4EVIA

Crystal structure analysis of coniferyl alcohol 9-o-methyltransferase from linum nodiflorum in complex with coniferyl alcohol 9-methyl ether and s -adenosyl-l-homocysteine
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
368
structure length
360
Chain Sequence
MDAATAVELLDAQPQVWHHFLGYINSMTLQCALELDIADVIHRHGHPIPLNQLAAALEIPQTKAPFLSRLMRMLVHLGYFTQVITKLPSYWLAPLSRLLLKQNPYNARSLTFCSVHEHLVDPWRQMSAWLRTGKEDGKDTPNAFAFAHEGKKVYEVCSEDANFSQLFSEGMAGDSWLFSRALVSKCRDAFEGLSSLVDVGGGTGNTSKVIAETFPNIHCTVFDLPHVVSGPKQTHPNLDYESGNMFTDEIPHADAVLFKWVLCDWPDEPVLKMLKQCKKALTKNGVKGKLMIADHVLDHESCNDSNSMGTSLILDMLFMSFLEGSLRTEKQWAKLFAEAGFKDYKITPVGGLRVLIEVYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coniferyl alcohol 9-O-methyltransferase
publication title Structural analysis of coniferyl alcohol 9-O-methyltransferase from Linum nodiflorum reveals a novel active-site environment.
pubmed doi rcsb
source organism Linum nodiflorum
molecule tags Transferase
total genus 128
structure length 360
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4eviA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4eviA02
3I0TA 2A14A 1USSA 1SQGA 2B9EA 3R0JA 1RI1A 3T8TA 3WTYC 4FS8A 4I0BA 1JR4A 3HIFA 1OKRA 5KK1A 2RQPA 2RNJA 2L01A 5ICCA 1Z05A 4BNCA 3CUQA 4ZYGA 2P7HA 4DM3A 5K5QA 1KQ8A 1JE8A 3PQKA 2GH1A 1QAOA 5DRYA 1JQEA 1UWVA 2NNNA 3THRA 4A0ZA 1G3YA 5GP1A 1LEAA 3BJ6A 2QYOA 1X1BA 4OA5A 2W24A 2P8TA 1X3UA 4GEKA 4IVNA 4KT5C 1TPYA 3SZPA 1ZRCA 4EM2A 3RIRA 4IJAA 3CLOA 4U7PB 4UVBA 2HYFA 4LECA 2MLKA 2QQBA 4BQAA 3WTTC 2G71A 3MGGA 3MWMA 5DM0A 2GWRA 1D3YA 2VZ9A 3TOAA 3HHHA 5E18F 3NDJA 5E8RA 3P9NA 4OINF 1WG8A 3F8BA 2WWYA 2L4AA 4ESJA 3WTUC 1NE2A 1ULYA 3LDGA 3A25A 5HZMA 2EX4A 3FWEA 1BN5A 1O3RA 5LHIA 2FSWA 3KPWA 4MQ4A 2UXNA 2YSRA 4DZRA 2O3FA 4HX4A 3HA7A 3LBYA 4M74A 4BP1A 3BGVA 4FZVA 4C03A 1EQAA 2ZIFA 3HRMA 5T67A 4E2YA 3I59A 5DEQA 2XYRA 4RTLA 1FY7A 2R7DA 2Z33A 1F1ZA 3SX0A 4L7VA 3ZPLA 1HXDA 3FMRA 3UJAA 2X4HA 1IM8A 1L1EA 3JTHA 5EOVA 2YXLA 2IVMA 4HF2A 3I54A 1SVUA 4R6WA 1MDMB 2XAFA 1ZLKA 1YF3A 1O3SA 3BZBA 5EVJA 3E8SA 4P96A 3B3GA 3BWBA 3TQSA 3EYYA 2EFWA 4RB1A 4ER5A 3FUTA 3MZYA 4LLNA 4OIPF 2ZFWA 1L3CA 3U1DA 2STTA 2PX4A 4ZZLA 4CGZA 2H11A 3AXTA 5CVIA 3G5TA 2G8NA 2XAHA 3KQSA 1XMAA 2B25A 1EH8A 3DULA 3ID6C 1U5TC 1G8AA 3E5XA 4MTLA 4YUZA 1ON1A 3QP5A 1R8XA 1MJFA 3CBGA 4KN7X 5FUBA 3UBTA 3PVCA 2JHCA 4HH4A 4P9UA 1F38A 4E33A 4XUDA 2KIFA 4X41A 3GRVA 4GF5A 4OX9Y 1BM9A 1W4MA 3BJAA 1S7AA 4H0EA 1MZBA 3FXQA 4HC4A 5D1NA 3MCZA 4Q48A 1IXKA 2ZJ2A 2KIUA 2EJRA 3KP4A 5D5XB 3GWZA 4ER0A 3DXXA 2ZWAA 3UJ9A 2OU2A 4A0YA 3L7WA 3EGEA 5K0FA 3TM5A 5CVRA 5DTMA 1I6XA 5H02A 5HDGA 4RB3C 3FZGA 4OIRF 1QAQA 2DK5A 3GGDA 2L02A 2AR0A 2QVOA 4BP3A 5F64A 2PVCA 3LL7A 5ICFA 3QAHA 2MD5A 5AIQA 2Y75A 1XCVA 3EVGA 3LCUA 5EHIA 2LKPA 4XSZF 5L3GA 3LBFA 4XCXA 3KP3A 4O6JA 2FMYA 5D5VB 2GAFA 2P8JA 2DPDA 3IHUA 1B59A 2VOOA 2VONA 4HTFB 3M70A 4PDKA 1WQ2A 2XGXA 1IN7A 3UWPA 2XVCA 4L9TA 3HRUA 2DAOA 1XCLA 2QQ9A 3MTEA 3FPJA 2QUFA 1VIDA 2M45A 4Q4ZF 5CYVA 3EETA 2BGCA 1ZYRF 2VC0A 4XRFA 5LQUA 1HSTA 4KIFA 2EFJA 4F7ZA 1WZNA 2IPXA 1XDSA 1HSJA 1OR8A 1XSDA 3C6KA 1LEBA 5EEHA 4PNEA 4G6DA 2L4MA 1YFLA 2O0YA 1XB4A 5EZSA 5T64A 2P6TA 2NS0A 4ETSA 2AOUA 1FBSA 2UZ4A 3FHZA 2QY6A 3GZ5A 3KQYA 2DW4A 4EKGA 3OZSA 3DLCA 5E9JA 2F2EA 4L0ZB 1SFEA 2ZNZA 4GGGA 4MQ9F 1YB2A 2I7CA 4YV2A 4GBED 2DK8A 3P9CA 1J2XA 3SR4A 2OZVA 4EJOA 2JG3A 2COMA 3BKXA 3KR0A 3NW9A 1RIOH 4UNOA 3LWFA 4KMFA 3LDFA 3RJPA 5H6QA 1OMIA 1KPIA 1Q0TA 5D6EA 3SSNA 1XXLA 3GVAA 1HNNA 4YFXF 2XROA 2YPRA 4U0YA 1D2CA 5KS2A 1QBJA 5C9ZA 3LCVB 2YUIA 3I64A 3HUGA 2PEXA 3PTAA 1DUXC 2F5DA 3VOEA 5D6FA 4HDVA 4H0NA 1LQ1A 5CD1A 3O31A 1BKYA 2YR2A 4ATNA 3DXYA 3KPJA 2A6EF 3FTCA 2FNAA 1GHCA 3EYIA 3ULQB 4RVFA 4ENNA 5EEGA 2K02A 5HIMA 3CJQA 4AIHA 2HTSA 1ZKDA 2BEOA 1LNWA 2H00A 3TKAA 1U2ZA 4QWQA 3Q5FA 4F85A 5KQSA 1ORIA 2YU3A 5E1WA 3IEIA 3R9XB 1L3BA 4PYQA 5E1XA 3C0KA 4O29A 2P3OA 3ECOA 3WE2A 1EJ0A 5HFJA 1FBUA 1R36A 4A12A 2Z3YA 4IV8A 3GCZA 2FF4A 2IW5A 4EJUA 1L3LA 3ERED 1OR7A 1T98A 5D4SA 4ER6A 4L0YB 2Q0OA 3I5UA 2M8EA 2PMHA 3Q9SA 2O06A 3KPYA 3V8KA 3KEQA 3SGLA 3OU2A 5DX1A 4PYJA 4AWXB 4HQEA 2GA1A 3LHDA 4WXCA 3ELWA 1SFUA 4BAYA 4RSRA 2L3DA 5FD6A 5FTWA 2JTVA 5F2NA 2AOVA 2IFTA 2DLLA 3LA2A 1I27A 2LSOA 3WTXC 1IN4A 3SMQA 2FE3A 3F6OA 1T0FA 4HOBA 3UFBA 4EKIA 4OQEA 1CF7A 5F2OA 2XRNA 2K4BA 3HOTA 4E2WA 1K6OA 4XUEA 4I2OA 5D1HA 3V97A 1WSUA 1RI4A 3RW9A 3TOSA 5DDGA 3LGAA 3LAPA 2HR3A 3IYLW 3ZQ7A 3T7TA 2HNKA 5LLQA 2ZFUA 3ELDA 2ZKZA 3MQ0A 4CKBA 4M9ZA 2Q2EA 5CVJA 2ESNA 5FD5A 3TFWA 3FUXA 4CXMA 5BMZA 3DMFA 4YUVA 1PRYA 1ZREA 5EIWA 3K6RA 5BQTA 3TRKA 4ZTBA 4UHTA 4C06A 2ETHA 1Z9CA 3J81Z 3WU0A 4FT8A 3V8VA 1SD6A 3CO6C 3G8AA 4U0WA 2G7UA 4G94A 1P4WA 3T8RA 5A2QZ 3VFZA 2XYVA 2BE5F 1G38A 4YMGA 1RI3A 3M33A 3ME5A 5FA8A 2UZKA 1O7LA 4WK8F 4X63A 2GA2A 3IL2A 5K0LA 1HW1A 2EV5A 3ABUA 5KYGA 1K7AA 1S6LA 3L8DA 2KJBA 2VE9A 4YFNF 2JZYA 3F8FA 2IIPA 4E30A 3HTUA 4DQ2A 5H6RA 1G55A 1TQMA 5E2AA 5BW4A 5LQKA 5K0JA 4CKCA 2DO7A 3FUUA 2VOPA 4AVPA 2GS9A 2GXBA 3KETA 4RTRA 2AN4A 3BT7A 4U7DA 1FSEA 2HTEA 3OU6A 3IKTA 4V0RA 2XAJA 1R5HA 2HDCA 5E8GA 1P1BA 4GOLD 4M9XA 3HTXA 3MB5A 2GLUA 5ILVA 