4EVIA

Crystal structure analysis of coniferyl alcohol 9-o-methyltransferase from linum nodiflorum in complex with coniferyl alcohol 9-methyl ether and s -adenosyl-l-homocysteine
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
368
structure length
360
Chain Sequence
MDAATAVELLDAQPQVWHHFLGYINSMTLQCALELDIADVIHRHGHPIPLNQLAAALEIPQTKAPFLSRLMRMLVHLGYFTQVITKLPSYWLAPLSRLLLKQNPYNARSLTFCSVHEHLVDPWRQMSAWLRTGKEDGKDTPNAFAFAHEGKKVYEVCSEDANFSQLFSEGMAGDSWLFSRALVSKCRDAFEGLSSLVDVGGGTGNTSKVIAETFPNIHCTVFDLPHVVSGPKQTHPNLDYESGNMFTDEIPHADAVLFKWVLCDWPDEPVLKMLKQCKKALTKNGVKGKLMIADHVLDHESCNDSNSMGTSLILDMLFMSFLEGSLRTEKQWAKLFAEAGFKDYKITPVGGLRVLIEVYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coniferyl alcohol 9-O-methyltransferase
publication title Structural analysis of coniferyl alcohol 9-O-methyltransferase from Linum nodiflorum reveals a novel active-site environment.
pubmed doi rcsb
source organism Linum nodiflorum
molecule tags Transferase
total genus 128
structure length 360
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4eviA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4eviA02
1OYIA 3AXTA 4AX8A 1B9NA 4UV9A 2KW5A 2DW4A 5L3EA 4RB0A 1E17A 1NW6A 3O2PE 3GRRA 1JQEA 2K4MA 3E8SA 3LDGA 2PT9A 2PT6A 3LBFA 3F3XA 5LLQA 2NP6A 2B78A 2FE3A 3U1DA 3GYHX 4R6WA 1JHHA 2ZXJA 5FCDA 4XBFA 1EV7A 3OCJA 3Q87B 2G9WA 2E7XA 3SX0A 3C7JA 4PCAA 3AJDA 4YV0A 5T64A 3TO7A 1JSXA 5FUBA 2BV6A 5GP1A 4HQMA 3RKYA 1RZ4A 2OAZA 4OIPF 3ROUA 2UZKA 2QWWA 3AWIA 3EVFA 1M6EX 5DX0A 1OYYA 4QVGA 3N97A 5HDGA 4DNCA 5DDGA 1KQ0A 1I6XA 5TRDA 3WE2A 3G2QA 4UVBA 5FHQA 3ZMVA 4BLUA 4CYDA 1AQJA 2PXAA 2VBYA 2CKDA 4IV0A 1FYKA 1IRGA 3MHTA 3FHZA 5DCFA 1G4DA 1FBQA 2EFOA 2Z9OA 3IHTA 1RNLA 2OY0A 1XGMA 3BWYA 4Q48A 3K1MA 2BH2A 4LLLA 5E1WA 4O5VA 3SMQA 5DD4A 3L8DA 