA 5IY5H 1GYPA 5B2ZA 4BB6A 4XW2A 1G8FA 1D2AA 2PVSA 5CHEA 3U1DA 5DI3A 4AYTA 4JJFA 5KNDH 1Y5MA 1EJ6A 1JDSA 3GLKA 4G4GA 2QX7A 3CYFA 3C7TA 5EZSA 5K3CA 2DC1A 1C30B 1QHYA 2IZZA 1B0ZA 3H97A 1NNEA 2E49A 1F5NA 2JCGA 1K8ZB 2BWJA 2PGIA 4NB5A 1XRRA 1X8LA 4BO3A 1XEFA 4L9SA 1OVGA 1TNDA 3R2JA 1JHOA 2D1YA 2O8FA 3HH8A 2ZFWA 1CR0A 3JYQA 3BPVA 1TGYA 5IJ9A 2CLOB 1WJGA 1Z56C 4IW3B 4HF0A 4QFMA 4BPRA 3PKJA 3CJTA 2PRYA 1Z0AA 5J43A 1TB4A 4N7RA 1TWGJ 1E2QA 4EAAA 4F2HA 3H0GJ 1C41A 3RSZA 3HKDB 4RLFA 4TMXA 1IATA 3R09A 2F5EA 2RAUA 3G13A 3ND5A 4XPIA 3L7CA 5F3DA 3I9NA 2QZ9A 2V6EA 2OO3A 2PMZA 3QE2A 1P44A 5LC1A 4TQGA 5B1DA 1W7PB 2VN8A 4WBNB 1DXOA 3UY4A 4I4LA 3FROA 3KELA 4DT1B 2HXYA 5KYKA 2PJPA 2IUTA 1DZ3A 2XUOA 2C7BA 3B82A 2DUMA 3AOGA 3KHSA 5FBLB 1RHUA 4JLPA 2KYRA 1I32A 4MX8A 1I4EB 4CT0A 3GJ7A 5FA5A 4Y52J 1TW3A 3TMOA 3LOPA 2PUCA 3B13B 3TP3A 4BVGA 1IY8A 3VYUB 4K9LA 3DOJA 1PS9A 4P4UA 5L3RA 1PUJA 3O95A 5HZGA 3I1YA 1QE0A 1VQ7I 3VZRA 1JUPA 4OU4A 3TW8A 3HDDA 4AX8A 3ESZA 2IHTA 1VQ6I 2DKNA 3G6WA 4MA4A 3OPMA 3GJ3A 4EFKA 2H52A 3KPUA 1AGNA 4YUWA 2EX1A 2DPGA 2O0MA 3DDUA 4R1UA 5ILSA 3PHBE 1JJAA 1FL9A 2ZC2A 2L7KA 1XFAA 3HYCA 5E4JA 3F9IA 2GPAA 1QDEA 2WJAA 2YWDA 3WMFA 1YJQA 3SJAA 3QNUA 1F1ZA 3ZQQA 2LNBA 2QAGC 4S1VA 1G8GA 5CLSA 2IYUA 5ALQA 2VRBA 1SUCA 2GBYA 5LP6C 5FHQA 3AM5A 4ON9A 5DCYA 1ZOLA 2XSZD 1ORIA 4UVEA 6REQA 3RIXA 5IAOA 4R16A 2WFAA 1R7RA 3N07A 4PAMA 2LKCA 5HS6A 4TZKA 1ONVA 2GAUA 1MSEC 3ZMUA 2O4UX 3S2WA 4NYMR 3OSFA 1DTWA 5DNCA 3BCHA 2QRQA 3C3CA 3L06A 4GRIA 1NM5A 2JEOA 4MKFA 3DZCA 3K4CA 1HE8B 1VL1A 4L3VA 3IEXA 4ENNA 4E1VA 2ZWAA 4GG1A 2OORC 3V4OA 3Q6MA 3DF8A 2P4HX 1FS6A 3RYFA 3WMEA 3WWOA 1XIVA 3HWX1 3O75A 1WQ3A 4WX2B 4NMWA 1ITZA 1GZDA 2IV7A 2PQ2A 1ZNZA 1H4SA 5DGTA 5F08A 1H5UA 2ZUEA 2G9QA 4MUXA 2PUDA 2IHUA 1EFRA 2ZRLA 3AQIA 5D6EA 1LPBB 1YJWI 3QFSA 4J91A 4R9NA 4W5HA 3MHPA 2J0UA 5CBPB 5I7SA 1JKJA 3IDSA 1Y7PA 2OBMA 1I6HJ 4OJQA 3F1KA 2PKRA 5JYCA 1I2DA 2IXAA 1XX5A 3W9YA 3SC6A 2A0XA 2JH3A 2I4OA 4A3SA 1E2FA 1C80A 3QOFA 4RJIA 4DLBA 4U63A 2JLVA 4ZOCA 4ZTZB 2QEXI 5DBEX 1NA5A 1P80A 1HFKA 1Q14A 1II8A 2V54A 3RUAA 1Z47A 3II6X 3PDIA 1XL1A 3UJBA 2CQNA 