1NBIA 4FT4A 4RTJA 4IF4A 1L9KA 5FB2A 4Y2HA 1KXZA 2PSSA 3IRQA 2P5KA 1VTNC 4K6MA 3QOWA 4P7GA 2A3SA 2FRXA 2ZWVA 1M6EX 4QTTB 1JTEA 3FPHA 2IPQX 3QOPA 2WK1A 2UYCA 3KCCA 1FC3A 1XCBA 1T38A 4DQ0A 3KP7A 5U4XA 1KP9A 1VQ1A 3N4MA 1X1CA 2K4JA 4MGRA 3IV6A 2V1XA 2BR3A 4A0XA 1WS6A 3J81K 3RIEA 3ZMZA 1ZG5A 3W6JB 1UFKA 3M6UA 3BZ6A 5HVQC 2O8XA 1ZHFA 3WGIA 2BM8A 4V0QA 3KEOA 5A2QK 3FUWA 1YW7A 2G70A 1NW8A 3LKZA 2XYQA 2ACJA 5HIKA 3CUQC 1RNLA 3IWFA 4G56A 3H2BA 5E1OA 4HF0A 3G89A 3KZYA 4R1HA 3WGHA 2DTRA 5K0CA 2VDWA 3OOPA 3CVOA 1S7OA 1CGPA 2WA2A 1Z91A 1AQJA 2OB2A 3KE2A 1IXSB 2VT3A 3KFWX 3EGVA 2G72A 1V39A 2EV0A 2ERCA 2IH2A 1HQCA 3RPUA 3F8MA 2FYTA 3A4TA 4S04A 2IJLA 4KFCA 2E7XA 4G7OF 2IBSA 3B89A 4ZYDA 3FPFA 3GFMA 4OA8A 2HOEA 4U7BA 1DCTA 4WX9A 2HGCA 2OZUA 4EM0B 3SQNA 1VP3A 3TMAA 2RC4A 1U2WA 4R05A 3FYCA 1JGSA 3EVFA 1X19A 3B3FA 4RTNA 1FWZA 1FPQA 1QNTA 1HW2A 4M72A 2QRVB 1TNSA 2VDUE 3G8BA 3ORHA 5JR3A 1UHWA 2KRFA 2CO5A 1CF7B 2AOWA 2PWPA 5D8KB 1LDJA 5HLIA 2HWVA 1J9IA 2JHAA 1KGSA 1M6YA 2PX2A 2JPCA 1R23A 4UVAA 2IP2A 3RYRA 3PX3A 4DF3A 5ILSA 1XTPA 1O57A 2XAGA 4IV0A 1D2GA 3F23A 1FYKA 2P5LC 3UJBA 5DTQA 3I53A 1VP9A 2O0LA 1FBQA 3PFGA 1BOAA 3G5LA 3NEUA 5DV5A 4ENKA 4Y30A 1QGPA 2RVCA 2CWEA 2OQGA 2EA2A 2HZTA 1U3EM 3AXSA 3P7NA 5DM4A 1YFJA 1G4DA 1Z3CA 3QPHA 7MHTA 3BXOA 1DL5A 4P58A 5J8CA 1L3IA 5FLXK 5CUQA 1YW9A 1XCJA 3S68A 1YIOA 2VDVE 4RGXA 4LLGF 2AZTA 1IRGA 2G7HA 1P39A 3O2PE 2ADMA 2JRTA 3T1BA 2PXCA 2PX5A 3KR2A 3FX3A 3GO5A 1WRJA 3P2EA 3RPQA 1VBFA 2W25A 3C3YA 3M6XA 1BI1A 3ZN1A 3PX2A 1LJ9A 1USTA 2FA5A 2MLGA 4QDKA 2L54A 3G2PA 2D1HA 2WTEA 3LX6A 2PGXA 1JSXA 3LA7A 1X1DA 2PJDA 3PFIA 5BPDA 1GVJA 5K5RA 1I1GA 2NYXA 1Q1HA 5K8VA 2AN5A 1S3JA 3GJYA 4KDRA 1A04A 5LRRA 2OA4A 2K7LA 2FMLA 4N9HA 2HEOA 5D5UB 3EGIA 3GYHX 4N0BA 3WTWC 5FWDA 2E1NA 3HOSA 1IN8A 2ESHA 2NP7A 1AOYA 4HX7A 3GW2A 4E70A 2ZCJA 1MHTA 3EEOA 2D2WA 1YW8A 5HOQA 3B73A 3NMUF 4L9VA 3WTSC 3GXOA 1VL5A 3E97A 1BC8C 4R79A 1O9GA 3C1DA 5C1IA 3NRVA 4G7HF 3SSOA 3M1EA 2VC1A 4HAMA 4DNCA 3MAGA 4QLCU 3HSFA 3T0YA 1D8JA 3CJNA 1FLIA 1FP1D 3FPGA 3B7PA 4C4AA 3DTNA 1O7FA 3KU1A 4BH9A 3G2MA 5EGSA 2HS5A 3WTVC 5HDNA 5G02A 1WXXA 3JWGA 5CIYA 3KQWA 3KQOA 4RB0A 4F84A 2OBPA 3KKZA 2F5FA 2HMYB 2CGPA 4M36A 5GIOE 3DPLC 2A5YB 4EGZA 4PGGA 4C08A 3F8CA 4QPPA 2K27A 2PXAA 2IT0A 2HWKA 3E6CC 3WE3A 4E32A 3DH0A 4PINA 1I1SA 2LDUA 4GCVA 5EG5A 2PFBA 3GO4A 3U81A 2JPBA 4FX0A 4U7TB 4P7FA 2A69F 4BLVA 2ZZNA 1RJDA 2V7EA 1PP8F 3NQOA 4OMZA 2H1RA 2CYYA 3KPUA 2D1VA 2OYRA 1OYYA 1C0WA 2P7CB 2DPMA 2JH9A 3RKXA 5FULA 3T7RA 4PYMA 3JWJA 2K86A 3EEYA 4X60A 5JUWA 4HG2A 4ISCA 3EMBA 1H9TA 5E17F 2PXXA 5LQCA 3F22A 4P55A 2JH8A 3VEPA 2Z6QA 2G1PA 1SQFA 3RTRA 2ZO4A 3ECHA 3BWGA 3COAC 5DM1A 3THSA 1Z6RA 1LB2A 2Z6AA 3K1NA 4C04A 3TR6A 3HCDA 2H6CA 4BY9E 2MH9A 5FQOA 2PWYA 3B02A 1QQIA 4B09A 2M5WA 4WXDA 1PJZA 1Z6TA 5F6FA 2AVNA 5KVAA 2VBYA 1S8NA 5DM2A 5K09A 2Y0MA 3DOUA 5EQJB 5LEKA 1JQDA 3UZUA 3R61A 4IRIA 5E20A 1B1BA 1HKTA 3HRSA 1RI2A 2W85A 4AZTA 1JG4A 3VC2A 4MWZA 5GIPE 1WKMA 1NKVA 5IH3A 3SFZA 5AONA 1TBXA 4DMGA 4RTSA 2ZMEB 4I0AA 1D8KA 5T6BA 5IT9Z 4LK0F 3OFJA 4NECA 1HKSA 3DV8A 3HCBA 1QO0D 1SAXA 3DMHA 1U6GA 4G7ZF 2I62A 2ZZMA 2XV4S 3HSEA 4PYLA 2YVLA 1JSZA 1WI9A 4KMUX 1XMKA 2YQZA 5LEJA 1ZRDA 5CCBA 4MHTA 4KUMA 2B3TA 5GM1A 5B1SA 2OKCA 1B4AA 3I4PA 5ERIA 5EMLA 4JK1X 4KIBA 4RS8A 3AJDA 4DCMA 3K9TA 3ROUA 1H9GA 2IGTA 4YIFA 3ZMSA 3NWBA 3CUOA 2RN7A 3WG9A 4C05A 2YX4A 5EMMA 2XBMA 4RVHA 4XLPF 4TV7A 1P4AA 1R5GA 2QQAA 2N47A 4PONA 4JQFA 4KNYA 1J0RA 3OV8A 2FK7A 1ZARA 3A7DA 5LHGA 5CVUA 5LQAA 3EMDA 2PBIA 3IKVA 3E6BA 4MTDA 2O6GE 1P92A 2Q41A 3M9AA 2FPOA 1DUSA 1XGNA 5L3FA 4RWZA 2CMGA 2C7QA 3NTVA 2FBIA 3N97A 4A5NA 5EZQA 1KU2A 3QP6A 3JSOA 1SG9A 2C6YA 2IH5A 2JJQA 1FSHA 1AF7A 5E2BA 3SM3A 2P1DA 2Z99A 5LGTA 4Q47A 2OBFA 3ANXA 1MKMA 4KRGA 3TO9A 1IXCA 3ZN0A 1LVAA 3L00A 4M6YA 2VE8A 4GC5A 4RX1A 4CHUA 2UXXA 2BV6A 5FGMA 3CC8A 1SUIA 1JXSA 3SSMA 2XUBA 1JHHA 5CM2Z 4FHTA 2H6BA 2Z6UA 5IT9K 5FO5A 3EVZA 4LB6B 1IRFA 4CXFA 2TDXA 1P2FA 1LDKB 4CWAA 3AY0A 1U78A 1WXWA 5DUKA 4CDGA 1YUBA 3EPPA 1XN7A 5DCMB 4AUKA 3CGGA 2C7OA 3CKKA 4IXAA 2EJUA 2ZW9A 1F5TA 3RKYA 1GXQA 2FEZA 3HA5A 2I9KA 2MC3A 4CO8A 3DKWA 5EPEA 2VODA 3TO6A 2FU4A 2MA3A 5EMJA 3FXUA 2IH4A 1P91A 2P35A 4PGHA 3HVHA 1TW3A 4R6XA 3TO7A 4HF1A 3J80Z 2QRVA 1IW7F 2XAQA 2EB7A 2VP3A 2IBTA 3BROA 2CSOA 5HIJA 1P6RA 4IWNA 4YFKF 3GNLA 1JG3A 1VE3A 5HILA 5HS8A 3DXZA 1YG2A 2R7FA 2J5PA 2M87A 3A27A 3JWHA 2GPYA 4ASNA 1KU7A 1R00A 5DLYA 1XD7A 4UXNA 2ONZA 5LQRA 1UHMA 2NXNA 3FYDA 4CZZA 1B9MA 3IRRA 3FXRA 4HSGA 5KQRA 2FRHA 2PT6A 2RGVA 3QV2A 3MCTA 2P40A 1V3FA 1XSVA 3TQNA 1TLHB 1J5YA 2PMUA 1Q0SA 2ZLBA 3GIWA 3LECA 2ZXJA 1FP2A 4JXJA 1FYLA 2EV6A 3B5IA 2OQRA 3MFKA 2Y48A 3DLIA 2FK8A 3FRHA 2STWA 2YXDA 4KICA 2YX7A 3QOXA 3VB2A 2GIVA 3SXYA 2BBYA 4MEYF 4PYKA 2HYGD 1ZGAA 1J59A 2NXJA 2DU9A 5HLHA 2JHPA 4L9JA 1TW2A 1YYVA 2ADUA 2QBYB 2AXLA 1QYRA 3KP5A 3QRFF 3UJCA 1JG2A 5M5BA 1JHFA 3FUVA 2E7WA 4YUYA 4LGWA 4RTKA 1KU3A 3GEZA 3REOA 4DA4A 2Y1WA 1XDUA 3HCFA 2IRFG 5ED4A 1NW7A 3J80K 2EFQA 3A7EA 3QU3A 2VBZA 1R8YA 4MEXF 1EJ6A 4RTQA 2EWNA 3FZVA 2ISYA 1EH7A 4HDUA 2ZTHA 5DXAA 2XVMA 3E7PA 1F9NA 1ZG1A 2X0LA 2ORED 4E2XA 1BOOA 2GA9A 4YUXA 2HTJA 