3MGGA 1G3WA 1SUSA 3BKWA 4N9HA 3T7SA 1LQ1A 4P9UA 2HTEA 3ELYA 1J2XA 1W7PB 3H2BA 3W6JB 4KN7X 3A27A 4OA5A 5E1OA 2EJTA 5EC8A 4P9FA 1OMIA 4RAZA 4CKCA 1EH8A 2VT3A 2ZMEA 5FB2A 1JXSA 2ZWAA 3SSMA 2TDXA 2Z6UA 1K78A 3DPLC 1ZG5A 4RTJA 2PXXA 2AOUB 1ORIA 5HS9A 2QBYA 4XUEA 3P2EA 2OZUA 4G8XA 2Q0OA 4QQKA 5FULA 4DKJA 3NDIA 4M9XA 3FRIA 2FF4A 4RWZA 3BY6A 3JWHA 3KFWX 5HLHA 2P7HA 2ZBKA 2UYHA 1UHMA 4IWNA 2DPDA 3BDDA 1XVAA 1L0OC 3SGLA 3MQ2A 4HC4A 2P7CB 3WTVC 3CVOA 2QRVA 4F85A 2ZNZA 1QGPA 4RS8A 4P7KA 3GFJA 3U81A 2L54A 4BLWA 4XSXF 2G7UA 1JG2A 1TW3A 4IHTA 2A6HF 3KQSA 2F2EA 5CD1A 4EK9A 4JBAA 2Q2EA 4E32A 2Y0MA 2D1HA 5EOVA 3RPQA 3HCDA 3UJ7A 3QU3A 4IV8A 2W57A 4EQQA 3KPYA 3BPVA 1IXCA 3TKYA 5ICGA 4L5JA 3LL7A 3GO4A 4Y2HA 1I9GA 3CJRA 3E97A 1P6RA 2KJCA 1IXRC 4QDJA 4GYIA 2FRHA 2NXJA 2Z6AA 4MTEA 2WWYA 3DP7A 2JTVA 1ON2A 1G8AA 4KDPA 3R9XB 1KR5A 4HZFA 1D8KA 5E17F 5DM2A 4MEYF 4X63A 5FTWA 4BYYA 3FUTA 5LQCA 2MA3A 3HEMA 3HOSA 4HW0A 4JQFA 2IA0A 4AD9A 2ZW9A 4E31A 1K79A 1OYWA 3CDHA 2FK8A 4V0QA 4EQZA 2H1RA 2FEZA 1IZ1A 4E2XA 4A6EA 2P1DA 2PX8A 1R5GA 4QTUB 1DL5A 1REPC 4FGZA 1MKMA 3NRVA 2CW0F 2LD4A 4EV0A 2GA1A 3FPEA 5E2AA 2XUBA 4IF4A 1SQFA 2ZTHA 3E6DA 2O6GE 3DLIA 5EHGA 3P9IA 3TLJA 1HXDA 3LECA 1O9GA 4EM2A 4HDVA 1HW2A 5BW4A 4CO8A 3LCVB 5DLYA 2F5EA 4PYQA 2OYRA 2P8JA 2VT2A 4L9TA 3MEXA 5EKUA 2J5OA 1NW5A 3GFLA 5HLIA 1G3SA 5FA8A 2KIUA 3HRUA 4GOND 2AS0A 1LB2A 3IWZA 1WG8A 5D6EA 2FYTA 3FMSA 2P40A 1SQGA 2ZO4A 4YFXF 2ISZA 2FA5A 3LDFA 2H09A 2PMHA 4R8HA 1LEBA 2BBYA 1R36A 2M1BA 1BJAA 4ESJA 3TOBA 1O9HA 5HIJA 2P6TA 2G1PA 1ZARA 2HGCA 3KCCA 4M74A 3E6CC 2H6BA 2UYOA 5LRRA 3IHUA 2CWWA 2VZ9A 2AXLA 2JPBA 3I0TA 4HLYA 1JTFA 3HRMA 4UVAA 4CTKA 1XDSA 4TV7A 1L3BA 3M7GA 1Z3CA 2ISYA 1YLFA 3PFIA 5ICFA 3MAJA 2OPBA 3RI4A 1MHTA 1XDZA 3HM2A 2IA1A 4HF0A 3PX2A 2RNJA 3CTAA 1QO0D 2BYVE 2DLLA 