3LCCA 3UMFA 5J2UA 2ZXJA 1C7JA 2R8ZA 5TY0A 3R5JA 2WM8A 4RM2A 4AI6A 3BTCA 4TRRA 3RBVA 2H65A 1TTTA 3RRYA 2EFOA 1QH0A 3U9SA 5EKUA 4P4LA 2RDPA 2YY6A 4B76A 4IUDS 4JC5A 2ZJ4A 2B7BA 4IZOA 3RVKA 3DF9A 1PFKA 2P9HA 2GOYA 3N4MA 1PUFA 2G5PA 4Q1EA 1F2TB 2EBHX 1OCTC 2GHQA 4ZARA 3D6UA 3AEUB 2XAUA 5LIRA 1BBYA 5J59A 4NPCA 1TVMA 2B5VA 3HJCA 4KRFA 3IQGX 2VJYA 2GA1A 4EL5A 4IVPA 4L50A 4GX5A 2K40A 4CV1A 1XWIA 3TO6A 4S1NA 5IBCA 5FLMJ 2ZXFA 1EUQA 4CT5A 2P9JA 2OM6A 4W5NA 1OTHA 4G0YA 3TK1A 2RJ3A 1FTNA 2VJBA 2QF7A 2C31A 1LBSA 3D6HA 3E9NA 5JY1A 3STYA 2PGAA 5FL7D 3Q12A 4MTLA 1MOSA 4O6VA 4RF3A 2TCTA 4QPJC 5DNDA 4P22A 3D6AA 4KTVE 5DM7F 3C1OA 3BD7A 1HG1A 1TVKA 2OOKA 3I2FA 3O31A 3DMFA 3EFHA 2QRMA 1JX6A 2BF4A 3ED5A 1JHUA 4Q00A 4EO7A 1V54H 1EG2A 2FB9A 1P72A 2DFPA 4E5NA 3HRUA 5E17F 4YFKF 2HQ5A 3R5XA 4ZO9A 4HNQA 5FD6A 4OI2A 4HMQA 1O95A 4C4SA 2RGRA 4CL3A 4R0NA 5L3QB 3UK2A 1S02A 3EF1A 5FPKA 1GT6A 5DYIA 3KSMA 3FXRA 4FSXA 3VSKA 1Y9AA 1BIFA 1O94A 5ED0A 2XV1A 4OGFA 4GOLD 3NBZC 5CT6A 3QHQA 5CVIA 1VHTA 1J97A 3OZBA 4N03A 5H68A 2CNNA 4P6VF 4BO8A 1BMDA 2WU3A 4UNPA 4N12A 2GAJA 3ROZA 3ABLH 1GV0A 5A9TA 2VSXA 1YH3A 4GI5A 4PLGA 4HDSA 4A0ZA 4EJ2A 4MV4A 3K9FC 5KOJB 4YACA 2VDPB 3TVYA 1WPKA 4OIPF 2FRDA 5K0GA 4LNAA 3Q6IA 2IX3A 2EV5A 1TEHA 5H3CA 2BHLA 3I59A 2P6PA 2CYBA 3HCDA 2VPPA 3VV3A 4MQFB 3W77A 5BNFA 3WJ2A 1KQNA 2FN9A 3BDAA 4JJAA 2I6XA 3PVSA 4FN4A 2YDYA 2O0YA 4KDFA 4EYGA 2IF2A 4BB5A 5GJCA 1GA4A 4OQDA 3GDWA 5K3SA 1D2GA 5CLQA 1Q57A 3RW9A 1JXOA 5HIIA 2BEVA 1L5FA 3KB1A 3D02A 3RADC 1VB3A 1IXYA 2Y0MA 3LBAA 2PFBA 3PWTA 4OYLA 1IUPA 1V7PC 2DUUA 4ZA2A 2A14A 4GXRA 2RH8A 3WK4A 2PU5A 2W0MA 4DV5B 4EABA 3BEOA 5FUMA 3Q8LA 2HSWA 3R3SA 2QZ4A 1QE5A 2EILH 3GFTA 4TSKA 2ZWMA 4WOBA 2UZKA 3TOZA 2OCYC 3IX7A 3RKSA 3CT4A 2L2QA 4F5ZA 2TMYA 1YI8A 1W1UA 5H3LA 1QO9A 5CFOA 3I0NA 3VNUA 5SZKB 4FNMA 1CR6A 3PVCA 3HVHA 4CIXA 3LG2A 1SFKA 3T1OA 5CA1A 2P9GA 3UWSA 3GZ6A 5J47A 4N3AA 2IGOA 2X2PA 3A10A 3BILA 4HYEA 3D4NA 5BORA 4B6JA 1I4WA 4G9EA 2NPFA 3U13A 2Q4OA 3KKQA 3HU1A 5EY5B 3ABZA 2Y76A 4MFEA 3IKMB 4BE4A 2ZVJA 4FR5A 3VC1A 4NRDA 3IHLA 2EW1A 2ENWA 3HKCA 3EH2A 4CNBA 4F11A 3GJXC 1DEAA 2G5CA 