3F3XA 1L0OC 4UVCA 1U5TB 3K2ZA 1SD5A 5GM2A 3L09A 4BHPA 1MJAA 4HV6A 1EV7A 2XHKA 3KHKA 2PKWA 3M6WA 4AZVA 5EKUA 1MJ9A 4C07A 2JSCA 4EV0A 2B78A 3KQPA 3G88A 4WXHA 2Z5UA 2EA4A 4CICA 1IN5A 3GFIA 3KZZA 3NVKI 1ZG3A 2HFHA 5K0NA 3ZP5A 2P4WA 4YG2F 5BOXA 1NV8A 4MQVA 2KKOA 3JW4A 1BI2A 4B8XA 1RJFA 5TRDA 2NNWB 3TPZA 2ZNYA 1KIAA 2E5WA 3O6BB 4IHSA 3LCCA 2O07A 3F21A 3E23A 4IRHA 3EUHA 5FA5A 5DD4A 4P7JA 4BHCA 5BP7A 2LNBA 4GYIA 3LA3A 4EQZA 3E6DA 2AS0A 3ABTA 5DSTA 2NYUA 4CKEA 4CTJA 1KQ0A 3EVCA 3VSEA 4HLYA 1NBHA 5FADA 3PQJA 1DDNA 1KPGA 3CJRA 2XVAA 1MJBA 1V4RA 4YV0A 1INLA 4PIPA 2PG4A 3I9FA 4WCGA 3CJTA 3Q87B 5FHRA 2E1CA 3JTGA 2R6ZA 1SKMA 3R0QA 1O3QA 1T6SA 5L3DA 2FQ3A 1O3TA 4RGRA 4WVLA 3EVBA 1NW3A 1G60A 4RGSA 2PV0A 1YQAA 2PX8A 2VBWA 1ZLJA 4U0VA 4PYIA 2OB1A 1G6NA 5DPMA 3GZ6A 4WF2A 2LF7A 3E5UA 4QDJA 5JHUA 1STZA 4IPAA 4EGYA 1AV6A 3CCFA 4UV9A 5GOZA 1M0EA 4JBAA 5KVRA 1FYMA 3FM3A 1JQ3A 5DX8A 10MHA 3NWEA 2H27A 4HGYA 3WSTA 2YX1A 3LQQA 5DD8A 5C0OE 3MERA 4PYOA 3FRIA 1NW5A 4Z2YA 3UJDA 4N9IA 4EJTA 1NT2A 1P1CA 2ZMEA 3C3WA 4CTKA 4OIQF 1KA8A 3PLAE 2EFNA 3PT9A 1I1NA 3GRUA 1MD0A 3IHTA 3ELUA 4BLWA 2IA1A 4OU0A 5L3CA 1IAWA 3EQLF 2PI0A 1NV9A 1T43A 3IC7A 3GUDA 4CYDA 2YXEA 2C7PA 4L5IA 3EVAA 1W7PD 3WTZA 4GOND 2KJCA 1WY7A 3ER8A 2EFPA 3JWIA 4KW7A 3G73A 4GOOD 5DSXA 3U9GA 1FJXA 5HS7A 4LLLA 3HCEA 3FMSA 4M38A 2XKPA 2UWMA 3V8JA 4EK9A 3DR5A 1BIAA 1VLMA 4I7HA 1D2HA 3AWIA 4XLNF 3BP8A 3BWCA 3B3JA 4L18B 3E5QA 1O54A 3MZHA 3M4XA 3OE4A 2BR4A 5E9WA 3W6KB 3AAFA 3F72A 4GC9A 4RB2C 3EVDA 2XIGA 2ZVJA 1RUNA 3JSPA 4PZJA 4FT2A 1YZ3A 2ZBQA 3GRRA 4HLXA 1F4KA 2AS5F 5GINE 1ZAOA 1XJ5A 1SMTA 2RDPA 4RTOA 4MNUA 4KN4X 4HYEA 3DMGA 3F6VA 3O7WA 4AD9A 2EFOA 4ENJA 1U8RA 3LAJA 1B6AA 1RJGA 4EVIA 5LSAA 1IF1A 3ERCA 4LD5A 2PBFA 4ON0A 2KW5A 4POOA 3G2OA 3BWYA 5K0BA 3KLNA 5LHHA 1R1TA 1REPC 4FR0A 4G9YA 5L3BA 1HW5A 1R1VA 2YTZA 3O3KA 4A6DA 5K01A 3TM4A 1B9NA 3L2CA 4I98B 2B2CA 2H94A 3ELYA 2P41A 3K1PA 2V1UA 4LFUA 3ZMVA 4LG0A 3BY6A 2PLYA 1NW6A 2OZ6A 2FHPA 3H3UA 4HBLA 4HZFA 4O3MA 3RYPA 5DTRA 5LGUA 3BJOA 4AIJA 4IHTA 5EIFA 4Y13A 2NRAC 1PP7U 5J8FA 5BW5A 5DCMA 3S2WA 3R6TA 2BYVE 4EM1A 1F3LA 3BWMA 3Q7EA 4OOIA 4HX8A 3WGGA 4ZYEA 2CKDA 4I01A 1W7PB 2KIMA 3HVIA 1QZZA 5ICEA 1YTYA 5K03A 5HS9A 4I02A 5E8IA 3GU3A 3O4FA 2NXCA 5D5WB 3HP7A 1N7IA 3P71T 3C6MA 4AZSA 3I71A 1Y0UA 2IA0A 2K4MA 1HKQA 2YR0A 2ZULA 3ZMUA 4PCAA 3R4KA 4O5VA 1N7JA 2V6CA 1VPTA 3K1MA 5DWQA 1ON2A 4E31A 3FTDA 4G6QA 1TTYA 5LGNA 1BBYA 3HNRA 2O61A 1TQPA 2DFIA 2O05A 1J75A 1KHHA 4GYGA 2GB4A 3PS9A 3M8EA 2UYQA 4M73A 1WWXA 1K78B 1EIZA 4BXUA 2P5VA 4AZWA 4E2ZA 4U88A 5D4RA 2AOTA 3LDUA 2QE6A 2AOXA 4F86A 5HIIA 4KA4A 5HOOA 2OPBA 2PJPA 1XGSA 3QPTA 3RDIA 5D8LB 3MQ2A 4OBXA 1KYZA 2VS1A 3FF5A 3OE5A 1JG1A 1BC5A 3KPVA 2HR1A 1NHAA 2DPUA 1XVAA 5IT3A 1SD7A 1FNNA 4R8HA 5E1DA 3UA3A 2CMHA 4K2EA 3CO7C 4RAZA 3WODF 3DFGA 3JAMZ 2P7IA 4GXOA 3ER9A 4Q5SF 2DI3A 4BLUA 2VBXA 4KIGA 2NP6A 1JTFA 3KQQA 3RI4A 3LSTA 1PUEE 4FGZA 4HRAA 3OCJA 2ZBPA 5BXYA 1I9GA 5FHQA 5DX0A 2HKXA 2WC2A 1W5TA 4G8XA 3NVMB 4OBWA 4NB5A 1DP7P 4P5OA 3F8NA 5E1ZB 4QPNA 4M6XA 2WA1A 3P2KA 3Q9VA 4R8RA 4MHGA 1SUSA 2QBYA 1KR5A 3T0IA 1R7JA 3R0AA 2NAZA 2I6GA 1FZPB 1RI7A 2HQRA 4UUVA 4L9NA 2JT1A 3HTSB 5JI6A 1IUYA 5GWXA 2Q8KA 3BDDA 4FSXA 3BUSA 3FTFA 3D0SA 1KU9A 5E9QA 4GO1A 3T5XA 3KQMA 4X61A 4ER7A 1ZGJA 3HCCA 1ONVA 1T39A 2ONYA 3G7UA 4KDCA 4PYNA 3FMQA 2GQQA 4RTPA 1U5TA 3A26A 5LR6A 3P9IA 3J7AO 1DPUA 3V4GA 1R74A 3CUQB 1XGMA 1G3SA 1HBXG 1ZQ9A 1XSXA 3V7RA 1XDZA 2QWWA 3R3HA 3TDZC 3GRYA 3OPNA 4ZYHA 4KWCA 2M30A 5ICGA 1QZYA 3FTEA 2DQLA 3C18A 3DXJF 2FOKA 3JAMK 2P3LA 1T2KA 4DKJA 4Y15A 5JFRA 1G3TA 1IY9A 5F1RA 3GX4X 1ORHA 3OFKA 3HSRA 3MTIA 1I4WA 3ZMTA 1UIRA 2ZSUA 3HM2A 2P7VB 4MIKA 1XGOA 3DPTA 4MTEA 2O57A 3HVJA 2EK5A 2ZCWA 1QANA 4EMSA 4QQNA 4X1OA 2LD4A 5CLSA 4AX8A 1KPHA 2PQ8A 3P97A 3BKWA 4DCGA 4L5JA 3D2LA 1RUOA 1GXPA 5AIPA 3V7SA 4D0PA 4LG0B 2QZ8A 3L9FA 1R18A 2ZIEA 2V74B 1TQIA 5E1MA 3PFHA 4ENMA 4BHBA 2HKOA 2ZBKA 2PY6A 5HLGA 3I59B 2DULA 1KYWA 1EAMA 4ZZDA 3M7GA 4UV8A 2V9VA 3TKYA 5ERGB 3HHGA 4HW0A 3HA3A 2A61A 2OD5A 1IXRC 2A68F 1BC7C 1EG2A 5DT2A 2FCAA 4B17A 5H20A 3DQVC 2GXGA 4YMHA 5DRTA 2ZIGA 3T7SA 2BZGA 2ZBRA 3OZRA 4LWPA 1BJAA 4UOEA 1SFXA 4LK1F 3K0LA 2Z9OA 4GOMD 1RJEA 4Y17A 3ISPA 5L3EA 9MHTA 4OQDA 1S29A 5FFZA 3GRZA 1ZN2A 2M1BA 4FSDA 1ZRFA 3RODA 1ZH5A 5TJJA 5FWAA 4PCQA 2AN3A 4FP9A 4KDPA 1OYWA 2BR5A 3GFJA 1YZHA 3KR1A 1KQ9A 2DBBA 5CVVA 3K0BA 2AOTB 5E1BA 4RVGA 4AIKA 5DYMA 3P8ZA 1FBNA 1UB9A 2RKHA 3BGIA 4A2UA 3G2QA 4PIMA 3UJ8A 4QVGA 5F2KA 3CDHA 3RKWA 3SXJA 1BI0A 3ELKA 4KYWA 3DUWA 5IKMA 2IDKA 3MHTA 3MEXA 2CFXA 4S05A 4M7RA 3KLOA 4RYLA 1AWCA 3GDHA 3GFLA 2P3QA 2OXTA 4LMYA 1R58A 2V79A 1R1UA 3BPVA 8MHTA 2EJTA 2W84A 3HRTA 5MHTA 2IDJA 3C3PA 4P7KA 3U2RA 5K5OA 5CCXA 5CVEA 2CL5A 1PDNC 2W57A 1IZ1A 3QU6A 2PLWA 1UCRA 3X0DA 3SZTA 2ISZA 5LQJA 1R22A 5DXJA 4P9FA 1W5SA 3P9KA 3H3ZA 1Z1DA 1YLFA 3DF8A 1RI5A 2XASA 4YV1A 3R24A 3WU1B 5J6XA 2F5CA 4NQWA 1D5VA 2F5EA 5EHGA 1N2XA 3TOBA 1DPRA 2V1DA 2P6SA 1G3WA 2RV8A 1QPMA 1IN6A 4IKPA 3BOQA 4OIOF 4BYYA 2WV0A 2H09A 1BIBA 2ESRA 2VT2A 3KP6A 2QLZA 1BHJA 5K0GA 4RAYA 2FXAA 5K05A 5DUIA 5K1YA 3DEUA 3E6MA 2J5OA 5CVDA 4ZH4F 2O03A 4PWYA 4M71A 