2P41A 4LWOA 4QLCU 2OXTA 1JSZA 3KPVA 5HZMA 1YUBA 3DQVC 2QYOA 5M5BA 2VODA 3M4XA 5K01A 1U2WA 5LHGA 2DU9A 4DCMA 3U2RA 4HG2A 3RDIA 1YS7A 3UA4A 1U6GA 4EVIA 4XSZF 3TRKA 3FTCA 2WC2A 1SD6A 2D1VA 2IA2A 4ENMA 4POOA 4EM0B 1ORHA 4RB1A 2NYXA 2AVNA 2E5WA 3KKZA 2EJRA 4YUWA 3G2OA 3IYLW 5EIFA 3OOPA 2C7PA 1R22A 2DT5A 2PBFA 2PN6A 3JAMK 2CFXA 3DH0A 2W84A 4U88A 3DR5A 2VN2A 1YTYA 5CM2Z 2FRXA 2EJUA 2GAUA 3JWIA 2O07A 4F84A 5C9ZA 5IKMA 4UXNA 1KYWA 4HGYA 2MC3A 3FMQA 3MB5A 2WA1A 1MDMB 1U5TC 3VFZA 4L0ZB 3NJRA 3F6VA 3RKXA 5TJJA 5D5WB 3LAPA 2EV6A 3J80Z 3E7PA 4P7GA 4LFUA 2ELHA 5K8VA 5D1HA 3SR4A 5ERIA 1FBUA 3MCTA 4MHTA 2BR4A 5LGUA 3GW2A 3HUGA 2OQRA 4BXUA 1PRYA 3HCCA 5C1IA 1T0FA 3BJ6A 2I62A 1L3CA 2Y75A 2IPXA 4LB6B 4G7ZF 5K0BA 1F1ZA 1YFJA 1LVAA 2P8TA 5FFXA 1L9KA 2A14A 3GIWA 4G7OF 1HKQA 4N0BA 3JWGA 2AVDA 2ZLBA 1ZYRF 2XKPA 3DFGA 2EX4A 3FPFA 4QTTB 4UVCA 4YUXA 5DYMA 1R5HA 4LECA 1OR7A 2HYGD 2GWRA 1F3LA 3I9FA 5E1DA 3WSTA 1J7KA 4NHJA 3C3WA 4GXOA 1LDJA 2Q8KA 4OBXA 1EH7A 5EEHA 3R6SA 4AZVA 1JG4A 3KQPA 1XSXA 5LRSA 5GOZA 2VE8A 3FTFA 4LMYA 1M6YA 3R60A 1W5SA 1IN7A 1TQMA 5DM4A 1TW2A 1QNTA 3G8AA 4RVDA 4WWCA 2UZ4A 1TNSA 3F8MA 4IHSA 3FZGA 5D8KB 1SFUA 1FY7A 2YU3A 3ZN1A 2I9KA 2ZZKA 2V1XA 2HQRA 3QAHA 2F8LA 3HVKA 4M6YA 4YFKF 3M6XA 5DPMA 1SFEA 2NRAC 1ON1A 3T1BA 3ZMZA 4EM1A 3C6KA 5LEJA 3T8TA 2P7VB 4IPAA 2QLZA 2NXNA 3R0JA 1QYRA 1R8YA 1FOKA 2HDCA 1YW9A 5D6FA 5K5RA 1QAMA 4B09A 1U8RA 5EZSA 1KQ8A 2GXGA 2R7DA 3CUQC 1YS6A 2OZVA 3KP3A 4EJTA 5D5VB 3KQMA 3DULA 2B3TA 1QZYA 3ECOA 2MD5A 3Q7EA 5J8FA 5A2QK 4ASNA 3F8BA 5DCMB 3DMHA 2GA9A 3DXXA 3RPUA 5DTMA 2VDUE 3NWBA 4E2ZA 3TKAA 5D4RA 4HGZA 2OB2A 1LDDA 1R7JA 5LGNA 3D2LA 3CO6C 4RGSA 3NWEA 3RYRA 3P9KA 2GQQA 1DCTA 2A6EF 5CVVA 2YXDA 4DF3A 1Y8CA 1YW7A 4AIKA 3BPXA 4PYKA 3EETA 4A12A 4GOMD 1QAOA 1VIDA 3FPGA 3TMAA 4YUZA 5IT3A 