2DA2A 4O6JA 3A37A 1QGPA 4MA5A 3CX4A 4CICA 3U80A 4FFDA 2IEBA 3CLSC 3KKLA 4C1NA 3E61A 5CR9A 2J45A 4BC0A 3KIPA 1UJ8A 5H0IA 3FNBA 3CTAA 4OBEA 4BMZA 4LX0A 1U80A 1UQRA 3M5PA 2GEUA 3L7DA 2QXUA 3FAKA 5F64A 4ALIA 5JPCA 3SKVA 1JSRA 1CT9A 1IK4A 4BLRA 4FEYA 5A9RA 4DOMA 2FUCA 2OXCA 1PYGA 1Z2PX 5D5QA 2R6ZA 3WRXC 4P3OA 2IZOA 4GBJA 1ECLA 3KO8A 4I98B 2KI5A 2I76A 2C6YA 3PSFA 5U4QA 2DMQA 1T6ZA 2OGZA 3GVIA 4RKRA 2Q6TA 4GU5A 2VNJA 1LF5A 5M5XJ 4KNYA 3S1RJ 3MFKA 1Z22A 2ID9A 2HWVA 2KRCA 1SEVA 1W4AA 1R6AA 2BYVE 1B2RA 3FA2A 3OJEA 1ZLJA 2V65A 4JBGA 2W6PA 1H05A 5JMWA 5D84A 2HMUA 1U1IA 1YDHA 4HWPA 1GGJA 5LB2A 5IM5A 3UVEA 1UBUS 5E3HA 4BVBA 4LQLA 4AKGA 3DOHA 1CERA 2KQUA 4Y2QA 2BKVA 3VJMA 5AKHA 3SX0A 4RK6A 3AEKB 1MX1A 4R1HA 2PKCA 3FBTA 1G2PA 1VQOI 3IAS6 3U61B 2WP8J 4II2A 4FOLA 3JAMZ 4HDNB 1XN7A 2JFOA 1KWGA 4B3GA 2DFHA 4P55A 4JOCA 1T0PA 4LBVA 1ISFA 4H4DA 3WYAA 2G0TA 4JLMA 5EIBC 2VWQA 4YRGA 4P92A 1M8JA 1VL8A 4XD7D 2OZLA 2AXQA 1XF9A 1KKUA 5F04A 1B8VA 3D2CA 2XE8A 2EIHA 4TXLA 2Q8PA 1DG3A 2QW0X 3EPPA 4IRIA 1DC3A 2AZTA 4ZVNA 4FGJA 3HSSA 1K4SA 4IUCS 3G1TA 3IHWA 2PG4A 3H1AA 3EGEA 3ZE0B 1X0XA 2BMJA 2IC5A 2TMKA 3ETNA 3R5TA 3R77A 5DASA 2X8AA 2H94A 1USSA 2QY6A 4J7CA 1XDDA 3W8RA 3FOWA 1ZGWA 1WJEA 4MRRA 3E23A 1OZFA 2QRPA 3Q9VA 4HDUA 1PT8A 2JHAA 5E1DA 2L4AA 1FDUA 3NBQA 2OC9A 1MPTA 3F0TA 1OFUA 3D1LA 2GCIA 1BJKA 3L4BA 1M7HA 3MCZA 3GFOA 3QBTA 4FX0A 5FLYA 4RCYA 4F5EA 1EDDA 2C2HA 2BFNA 2M6KA 1TK9A 3I9FA 1XYVA 2E5WA 2AQ8A 4PN7A 3SXPA 4YY3B 5HWSA 5IARA 2C99A 2C29D 4QEDA 2M34A 3MS4A 2WNIA 4UXJA 4BMOB 4EGJA 3WWDA 1UELB 4UXIA 3SIXA 2YKGA 2R00A 2FMXA 1G21A 1QHGA 1OB5A 4HFMA 4JLNA 3EEBA 1CY1A 2VYVA 3VKUA 1JLHA 1M0TA 4YBRA 2HB6A 1BWQA 2XNDA 1EA7A 4R01A 5KVQA 2IHNA 2ZI6A 4AXXA 3AVVA 2LD4A 4CM8A 1XFDA 3HR4A 2DFVA 2WNSA 5TVKA 1W44A 3AHEA 3ZNNA 2NACA 3VODA 5IU6A 5ILOA 2VDLB 1WXFA 2E21A 5CLFA 1LB1B 4ZXPA 3AM3A 1GADO 1B8UA 5KSWB 3LUJA 2YHBA 1RM3A 1F0KA 5FXMA 3NIGB 2C5AA 4NMHA 5LBTA 1DX9A 2IYLD 2WV0A 4LA4A 3NIBA 2X6XA 1BW9A 1EDEA 2C4MA 4MTCA 4YT2A 4F3RA 3KSZO 4RJ2A 2LE0A 3RG2A 1ZG3A 3MBKA 1RKVA 2A35A 3KL2A 2PUWA 4X45A 1P29A 2IBDA 1GARA 4OM8A 4PHGA 4F4DA 1K7CA