1SMYF 5ILUA 3TDUC 3E3VA 4M9SA 2PT9A 4EQQA 3KQVA 3TLJA 1RZ4A 4QVKA 3SHFA 2AOUB 2DT5A 1UFMA 1YS6A 1QAMA 4LWOA 3ZMDA 3HVKA 2QM3A 3LQRA 2FBKA 1R6AA 1E17A 4GUAA 5BS6A 1YO5C 3KQTA 2EG5A 3M6VA 4ER3A 1ODDA 3LKDA 2GAUA 3LFKA 1Z7UA 3DP7A 2PN6A 1O9HA 2ZZKA 3E05A 1W7PA 4HV5A 2OO3A 2NNYA 2UYOA 1YS7A 2MBFA 3V8LA 1TNTA 1MDMA 5BPIA 2CG4A 2IA2A 1HMYA 3UJ7A 4I09A 2GZWA 3V7CA 3EDPA 3PB3A 1EH6A 2F8LA 3H92A 1OYIA 4KVZA 4RV9A 2CQKA 3IWZA 2R3SA 2MH2A 4ESBA 4HGZA 1P4XA 1LDDA 4XSXF 4IRGA 2HV9A 4LG1A 3GLXA 4R8SA 1YFHA 2Y1XA 3NDIA 4QTUB 2B0LA 3KR9A 4FX4A 3BGDA 2HQNA 4WWCA 1K78A 2ELHA 2NXEA 5EMKA 4RGUA 3P2IA 3FPEA 1G6Q1 3HCAA 5HDKA 3F4KA 5HEKA 1AQIA 3HEMA 4RTMA 4YUWA 3TGNA 1X1AA 5FLXZ 1B42A 4XBFA 3OZTA 3VYWA 1J7KA 2A6HF 2BM9A 2BH2A 3ML6A 3LPMA 5LRSA 4EJVA 4RVDA 3R6SA 4HA8A 5FQNA 3MAJA 4XUCA 5FFXA 5EC8A 3VC1A 4ESFA 5JVTA 2OY0A 5P8WA 5DCFA 5K0EA 1BI3A 5E8JA 1E2XA 4YIIA 2LF8A 3CTAA 2UYHA 2C7RA 4A6EA 3NJRA 2FNPA 3EVEA 4LB5A 1FOKA 1FT9A 5CJ9A 6PAXA 2FBHA 4M37A 1FX7A 5FCDA 3VODA 3K69A 3FM5A 3UJ6A 3GF2A 3SVZA 3UA4A 1K79A 1H0MA 2VN2A 3R60A 5EKXA 2G9WA 5LBQA 4QQKA 4HTFA 1G8SA 1OPCA 4OMYA 4LJZF 2QENA 2OAZA 4NHJA 3OU7A 2DQRA 1Y8CA 1I5ZA 1MGTA 1SD4A 3D5LA 3KP2A 4EJWA 1H1DA 2AVDA 3C7JA 3G3ZA 2A07F 4PCLA 4A5MA 4HQMA 2VXZA 3BPXA 2XKOA 2CW0F 4GQBA 2CWWA 5LQNA 3I58A 2D45A 3HYIA 3M8FA
chains in the Genus database with same CATH superfamily
1ZD9A 3DTVB 2NVUA 3VTZA 3WTYC 5C5DA 1OKRA 4PJ0C 4B6JA 2IC5A 1AKUA 5ALYA 1Y8RA 4NQRA 1FXWA 1XQ9A 4A8PA 5KNBA 1JE8A 4W99A 1QAOA 2ZQ5A 1RAGA 3GOHA 2AZXA 1H5QA 5I4IA 1M2VB 5EDNA 3LP8A 4GEKA 4UHBA 5KMGA 5DW3A 2A5LA 5EJFA 3HM5A 5JNVA 1G4AE 4JUFA 4KRFA 2YFHA 4P4UA 2BFCB 1R37A 4IGKA 3RT9A 4IS3A 4UXJA 1P18A 3WFIA 5FTKA 5ILQA 5H80A 1U9IA 3TQOA 3HKDA 4EJ6A 4KKVA 2Q5HA 4QOFA 1HLDA 4PZAA 4KMSA 5TPWB 5DEQA 2EP7A 1YOVA 5BQPA 4Q9HA 4OAPA 3T1NA 5EOVA 1OX6A 4MV8A 4MUEA 1VI0A 1HFEL 2XUHA 3V3TA 1AKWA 1RYHA 2R4UA 4RK1A 2VC2B 1J2YA 4N5HX 3SWWA 5A0FA 5IM4A 2SKCA 2XWQA 1TWCJ 3CUKA 3C3DA 1ISIA 4J0IA 16PKA 1SKYB 2AC4A 4PFKA 4XR9A 1R8XA 3UBTA 2QDXA 4MKFA 4IGFA 2RFLA 3GN1A 4FCWA 4JFRA 1FFAA 4R7TA 2J5KA 5J5AA 4M3GA 4J2OA 4TWZA 2ZUVA 2IPMA 3KP4A 2ZBDA 3GFTA 3EZLA 4WLUA 4QUHA 2Q99A 2XVXA 4NQZA 4HWGA 4G67A 4EFKA 3EVGA 2HNHA 2FMYA 1JFRA 3L0ZA 3M3DA 1ST2A 1QHYA 1D3AA 3H0KA 2WU8A 2P9HA 1Q0LA 1UMCB 3FPJA 1N2ZA 4YAEA 2ZUEA 1WZNA 5CJ2A 5FLEX 4RELA 5F27A 3A4IA 4EO7A 3OJEA 1RWXA 4WDQA 3D4OA 2WJ3A 3PEFA 1XB4A 5EZSA 3RUPA 3E1KA 2XGCA 3GZ5A 4A0QA 1HFJA 3T38A 2OZVA 4QRDA 2OXEA 4X3PA 3H16A 3JSXA 4P1ZA 5BQOA 1E1NA 4N0MA 1IB0A 1TK9A 2EKBA 2PUJA 4GBGA 5HCNA 3ZQFA 3KT8A 2YUIA 5CGQB 2VTBB 2CLDX 3VNQA 2R6AA 4OJYA 4XM0A 1M1YB 1KEEA 1FPMA 4TL6A 1IMOA 4U9UA 3DEAA 3TXXA 2DWUA 4WY2A 5CMLA 1QF7A 4KO1S 1Z5VA 4LOCA 3V48A 4HWPA 4MAAA 3AH8A 1U4NA 2BEOA 2K9MA 3D1NI 3ROZA 3QPUA 3PRKE 3S81A 3R4CA 3SIPA 3WOHA 4M54A 3GEPA 3X2SA 4PEVA 2CVFA 3AFNA 1OFUX 3TPFA 3CP8A 3IUEA 2RH5A 2QN7A 2QSGX 4YGYA 3C8ZA 1TZ2A 4LSWA 2QZZA 1RRCA 3QVLA 1PR9A 1IY2A 4EG4A 4CL2A 2CLSA 4R1QA 3HQ4O 1XN4A 3EEQA 3SMQA 1JI3A 1JXAA 1J2UA 2HPVA 1A2KC 2C5AA 4HQFA 5LQSA 3NO4A 2WG0A 4YJKA 4CLHA 4I2OA 2ZSKA 4JXZA 4HOYA 1YHYA 1XROA 4HGPA 3WVNA 1PIWA 5AIAA 1T3LA 3EW7A 2YC2C 2UDPA 4WJZA 5FD5A 1PRYA 3OJFA 1DFIA 3GFFA 1V8DA 4BFWA 4EFLA 3G8AA 5A2QZ 3OQ6A 3MCAA 4W5RA 2FUKA 1X2MA 4RK4A 1Y4DE 4Z8XA 5ESRA 2O2JA 1FP7A 1FJLA 2AX3A 2ZM5A 2XT6A 4BMZA 4IG9A 4RMGA 4G0UA 1H6DA 1O97D 1YE3A 2IOFK 1DJNA 5TMPA 1Z73A 3HC7A 1J1IA 1SXJC 4TTQA 3BT7A 1FSEA 3H0GJ 3WBBA 3LD9A 1M2KA 2P4SA 1ZWKA 3N2KA 4FLEA 5E8GA 1KZ7B 2I6TA 3O9MA 4TMZA 1KFBB 2GVNA 3SDZA 4B32A 1T1SA 4IF4A 1F60A 5FB2A 4Z49A 3A58B 1WHSB 3QOEA 4W82A 5CNKA 1VTNC 2A3SA 2HSJA 1QG2A 4C2UA 3QTBA 5IJXA 2K9QA 2ZYIA 3KP7A 1KP9A 4PAOA 4KSBA 1THGA 4IOMA 3VKFA 1FUUA 4RZXA 1JHYA 1SULA 1O58A 4JLKA 2QUBA 4EW1A 4B6FA 4A7PA 4K88A 3KZYA 3QA9A 1IOWA 1SOAA 1NQWA 1D2RA 2DOAA 2RHBA 1Y34E 3JU3A 1E3PA 1NHGA 4RGYA 2VT3A 3KFWX 4EZEA 4MWGA 1P77A 1VRVA 4XDYA 1RZRD 4G7OF 1IZ8A 3NI2A 4FK8A 1E5VA 4KN8A 2OZUA 5AHRA 1VP3A 4BB5A 2J3EA 4R69A 4GE0A 1LNQA 3BGSA 1FPQA 1DEKA 3SFIA 1HW2A 1TA9A 3QLTA 1TO2E 4WNCA 1QGUA 4B6RA 1FFBA 5EJ4A 2PL5A 3OLQA 4A27A 4Y6LA 3I53A 3GY0A 3O8BA 2O0LA 4CV0A 5K7FA 4XB6B 3ZKWB 2LTPA 3DFMA 1GTZA 3L6EA 5J8CA 1HFKA 3TS1A 4P81A 1GT91 4RGXA 2PXCA 3BJZA 3FMFA 3P2EA 2BKAA 3C3YA 3GJZA 1JBEA 1ZR4A 3AUYA 1USTA 4XQ9A 3AEZA 4QFBA 2PGXA 4P34A 2C8JA 2IU0A 2M9HA 4F6LA 5CFLA 2XMPA 4IYRA 1Q1HA 3NARA 3V9AA 4TWBA 1R9GA 1C29B 4H6VA 2Y0SA 1UEXC 3IIIA 1LFPA 2QM8A 4Z1MA 4B4KA 4E70A 1WDMA 3FR8A 1GZ5A 4QXOA 4IJQA 1T36B 1LV7A 4YXWA 2LNDA 4R79A 4IP0A 1A31A 1DINA 3LY7A 1BDMA 1UKEA 1AQLA 1M72A 2XUJA 3E1SA 1O03A 1TE2A 5EGSA 3MWEB 4YR7A 1WXXA 4AWXA 4N3CA 1ULAA 2ICWG 1DZIA 2OBPA 2WWFA 3KKZA 2A9QA 4M36A 4QUJA 4JJ7A 2VUTA 3TSCA 4IUCS 2D62A 3PE6A 2XJ9A 3ICQB 5KTNA 2PXAA 1GFSA 2V8BA 1WPRA 3G23A 3U81A 2V6FA 1IZZA 1S3IA 4P7FA 3REQA 4AUEA 1SUAA 3KOXA 1IDZA 1CWUA 2HFKA 4DT1A 4DIFA 3VPSA 1JYFA 2YHIB 2DT8A 1ANKA 2D1RA 4C7MA 3H5AA 1USIA 2W2LA 1ODIA 1FVOA 2DQYA 4J49A 2XXAA 1TU0A 3LUFA 3GRCA 2Z6AA 1TU4A 2H6CA 4BY9E 5LC1A 1X9HA 2X6QA 2CNOA 2PWYA 1QQIA 2EZKA 4RPKA 3GJTA 1F06A 2PGNA 3HB9A 4S0XA 5E7IA 2F6CA 1SXHA 1LZKA 4MUBA 4XTCS 1JR6A 5JV5A 4ALNA 2GJ9A 2A0WA 4OL0A 4IDDA 1PF7E 2F9MA 1MVNA 2FMXA 4TUYB 3AK4A 3TD2A 1MO2A 2PTGA 2XT0A 3GYGA 1Y3FE 1N5MA 1ZRDA 1WGXA 5CCBA 5EIOA 2HPMA 1IXZA 3D2AA 3FVWA 1AUOA 4X7RA 2AWOA 2HU5A 3L49A 2XA1A 4MLDA 4RVHA 3BMXA 4FXPA 1T1JA 4C78A 3BR0A 5JQGB 4GPIB 3K70C 1X6VA 1ZARA 1FLDA 1U2GA 2A59A 2VPWA 3IAM6 1FTYA 3BSFA 5ALVA 3LGXA 4CR8A 1TA0A 2Y93A 3N97A 2I22A 4FLMA 1GPMA 3QP6A 4YFVA 1AF7A 3CX4A 4B43A 2Z99A 1IXCA 2ZJRF 1UBOS 3A0HC 3SSMA 1B14A 4FHTA 2VQ6A 4PX9A 2IIVA 3RYIB 2JFFA 4Q7LA 4LMPA 1NVVQ 5ILGA 1KS9A 1TM5E 4ZIRB 1V8OA 4FQ8A 1OXUA 4IUYA 1QGDA 4YLEA 2A0FA 2JJ7A 2ISSD 4BAGA 1Z0SA 2QMEA 1R5NA 2GNPA 1B6TA 2CDRA 5L3SB 4ZDIA 4DDKA 1WO8A 2D2XA 1UK8A 4RBNA 3DOFA 4R6XA 1UJ8A 3R8XA 1QVUA 5BSWA 4LJ8A 4M60A 2BKUA 2VP3A 2H9YA 3EWNA 5G0WA 3CX6A 2D1FA 4YFKF 1BS2A 4F2GA 4EB0A 4MKGA 3SLRA 1NFRA 4P82A 3LHIA 2M98A 2PGLA 4Q93A 2EU8A 1Y5RA 3W2TA 2XNJA 4FGSA 4C14A 1UHMA 1UJ6A 5AJZA 1OGJA 3UGQA 1B9MA 4KPGA 5GTHC 3GLSA 3ZE6A 3ZQHA 1LJ8A 2HF8A 3OIDA 2RGVA 1AO3A 3CCMI 2FSUA 1QG6A 1DX4A 3H5WA 2PMUA 4NC8A 4PO3X 4EG3A 1ULUA 1GA6A 1TEVA 4IIEA 1EZZA 4QLBA 4Y9DA 2YX7A 3VB2A 1AM4D 1ULBA 2B7EA 3GC6A 2JD1A 1ZXXA 4DNOA 2JDIA 3BTSA 3CTMA 3T9EA 4RTKA 2OCLA 4NZZA 2GARA 2ZRNA 1NW7A 2AD5A 3QU3A 3IMCA 4KSYA 3MEQA 1I24A 1PP4A 3U4AA 1H5UA 4LXHA 1JLLB 1Z82A 3FCEA 4JSYA 2O8DA 3F3XA 3Q2OA 2KS6A 1KVUA 1A95A 1CZOA 2FW6A 4S1OA 2JJMA 2EIJH 3ESYA 4Y6SA 1YZVA 1DQSA 5LMNB 3LFHA 4OXRA 1SR8A 4BX8A 3A9TA 1LI7A 3PUVA 2Z5UA 2PJRB 2G9NA 3O26A 5U9CA 4B8XA 1JJFA 3NH6A 2BP7A 3O84A 3EUHA 1B8PA 5DD4A 5JLXA 3OZVA 5BP7A 5BN4A 3LA3A 1JEDA 5DYIA 1R9JA 1RYYA 1MEOA 4GMXA 4YRQA 5I9IA 3W9UA 3GF4A 2BSAA 3EVCA 3VSEA 1GVDA 1DDNA 2B4QA 3F7NA 3VH1A 1YI2I 4MI9A 3AERA 5BO5A 1AZSC 4K40A 1Q77A 2RHWA 4OQ4A 3O38A 1OLTA 2GPTA 4JOBA 1B8OA 1FMWA 3EA0A 5JHUA 1E0KA 1STZA 5BSFA 4GMDA 5FYDA 3CCFA 3CLVA 4J03A 4V03A 1JQ3A 4I7EA 2QX4A 3WK6A 4PLFA 3LQQA 1AHHA 4MVCA 1ETHA 4F21A 2JIPA 4RSMA 1VSTA 3AZOA 2KP6A 2MW8A 3S7ZA 4CYMA 4D6XA 3PT9A 4JYPA 4EPYA 3LPLA 3CH6A 2QP4A 2XHEA 1NV9A 3IC7A 3EVAA 3T1QA 3KT3A 3IXLA 4MDYA 2PD3A 2P9TA 1FW8A 1M2WA 1GSAA 5DCYA 2A4KA 4H0CA 2A9VA 5C5EA 3FYUA 2HDNB 5L6MB 3BWCA 2P67A 1E0DA 3OE4A 4QUIA 5AI0A 1LBIA 4JX5A 3FDXA 2FW1A 4HLXA 1RESA 3QHAA 5LZ8A 2VXDA 3HV0A 2LIPA 3QA3E 3PU6A 4XLEA 4ENJA 3W7BA 4ML3A 1GVHA 1F5SA 4GXRA 4POOA 3D7NA 3S1RJ 3WRXC 2YWEA 3I92A 1CQWA 3O74A 3TM4A 1B9NA 3D4IA 1QH1A 4CR7A 4G37A 2A92A 2DODA 3HJEA 1ZNXA 3FBIB 4QFCA 3R8CA 3H9JA 5DM7F 4HZFA 3G0BA 2JD2A 1E3WB 2WSLA 4LHYA 4B4OA 5F52A 5KTPA 3PXAA 3QUQA 1W25A 5DULA 1NYRA 3OX3A 4ASUA 1QZZA 3AFMA 2EATA 1IVSA 3FXAA 3MKWB 2NXCA 2WFZA 1W30A 1VPTA 4RFVA 2FFQA 4JLJA 4FMDB 3VPAA 4GKKB 4GYGA 5EGOB 3KZ1E 1X1QA 4HDKA 3CU5A 2WEKA 4TLEA 3NANA 5EIBD 5FBWB 2WV7A 2ZKLA 3A6LA 1YRBA 4JP3A 1MAAA 3AUFA 3GCGA 1FP4A 3ZQQA 2DPUA 1XVAA 3G7NA 3VR5D 2C4NA 2IS1A 1DWPA 2GZ1A 1M9NA 4Q9NA 4FYXA 3LBIA 1CUDA 2E4AA 1PUEE 1F1JA 3JATB 5LBIA 1I2BA 2ZBPA 4MIOA 5IEBA 1GXSA 3LHFA 5JVDB 1DP7P 1FLAA 1IBLB 1YKFA 2GN6A 2H17A 1L5LA 2LXNA 4BO2A 3P0RA 1FZPB 1N2BA 2LV8A 2L19A 1ZR2A 2YUSA 3QIVA 4UFPA 1V47A 2PWAA 4PXYA 1JHPA 5IWAB 2F7SA 1XJWA 3VZQA 1KI9A 2YVKA 3DGEC 4FEGA 5B7PA 1WMDA 3E22A 3GUZA 1VJTA 3JWEA 5IC4A 3A26A 1GPWB 3E9MA 5K20A 2W4QA 4PSCA 1D1BA 1J0BA 4G26A 3OTWA 2C42A 1RQRA 2M30A 3FTEA 1ICIA 4LXYA 1YBHA 3H6KA 3HYRA 3HOZJ 1TUEA 3VI3B 4IQ0A 2O57A 3O4IA 3B8HA 2ZYHA 2EK5A 2ZCWA 3O4VA 3ZQ6A 1LK7A 2ZSAA 1GZHB 2GERA 3HKCA 3L9FA 1A82A 3IEXA 1TQIA 5K7SA 2G82A 4L22A 4I55A 3VJMA 4DIKA 5ALOA 5HQ3A 1DEAA 5INTA 4X84A 2Q4EA 5D01A 4O2AA 3PFCA 2KSQA 1SCKA 5FH9A 1B6SA 5H20A 3SC6A 2HCTA 1H9AA 3KB6A 2X2OA 3FCUB 3CCEI 2HKIA 5FAXA 2X0FA 3QTLA 2H1IA 3RBZA 1RBZA 5A2GA 1ZN2A 2M1BA 4Q3BA 4RESA 2BFEB 1V7QA 2P9QA 2AN3A 2PD6A 2Q9AA 2BR5A 3GFJA 1ZJ4A 3AY6A 5REQB 3ZZ0A 1TGYA 2AOTB 4FISA 2OQVA 1FBNA 3PQ7A 2EGUA 1T2AA 4PC7A 1TT5B 5EEAA 2HX1A 1VJ1A 1KDZA 3MIIA 3LYLA 4R2XA 4M0EA 221PA 2V79A 3WGMA 3U2RA 4KWEA 7MDHA 3A4LA 1CFZA 4XPZA 1A6IA 3HZJA 2VTEA 2DVMA 4IL6C 3DF8A 3VHXB 3BK7A 2YC4C 2JFQA 1GKUB 3QYFA 3FWYA 2QKMB 4IIVA 3KSMA 5JECA 1Q22A 3T1YB 1M5UA 1X7XA 2BGKA 4LJRA 3BOQA 4Y2UA 4BYYA 1FTQA 1WZIA 4LGMA 5LP6A 3R9IA 4JJAA 1XRNA 2NZ8A 2KLBA 3E6MA 5CVDA 3RSQA 2NO4A 3F8WA 1XZFA 1LGYA 1E7MA 3TLJA 1RZ4A 4OHVA 1DT5A 1V3QE 5BQ3A 1XNGA 1AU9A 1U0EA 5ECGC 5AK3A 2E87A 4IDBA 1GAQA 1YO5C 2QD5A 3T5CA 4IIXA 2I2DA 3U1TA 2ZB4A 4U6NA 1TFUA 3KTOA 1ZBDA 5BV0A 3ZE1B 4F5YA 5BPIA 4NAVA 2HW8A 4XLHA 1JKMA 1FTNA 4L7QA 4YK7A 2HLDA 1Y39A 4C6TB 2F8LA 2PSFA 4ESBA 1LDDA 4LG1A 4GT1A 2DMPA 2YWGA 4QTUB 1RPTA 1E3OC 4BY7J 1NAIA 2G5GX 4CI0B 2NXEA 5EMKA 2WYOA 4AD8A 3B6EA 1R5BA 3MQ4A 1ZIXA 5JALA 4GBMA 1X1AA 2XLCA 4D7NA 4LOAA 4IHVA 1MHPA 4A0HA 3BIOA 2YXPX 2CK3A 3O8HA 3HJAA 1Q1GA 4Q39A 5TLSA 1C7RA 4ENWA 3BCBA 3S27A 3HP4A 2LDBA 3VC1A 4ESFA 3PHBE 3L1UA 1OIWA 3MBKA 2IP1A 4HK4A 5CJ9A 4LWZA 5EQFA 4HQ0A 3ROGA 2I4MA 1P2GA 4OWRB 4M6WA 3UA4A 4GU5A 2P9ZA 3WTBA 2Z98A 1Q0QA 3R60A 4CG3A 4DNFA 3BE6A 2Q1TA 2UVQA 1EFPA 4KO4S 4LJZF 3HXLA 1MNAA 3BRSA 2BISA 1JTVA 3G3ZA 2Q7XA 2IIBA 1YO6A 2CWWA 3I58A 4Q1FA 1JJBA 3QXSA 2NSHA 5AJWA 1EBUA 4K46A 3D4NA 4EY6A 3RS2A 3OEWA 3OLYA 3ZE0B 4BC0A 2PUAA 4CEJA 1N5RA 3LLCA 2H54A 1THMA 1N32B 1LBHA 4OA5A 3LV8A 4DG5A 1ZKGA 2XSZD 4KT5C 1TPYA 2WB1A 3MTGA 4GGMX 4ND3A 1NVXQ 2QTCA 2HYFA 2J41A 2CXHA 3BS4A 1GPYA 3DVRX 1KEKA 3CNHA 3LWZA 5IG2A 2NU9A 3GLLA 1RSZA 2ATIA 3N8IA 2L4AA 2FUG2 4V2GA 3K09C 3V1YA 2MYSA 2J3MA 2FWNA 4ACAA 2EARA 1OISA 4C03A 3AVVA 2UV1A 3VZDA 1FTWA 1PU2A 1KKUA 3ZWAA 4IXTA 4WK4B 1IM8A 1L1EA 2JJ1D 3ZLJA 5I5EA 2GM5A 2BM1A 4BDYA 3BZBA 4FX5A 4POAA 3B3GA 4LHZA 4ER5A 3FUTA 3L84A 4LYHA 4ZT2A 3W6PA 4CGZA 1E4EB 2APJA 2R7UA 2XAHA 5JAUA 2HBYA 1XE3A 4P9UA 3U40A 1MRSA 1M75A 3LXUX 4JIGA 2O2DA 2LRDA 3VZRA 4FC7A 1P17A 4CKYA 1Q11A 3B6IA 3LNTA 2FKNA 2PGDA 3ZHRA 1I6XA 1MJNA 3O93A 5T4HA 5BUCA 4R5HA 2XOXA 2QD1A 3UMBA 2DPHA 3QAHA 1IH8A 1ZMOA 1PNTA 3MWKA 2Y75A 5B1HA 3ZKAA 1RLIA 4CCJA 4QPDA 4CODB 3K9WA 1KQNA 4EYKA 3ZQIA 2O8FA 3FMIA 2Q6TA 4IM7A 4V0OA 1IN7A 4KEAA 3FIJA 2IYOA 1BS1A 3JQGB 5C32A 2PV7A 2C2OA 3A32A 2H1LA 3PIIA 4OTZA 3I1YA 1QE3A 1XSDA 5KYUA 1EE9A 1XZIA 3VPFA 3E1GA 3D6MA 1IATA 3M6AA 4ETSA 1X7GA 2AOUA 3EODA 2I7CA 2EW1A 4EG0A 2DK8A 5T4FA 3KR0A 3CKMA 1PVEA 3LDFA 3L41A 3SZLA 4W8GA 3RFFA 4K9NA 5DCWA 4YJHA 4DVJA 2I3GA 4ZC1A 1QBJA 2J9YB 3AGQA 3W2AA 4G0XA 4L6AA 4ZYZA 3E3AA 2AXQA 3HN7A 5KWSA 1D1SA 1BR2A 2VJ5A 1GAWA 4MHOA 3F0CA 1YR9A 1H2FA 4MYRA 3L4JA 1QQTA 1Y3IA 2R86A 3KPJA 2ATXA 3L40A 1PQUA 1HURA 4RANA 4PAQA 4UEWA 5IJ9B 3L0YA 3ICCA 1VE5A 5F3DA 3OIUA 1KZ9A 3EIUA 1EJ0A 2R6FA 3SY8A 2Z3YA 1D04A 3NOQA 1AB6A 3D0OA 3GEHA 4TS3A 1RKQA 3JSAA 3LSJA 2M8EA 1MOPA 2GA1A 2D2EA 4X1KB 1U28A 3AR8A 5CLFA 4BFTA 3FHNA 4RSRA 1Q7EA 5CYPA 1US8B 1CF7A 3H0DA 3PJGA 5JDCC 4ARZA 2LRHA 5H3LA 1YJXA 3OL3A 2NOJB 4ABZA 1P5FA 3AU9A 3MJ4A 4BUJA 2CMKA 2D0DA 4WESB 1QC5B 4M1ZA 3BK1A 3MQ0A 2Q2EA 3NWPA 4JJFA 4NL4H 3S3OA 2IZZA 3WU0A 2DR3A 1EZ1A 2VDLB 2QTNA 2VCHA 4B79A 3PGKA 1P4WA 4YRTA 3MPOA 3RTBA 2VYVD 2GEJA 1O7LA 2IHVA 4ZANA 1RC8A 4X7BA 2BFCA 3GA7A 2GAJA 3KIPA 1JDSA 1JDZA 4FYIA 4D3ZA 2FLVA 1FMFA 2B8NA 5K0JA 1IIRA 2GFQA 3L7BA 4GZLA 3UC5A 2DOEA 3W06A 2VOPA 4BO7A 3KJZA 4EMBA 4W5JA 2AMJA 2H5JA 3IPXA 2A3RA 1R5HA 2QLFA 3HOYJ 2DFTA 4FDTA 5IH7A 1D5YA 4I50A 3OCWA 3T6KA 3KZVA 2DPGA 1M1XB 1AS3A 5I7RA 3IRQA 2Q6KA 4QJ5A 2FX0A 3O4JA 1P6UA 1PHRA 1N6OA 1WPKA 2NYRA 3KCCA 1A5TA 1FX1A 5B5EC 5JZBA 4K8RB 3J81K 1RPNA 3IAS2 1I7DA 3WGIA 4ENPA 1H66A 4P53A 3S1QJ 5CCEA 3CF4G 1PV4A 2CFRA 2Q3MA 3P9ZA 1QFZA 5JZMA 1WUKS 2QQEA 2EZHA 1ZHOA 2WA2A 2K40A 3PQ3A 4UXIA 4NE7A 2QU8A 2FSPA 2E82A 4S35A 5KC8A 4JJ4A 2C58A 3NORA 2G3YA 2FWPA 1XQ1A 3GNTA 1TQ8A 1GG5A 5I7UA 3FMOB 2GN0A 4FHEA 2BEWB 4H7PA 2IWRA 4BB9A 2ONJA 2A3NA 1U2WA 4GX2A 4QGFA 3GUUA 3IMFA 2CC2A 2RREA 3UG7A 4ZYAA 1B26A 3BM5A 1NUQA 2Z5FA 1QMGA 1ZC3A 2XOKA 1DXHA 3RYRA 3S17J 3VAZA 1XRMA 4LXUA 3B1KA 2RH8A 4FR2A 1V5FA 3A4YA 4ZJUA 4Y30A 1LE8A 3FDIA 4CF3A 2AFVA 5DM4A 1YFJA 1IZ0A 1R4NB 4TYMA 3BXOA 4JP5A 4RPGA 4AKHA 1SAUA 1YW9A 1TWGJ 1IRGA 5BNWA 3T1BA 2IUFA 3SG0A 4Z0PA 4JGBA 4QDKA 3LX6A 4RPIA 3A1FA 1B0AA 3LA7A 4EY3A 1ZN8A 1TGVA 4I1VA 1KFCB 3DFZA 2AF3C 2VTBA 1ZIYA 3FYHA 5K8VA 5DHQA 5JH7F 1M1YA 1SG0A 3FGNA 4EPWA 2CU7A 2Y9ZA 1PR4A 4DMKA 3ZD9A 3DAPA 3HUEA 4HXEB 4B5LA 3AHGA 2RC5A 1XZKA 4RGBA 3ZX4A 4FYWA 4A8TA 1GV5A 1E5DA 5AT1A 2G09A 4OQMA 4OXNA 4HAMA 1KJYA 2OV3A 1NJGA 2AE1A 3DTNA 3MD0A 1LRJA 4W6QA 4DJDC 5T4BA 4M1TA 4U02A 3TLZA 2SBTA 5C4GB 3KQOA 1T8IA 3T5DA 1KRHA 2F5FA 3LUCA 3OLZA 1UT5A 4RULA 3EX7C 3H5OA 2G04A 1BH2A 1YKGA 5K6RA 1NXXA 2XUGA 1CJCA 3B70A 4RBOA 1T25A 3BG3A 4FDLA 3NC1C 1DJMA 2VOEA 4UD6A 1SOWA 2HMVA 1URPA 1A8HA 4B47A 2H2HA 2IUSA 3AIKA 3FOEC 3NQOA 4OMZA 4AY3A 1N5DA 2PX0A 2CYYA 3KCQA 4EB8A 4HNUA 1C0WA 3HBLA 1N2SA 4H4EA 4NKRA 5K0ZA 1NA5A 4XIJA 1JDBC 3A10A 5AJTA 2WHQA 1L8AA 4DQXA 5EIXA 4FE7A 2ID8A 4NOLA 3CW2A 1F2TB 2JH8A 4ZYVA 2QGUA 1LB2A 2YYYA 1EBBA 4ZVUA 5AW1A 5BURA 2IXGA 3CRVA 2IHUA 3K8ZA 4OOEA 4EYOA 3DOUA 3Q8KA 3I04A 4CF5A 4UQOA 4G8CA 2P1ZA 1BE1A 3IOMA 4NYJQ 3AL0C 3MILA 4MV5A 5H4HA 3SFZA 1HZJA 4HYQA 1U6GA 1CQIA 4JU9A 4YAKA 4XN0A 3CM0A 3RIXA 1WI9A 1L5KA 2K9NA 3K2BA 4D99A 3CUEF 1W75A 4RPCA 1I39A 4J3NA 2QM7A 3MXOA 1MGOA 3B2NA 3N8KA 2ZYWX 4JA2A 3DF9A 2QUJA 2G36A 4WZAB 3WGVA 4KNYA 3SS8A 1BW5A 1HL7A 4LVUA 3A01A 1DUSA 5E0OA 3WV5A 1XGNA 1UMBB 5C18A 3EUEA 4Z51A 4HSTA 1N6PA 2Z1NA 2NOAA 2OCPA 3MTBA 3R1IA 4HNRA 3TO9A 3U7QB 4RKYA 5FGMA 5KHDA 2J3QA 1IRFA 4CXFA 4LA4A 3NUQA 1XIVA 3CLUD 5F08A 2J45A 1AO0A 8ADHA 1EINA 4Y6QA 3M82A 3EPPA 1PEYA 1T3SA 2Q5JA 2FLKA 3NKFA 5EXTA 2Y05A 4AJ4A 5TMEA 3TO6A 3KO8A 1HTTA 3FXUA 4FTWA 1E2PA 2XMZA 1IZ9A 1ICEA 4ZO4A 2ACVA 3J80Z 2NU7A 1U0GA 1Z83A 3GLFB 3ITEA 5FBVB 3LUHA 2YHAA 5DB4A 3PD1A 1UMKA 3IILA 4GZ5A 1GEEA 4IDEA 2H48A 3DAYA 5DLYA 2NLOA 3NIBA 1OKKA 4HSGA 2YOHA 4MUNA 4BQPA 2WPDA 4ILEA 2X9GA 2OENG 4BEBA 4RLHA 2X6RA 1Q0SA 3OZ7A 4E88A 2OQRA 1JEEA 2QG4A 3I1JA 4GR5A 4U9IS 2TYSB 1FE8A 2CEAA 3HG7A 4U7WA 3CA8A 2HYGD 4X66B 5TQ2B 3SC2B 2ZI3A 1IBSA 1QKIA 2IA5A 4L9WA 1XLTA 5H7XA 3OEEA 4YJ3B 4HAOA 3VPCA 3RSLA 1DHTA 3PUJA 3K05A 3S1LA 3A7EA 3RKSA 1IHUA 3ND5A 1T36A 3IUMA 1L4LA 2P0EA 1X39A 1ZG1A 1YQQA 1VMIA 2ORED 2FMFA 5AM4A 1L0OC 3TLCA 3IH5A 4Q18A 5HUHA 5FROA 1GIAA 4DA7A 4EJSC 1SG6A 3R20A 4GWKA 1SXJE 3AI7A 5I3CA 2C3UA 3CF4A 3UANA 2QA4I 1ISGA 4J4HA 3ZK7A 3MWEA 1M0SA 4YREA 1N7GA 4ZHQB 3NYRA 3ZWVA 4MQVA 1RJFA 2PDAA 3BWDD 1YCDA 3F78A 4XD7A 1RQXA 1QOZA 4KXFB 3F5FA 3ABTA 1I3NA 1BE6A 1G5RA 3KOZA 1G0OA 4CTJA 4Y0AA 3QFHA 2JIZD 1IV8A 1E3DA 1IUKA 4P4TA 2XVAA 1MJBA 4K2AA 1F0YA 1VGQA 2YHIA 4YMVA 1K61A 1MBJA 4ND4A 3R5XA 5BMVA 2DBQA 4FYHA 2PV0A 2BSXA 2QN3A 4TQAA 1DAFA 3H1EA 1ZLJA 4G5XA 4QDJA 2P2GA 3KNZA 4ZAZA 1N4AA 4UJ3A 3NEAA 4HGYA 3W9BA 3SE0A 1EB9A 3EPJA 3MERA 4Z2YA 3AKYA 1ZH2A 5ENDA 1RQ2A 2XB6A 1LDNA 4F4JA 1E94E 2NXNB 1S01A 2PI0A 3GUDA 3W04A 3IV9A 3KWFA 4RKEA 4GOND 4Z6KA 3AVTA 3BCHA 4L8VA 3RQIA 2EQ5A 4CN8A 4ECEA 1S72I 4EK9A 3KSDO 4QEDA 3UK6A 2GK6A 2PGAA 3KKMA 5G53C 2XVYA 3A3PA 1KXJA 3PUBA 1Z5WA 5E9WA 2JARA 4IFTA 1KO7A 4NQWB 3MJDA 5T8KA 4X1IB 4QSHA 5GJWC 1TCBA 1HE8B 4A3DJ 2EFGA 3LAJA 5J23A 5CYGA 2QHXA 3IH3A 4D7MA 2C78A 4ZRDA 3V4ZA 2GQ0A 3U39A 4NZOA 2B4YA 1L5RA 2V1UA 2KLHA 3AEKB 4QAJA 5IJWA 3RYIA 4DCJA 4R3NA 4CETA 1Z39A 3GI1A 5I3ZA 2Y92A 3H3UA 3RYPA 1S4QA 2AR9A 1F3LA 2COKA 3Q7EA 4ZIRA 3OCZA 1IUPA 2QMQA 2GCOA 4MVJM 2CKDA 1ZGWA 1WTCA 1IPHA 3F47A 2QN6A 1ZVKA 1E8MA 5K03A 1O6FA 2AI3A 2ZJAA 2AFRA 4HVAA 4K6HA 2IOFA 5F77A 1FOEB 5C7OO 1PUJA 1N3IA 2V7XA 3IQHX 5ALIA 1BBYA 2O05A 5D87A 3QEBZ 5ETJA 5TF0A 1C3OB 3KQNA 4M73A 1EIZA 1BQ4A 3AR9A 3RGGA 4GZ3A 2VP4A 2Y0CA 3QBDA 4WL0A 4S2EA 4AF6A 1IM2A 4CMIA 1KOLA 1SNYA 4PJLA 5JROA 1RIIA 4RC9A 4B3TB 5KSZA 5B1BH 3KELA 4KIGA 1QOPB 4NNPA 4K8OA 3QVWA 3UAYA 3OCJA 1MDBA 5DOVA 4BV8A 4X20B 1KSGA 1W5TA 4UNRA 2D5IA 3K2AA 4NB5A 4A15A 3NBYC 2DA1A 3OIVA 5JCOC 3N28A 1OTYA 4FX2A 5GTIC 2VJAA 3KD3A 2F43B 2OCAA 5BSTA 3ECAA 1AGNA 4KQGA 3QJ5A 3RFCA 1H88C 3VNVA 3A1NA 4E7SA 2Q1UA 4AO7A 3EW9A 1JQ5A 4U2FA 1KYIA 4TSFA 2FPLA 4BACA 1JLLA 4AYXA 4F97A 3CO5A 3THYA 3VU8A 3C6ZA 6GPBA 4IEJA 3LH5A 4HBGA 4QX6A 1QGYA 1TI7A 3PHHA 3J7AO 5CDSA 3QP9A 3LNQA 2GK4A 4JIMA 1U2PA 4Y2XA 2WWIA 4X0EA 4AQDA 1XP5A 4KGZA 4DV1B 3L6UA 2PJRA 3V8RA 2ZSEA 5F1KA 3PJFA 4PO1A 4Y15A 2Y8EA 1D2EA 1G3TA 3JYHA 4XL9A 3EJWA 5LN1A 2Q3FA 2ZYTX 1IBRA 3TB6A 3OZCA 1QHHB 4RK6A 1WPXA 5CA0A 5IKOA 4ZOCA 2QROA 2YJ4A 3P97A 1ZOLA 1NXSA 2D13A 3ZVNA 1U0SY 3PXBA 4MWTA 5H9WA 3QKWA 4F8EA 1FDTA 2Q5CA 1IBMB 4J0EA 3EXIB 4YCBA 4TVOA 2R7QA 3TKYA 2AZMA 2ZM6B 2OD5A 4XWAA 3GEBA 1BC7C 5DT2A 2VR1A 1Y7HA 1PJ4A 4CQLB 4CQNA 5J1UA 3EGDA 3T7SA 1XTTA 3IHWA 3G5MA 2PD4A 4GFBA 2I2AA 5JJBA 4YRIA 1TZJA 1HETA 4E13A 1YZHA 1JZTA 3CXRA 2G1KA 1NFFA 1VJRA 2PL3A 4A2UA 5E79C 4P38A 5IKMA 4Y3OA 2XZPA 2P3QA 4BVAA 2CBXA 1Z4JA 2L0KA 5CCXA 2LFBA 4D2IA 2PO5A 3NNNA 3E2IA 3G4SI 2REOA 3U4CA 4RZSA 3AV3A 1J21A 5CH5A 4ZCMA 2ERYA 2RI0A 1XCGB 3LKVA 3F3SA 4M8KA 2ZJ1A 5LZ7A 3VZSA 3N5CA 1F9AA 5B1EA 4FCTA 4YP6A 4OIOF 1Z63A 5E3MA 4B71A 4HT3B 2OMEA 4L08A 3WRYA 1QB8A 3WB2A 3QNWA 2JN6A 2XCOA 2SKEA 3KUKA 2OOKA 3AL2A 4ZRNA 1XQ6A 3QU7A 3GZJA 1QFXA 1V5GA 4D1YA 3BN3A 1LF0A 4ABYA 1XC7A 4PPFA 3RUIA 1P81A 3T5AA 1MCZA 2H2FA 1ZEMA 3LKDA 2ZYDA 3T8YA 5IKEA 2AG0A 5F1YA 4U00A 2PN6A 3B6KA 5DSZA 2ZMEC 3FLEA 4HDMB 5D7BA 1NQOA 3PFWO 1MB0A 1TJ5A 1UBFA 3CISA 4FN5A 4CCYA 2DFEA 2W11A 2X48A 5JTTA 3EDPA 5EQTA 2AFIE 3Q8WA 3TSZA 2VPPA 3VNUA 1NBWB 4L0DA 3FTNA 1J0AA 4IDHA 4UATA 1XCMA 5EGOA 5TVGA 3GLXA 3GP3A 1YHNA 2HQNA 3J7YJ 4Y1EA 1QH9A 2V96A 4HGRA 2FUCA 2H1FA 1CZNA 3VU9B 4YUWA 1TADA 4J1NA 1J8QA 4HWSA 1Z67A 4OB7A 1VF9A 1R6BX 4IGIA 4QJBA 5KHAA 3LT2A 4J3FA 2IEKA 5P8WA 4RDXA 2OSVA 3JATA 3SYKA 3NZEA 4G5YA 4RE6A 2IXAA 2XUOA 5DN6A 1FT9A 2WU3A 3LRTA 3TNJA 2IYNA 3ZQKA 1WOYA 3GJ0A 4MS4A 4A23A 3GF2A 4BBSJ 1H0MA 2YIMA 1DKUA 1JFFB 2A9JA 2IITA 2XCUA 3GEDA 3MKYB 1Z08A 2CNNA 3E0XA 3BJIC 3C6BA 3KP2A 1OHHD 4EJ0A 2JCVA 4Q4HA 4LLNA 1DMSA 1WUIS 3I0TA 3OJXA 1RI1A 5THQA 3ZHBA 2NPIA 2BE7A 5PNTA 5ICMA 1YZFA 3EMKA 4CMCA 4F9FA 5NULA 4YT2A 2XE8A 5CA1F 4DM3A 5KKCA 3DVAA 1T2NA 1RT9A 1E59A 2GH1A 3U13A 5EZHA 2NNNA 4KPFC 1A72A 3CUTA 3ABSB 4DZZA 1NSFA 3X1WA 4ZYTA 1JJ8C 2ZETA 4G86A 3C87A 5AK4A 3EQZA 4GNRA 4AN1A 1C1HA 5DM0A 3WYCA 3PIDA 1D3YA 3NDJA 3LHSA 4OINF 3U09A 3R5JA 3H1FA 3CZPA 1NM5A 5JWHA 4ZCSA 3LBYA 1HEIA 3B1ZA 3WWYA 3SHTA 1WLSA 3I9LA 3HRMA 4GDMA 3K6KA 5HTOA 1RADA 5A9TA 2UVDA 4LHSA 4IIUA 3QFFA 2GEFA 4XVRA 1HXDA 4CQMD 3K4HA 1OU0A 3I54A 2G9UA 1YJNI 3T7IA 4DMMA 3NUZA 1G7SA 3MZYA 2TMKA 1DU6A 5EAIA 2YMPA 1EH5A 5B6IA 4MTCA 3JR7A 3HOXJ 4TL8A 1UK9A 2BFEA 4D41A 1MB4A 4NH4A 4LF6B 5REQA 3BBPA 3WZLA 5THKA 3K9CA 2C5BA 4XA8A 2YFQA 3CKLA 2IYSA 1U1FA 5FTMA 1A7KA 2X2PA 3GFVA 4XOTA 4RHFA 3DL0A 4IF6A 2ZJ2A 4Q4DA 2A86A 2XEXA 1GLNA 5CTJA 1I6HJ 4ZXPA 4BKUA 1KF0A 4KRXA 5HDGA 3FZGA 1QAQA 4FXOA 2PVCA 5SICE 4A16A 1MIOB 1FRZA 3VHXA 4BO3A 2EIXA 1NYLA 4XCXA 4IX1A 1PTJA 1JJVA 3FNQA 3WGKA 3IHUA 1WAMA 4RKRA 3JQ6A 3JZDA 3C7CB 4MINA 1L8OA 2OR3A 3IHLA 4ZVOA 4IHJA 5ABPA 2Q27A 5LQUA 1OZAA 2EFJA 3E9EA 4LGYA 1UQTA 1XEWY 1EP3B 1BTOA 4OL9A 2VWHA 2YKGA 4QT4A 2E2HJ 1IDN1 3USZA 2QY6A 2XDVA 3KQYA 1U4SA 4N8SA 4L74A 1B8IB 4OPMA 5ANRB 1RU3A 3D1JA 1JI8A 3KB1A 3NW9A 3WLFA 3K4NA 5F5XA 2X7JA 4QWMA 4BDZA 2EERA 1VG0B 4E7OA 3ZHCA 3U6BA 1WNFA 3UCFA 2F5DA 4YY3B 3MF4A 1QQ5A 3K8QA 2LKXA 1NH3A 1BCSA 2JCYA 5M29A 1D9XA 2BLLA 4FOSA 3MS2A 4CDNA 4M8SA 1GRRA 3K9QO 3PVSA 3MOSA 5I51A 3ABLH 1I9CA 5CM9C 3ZR4B 4IOLA 1XA3A 4BNHA 5EG0B 3WAGA 1O6BA 2IW5A 4EJUA 1A2BA 4MUGA 2CQ7A 2G7MC 1UBSB 4D4LA 2Q0OA 1QV7A 2PMHA 5FOSA 3DMNA 3KPYA 1K0UA 1JU9A 5TISC 1W88B 2H9IA 3MJSA 1ZEJA 2VL7A 2ZBVA 3ER6A 4WCFB 3TCKA 1T6XA 1DWOA 1I27A 2HBRA 1YDWA 4CRWB 4PVCA 5I7FA 4MPDA 1K6OA 2OBLA 4EDFA 5D1HA 2ZKIA 3TR5A 1OFUA 1Z33A 5HMMA 1WXEA 5MN5A 3R6GA 5HXAA 3AQ4A 2OHHA 1W94A 3PUKA 4BNZA 2WU1A 5EIWA 2EBHX 4UE6A 1J22A 4TRNA 1W4BA 4E11A 2ZYVX 1G2QA 2DTEA 1XB2A 1ECPA 4DLNA 2FGKA 4JU8A 1PT9A 3H18A 2QPLA 4AJ9A 1X7HA 2KBEA 3ZY4A 4Q4CA 1CUBA 2RHOA 2X9VA 5EZGA 4OYRA 1W73A 1X8JA 2V5VA 1NTRA 3R2JA 3L8DA 4DSUA 1ODSA 4C0JA 1VE6A 1E58A 1O95A 3VM6A 2JGJA 5KYWB 4AVPA 4QZVA 3QELA 3HXTA 2BN4A 2R7LA 1SC3A 3EZ2A 4U3JB 3CW9A 1MENA 5DP1A 3C5WP 2EVWX 3MB5A 1X8LA 1L9KA 4Y2SA 2P5KA 3DBLB 1G20E 4YJ2B 4ME6A 3OIPA 5BYJA 3FLAA 3QW2A 2VF7A 3EA5A 1F4VA 2JEZA 2K4JA 4EA9A 1E4EA 5HE8A 2XAAA 3H6HA 3CCYA 4UCXA 2BM8A 3IPRA 3KEOA 1IQUA 3D0QA 1UUFA 1ZVMA 2LW7A 4ZYUA 1QO7A 2B35A 2XYQA 2ACJA 1ZOSA 2W7TA 1M2FA 3SR3A 3H9UA 1Q3KA 1H2ZA 4E12A 4JX9A 1OU4A 3JQ7B 1D4AA 5FV7A 3ES9A 4EPTA 1CBUA 2WIDA 1TIPA 4GVPA 3ZWDA 4KQ1A 3G7SA 1VMKA 1EM8B 4HRYA 3PQEA 3BGWA 2E19A 1GL3A 3GFMA 1UH5A 4NCJA 5JAOA 3LFUA 4K7JA 1XHFA 1X19A 4N39A 1H94A 3ULKA 4BQEA 1MQ8B 2Z5LA 1WL8A 4LX8A 3VMFA 3JQGA 3TLEA 2VPYA 1YAJA 3ASNH 2HA6A 2VPTA 3R40A 4C9BA 4C2TA 3UEOA 3PZBA 4TTVA 3FVTA 1BO6A 1VP9A 1GCOA 5EWLB 1E3LA 121PA 4Z5XA 1YASA 2WPNA 2WYVA 2UZ0A 3R77A 1F3OA 4JS0A 3C85A 2L9VA 2JW5A 3QKSA 3WIVA 4TT3A 3C3XA 3RROA 2FHSA 3H5TA 4DBLE 2AZTA 2P2CA 1EFKA 3G85A 3FPSA 3K4MA 2JGMA 2W25A 3M6XA 1BI1A 4DSAA 1TO1E 2BFWA 1A71A 1P7CA 2ISQA 2WM9B 4AS2A 4TLLB 4DPKA 2IQIA 3PFIA 3V80A 2NTEA 5JDIA 1MABA 3JVDA 1K4YA 2OA4A 5ALFA 3MMNA 4UAGA 4GYWA 4LFAB 1MJGA 1KS2A 1PK7A 1ETUA 3IMEA 4HX7A 3CNBA 1RWMA 1RW4A 3ZZMA 2WG2A 3KU4A 2X3YA 1YW8A 1S7EA 3B73A 2MD0A 3JARA 3K7EA 4C3UA 4W9MC 4YP7A 1LUAA 1OB5A 4P3YA 4B3XA 4WFJA 1KMIY 4YUAA 3IE1A 3MAGA 2HVQA 1O7FA 4N5IX 4TMTA 4YCLA 3NHFA 5AVJA 4A0GA 2QRLA 3UAGA 2XW6A 3CDIA 4X1KA 1RIFA 2H1HA 2A5YB 4MMZB 2W0SA 4ETNA 1JF8A 4MR9B 1P5RA 3E6CC 1KI8A 1S96A 1CR1A 1E9RA 4U7TB 3U4QB 5AD1A 1PFKA 1QS0B 3D5SC 2H0RA 2P7CB 3DDZX 1BNCA 3JWJA 1FFCA 4GNKA 3FOBA 1QC5A 1XZMA 4D26A 4D5GA 1LPOA 2VHWA 4X97A 3I2KA 3U80A 1JS1X 3LYHA 2OORC 3MYRA 3TR6A 3T7JA 3B02A 1JNYA 1SOMA 4ZZIA 4OK5A 2OCDA 2IK8A 2SCUB 4HDRA 3C3KA 1Q17A 2NU8B 3D6UA 4BO9A 1CW2B 4YXFA 3S5UA 3Q4GA 1QO0D 2MG4A 1SHLA 4CLOB 4JI7B 2OKCA 2TECE 2XUQA 5ERIA 2M6KA 3FPCA 4DDUA 3K9TA 1J99A 4ZCRA 4YIFA 4LV6A 1GTG1 1P74A 2YX4A 1E3IA 3U7FB 5KAPA 1ZAKA 5I01A 4JQFA 4XYLA 1LDGA 2GETA 1QP8A 6ABPA 5CR9A 3W77A 4JYCA 3V8QA 1W7AA 3QXCA 5CLLA 1P4SA 3ORQA 4BB6A 5JC8A 2JJQA 5E2BA 3P19A 5CBPA 4YRKA 1BFDA 3AM3A 4Q9DA 2PRIA 1CUFA 1XPXA 4M6YA 4DYHA 1Q0UA 2DQZA 4F4HA 2N1BA 2Z6UA 4TVKA 1X7DA 2XTJA 4BEHB 2QPTA 1FU4A 1I50J 3NFRA 3A6EA 1ZCBA 2W6ZA 4G65A 2IGKA 3M9LA 2ZW9A 4FGKA 4A3IJ 5D00A 5C1PA 4MLPA 4ARCA 1CLEA 2VBGA 1D9ZA 4CO8A 1UPUA 5FRDA 4UCWA 4C3HJ 2FU4A 1QBKC 1Z8HA 2EKQA 3W2IA 1J2JA 5JO9A 3N53A 4MEBA 1EUZA 2CSOA 3D54D 2CMDA 3GNLA 3W5IA 4DJAA 1U6JA 1OLXA 2NTJA 2A0KA 4HDAA 1ZX1A 2WM3A 4I5GA 2C4VA 3ONEA 1UC8A 3FOFC 5JCJA 4DEXA 1QO9A 2P40A 1V3FA 4W9NA 2HXYA 5KX5A 4K0KB 1B4DA 4ZOLF 4DREA 4Y2TA 2WAQN 1M2GA 3NT2A 5AOAA 4G25A 2GIVA 3IVGA 4HR7A 1BQ3A 2CQNA 4HB3A 6YASA 4EATA 3O90A 5FI5A 3HJHA 1XG1A 4P2BA 2E7WA 4EVQA 4MVJE 2XR1A 1KQPA 3HCFA 1XDUA 3L9WA 3GPLA 5ED4A 2YJNA 2VJKA 3TZ6A 4XSHA 3HB0A 1R6XA 2ZTHA 4C3IJ 3URKA 4B40A 4CF4A 4F56A 5B3SH 2JS7A 3GK3A 1SCNE 2OQIA 1A9TA 2GEUA 1T8TA 4B9EA 2DG2A 3AUJB 2W82A 2VPQA 2IGNA 3IRVA 4I4NA 2QW8A 4U8GA 1CJTC 5FFMA 2QXYA 2QA5A 4MP3A 1I32A 4OU4A 1ZG3A 5CGZA 4OSEA 1Z2AA 3CMCO 1WMEA 4YG2F 2C5LA 1Z88A 2NNWB 4KITB 1M3SA 3FXKA 1QPIA 3E6DA 2ZEJA 2KISA 3BRCA 4AW9A 4CQJA 3K31A 2E85A 1V4RA 1RZVA 3WADA 4XJSA 1O3QA 2IOHA 5L3DA 1Z0FA 4BJ3A 3OBIA 4XR4A 1F2TA 1JLHA 2CUNA 2QZJA 1M7HA 2OB1A 4KP7A 3MWGA 3RUAA 1G6NA 2KZVA 1LTHR 1MFZA 3SQMA 2QE7D 5KVRA 2AH5A 3OX2A 3FM3A 2H27A 3CEPB 4UZSA 3KWMA 3KYDA 5KKAA 3TLBA 4YECA 1NW5A 3U56A 2FSVC 4OQPA 2AJTA 1XTJA 1B0UA 1E5QA 2PS9A 3CRW1 3TYXA 2OO7A 4DBLC 2OBNA 1SCDA 5EMNA 2KJCA 3P5BA 2P9JA 2FE4A 3UQYS 2EDAA 4PZEA 4M38A 3OQJA 2FUNB 2V0CA 5KDLA 2BHYA 4MOWA 4Y7NJ 1JKPC 1TCVA 3A4NA 3HUTA 1FFYA 2A67A 1NRXA 5CQEA 1U7HA 1B2LA 4F2HA 3FNHA 3JX9A 1P7ZA 3G5UA 2F3UA 4ZQEA 2I4NA 3W6KB 2ASVA 4RB2C 3JQCA 5KNBH 5P21A 1ZK1A 5JG7A 4FT2A 2ZBQA 3LOPA 2GPJA 2G4VA 4MNUA 3QXXA 3AI2A 3GUCA 5CKTA 2R7WA 3GZNB 1WJGA 3UK2A 1QZXA 1TQ4A 4MNTA 5DHTA 1G17A 5LHHA 1H0HA 4DA6A 1XZCA 5L3BA 1R1VA 4V0KA 2WNSA 1TTPB 2QNRA 4ZZ3A 2CJYA 1O94D 4M49A 1CR0A 4MW7A 3BY6A 1JAZA 2PLYA 3JQPA 5HQTA 2FHPA 1QFMA 2FW9A 2JI4A 2OV6A 4E5DA 4FJ2A 3DQQA 2VQLA 3K5WA 4LI0A 4LRXA 5AKLA 3DBHB 2NRAC 1LLCA 2BYVE 3VYUB 2CLOB 2DEUA 2FB9A 1X3SA 3ONFA 1LB1B 2F1KA 3HL4A 3ZGYA 2YYZA 3QU9A 2MSCB 1UWKA 3ZMUA 4O5VA 4R2KA 3PPXA 1CY1A 5KPJA 3TDKA 3G1TA 2E4VA 2D06A 4O1IA 2N1MA 3M8EA 2UYQA 4DG9A 2YZMA 1L4BA 9ANTA 1X70A 4EY4A 2MYNA 4E1BA 2QE6A 2QM0A 1B1CA 4PW0A 4KA4A 4YAOA 2GESA 4PLVA 1OCPA 1JPUA 3IDZA 2K3PA 2BCJQ 2WWXA 3VVBA 4ISBA 2X4IA 2CFCA 2X4GA 3OC6A 3PXUA 3QBVA 1LQUA 3J81A 4Z54A 2GZRA 4XWYA 1N6NA 3K0CC 4IXDA 1DO8A 4YP0A 1YTUA 1YZGA 3UHPA 1DLJA 3KAJA 5DOZA 4FHGA 4BGIA 4F2PA 3A4CA 3BQ9A 4M2LA 3SC2A 4AMBA 1JNXX 3LZ6A 1H2BA 1IO2A 4IO9F 1KR5A 3QSYA 1MH4A