2DK8A 4I02A 3WODF 3VYWA 3DMGA 4HF2A 2Y1XA 2A68F 1Z91A 5LHIA 3TOAA 1NW3A 3GDHA 3GCZA 5DM0A 5K5QA 2QM3A 2D45A 4BHPA 2PX2A 4UOEA 2PY6A 2XIGA 5BPIA 5JUWA 1MDMA 1ZRFA 1ZN2A 3PS9A 2QQBA 5C0OE 4LG1A 4O3MA 3LKZA 4KIBA 3C18A 4FX0A 2A07F 5H02A 3OZTA 4BY9E 3UBTA 3ID6C 5FQNA 1LEAA 3W6KB 2JJQA 5E9JA 3K0LA 4PIPA 3N4MA 2X4HA 4C04A 3P97A 4FHTA 3LA2A 4XCXA 3M70A 3EDPA 5DSTA 2FNPA 4ATNA 3WU1B 2GS9A 1B1BA 4ER6A 4D0PA 2GH1A 3KPUA 4QDKA 4PYOA 3GX4X 5DRTA 3BZ6A 1IXKA 3SZTA 4MIKA 1VP9A 2FCAA 1ONVA 4KMUX 3KQQA 3JAMZ 1BI0A 2OBFA 2BM8A 2HR1A 2V1DA 1P1CA 2CMGA 5CVDA 4FT2A 1L3IA 5DTRA 5FA5A 2PEXA 2XYQA 4IRIA 1ZLKA 3PT9A 2UXXA 3S68A 1TLHB 3BGIA 1NE2A 4AVPA 4YUYA 4CWAA 3D5LA 1EH6A 5J8CA 4RB2C 3PLAE 1KU3A 2LSOA 1L3LA 1B6AA 4OINF 3HHHA 1X19A 4FSDA 3VOEA 5EQJB 2A61A 3QV2A 1QZZA 3HCBA 4P5OA 3ZMSA 4YMGA 1YF3A 2FBIA 2L4AA 2XAJA 2AN4A 5BQTA 5DRYA 6PAXA 4GEKA 1KQ9A 1YB2A 1BOAA 2DBBA 2H27A 4OIQF 1SAXA 4YV1A 2MH2A 2WK1A 3ER9A 3EUHA 1MJFA 3F8CA 1EJ6A 2OKCA 2A5YB 3M33A 1G8SA 1I1GA 3MERA 3LAJA 2FMYA 4LGWA 5FFZA 4GQBA 2IDKA 2IPQX 3ISPA 2XYVA 2ADMA 3SHFA 3OU7A 2FQ3A 5IT9Z 2JSCA 1UIRA 3EGVA 3SSOA 5T67A 5L3DA 3ELUA 5EMKA 1R1VA 3BGDA 2CO5A 1FYMA 5KS2A 2UYCA 2O0YA 4AZWA 1NHAA 1BKYA 4OOIA 4G94A 1R6AA 3HP7A 4QPNA 1T43A 2YR0A 5F6FA 3V7SA 3FPHA 2KRFA 3G2MA 4ER5A 3R3HA 3JW4A 3EGEA 5DCMA 3HTUA 5LSAA 3K0BA 3M1EA 4WXDA 4WK8F 5K0EA 3MCZA 3ZP5A 4HOBA 4AZSA 2ZBQA 4EMSA 8MHTA 1RI2A 4GGGA 4IRGA 1WKMA 5CVRA 4CTJA 5H6QA 4Y17A 4KYWA 1V39A 4C08A 2XVAA 3BWGA 3L9FA 5HS8A 4U0YA 4Z2YA 2IP2A 3NMUF 2HV9A 2YSRA 2XVMA 2BR3A 2PX5A 2HYFA 2L01A 3KLOA 3VB2A 1RI5A 1P4XA 1XJ5A 5ICCA 3G8BA 4I0BA 4RTSA 2VOPA 2ZZMA 1U3EM 4PGGA 4RGXA 3O7WA 1S6LA 2NNNA 4MNUA 5EHIA 2N47A 2FBHA 3HRTA 5K05A 2IBSA 5AIQA 2E1CA 5EMMA 1HNNA 2WV0A 1D2HA 2VBZA 3RJPA 5A2QZ 1HBXG 2BR5A 4ZTBA 2C6YA 1O7LA 4KRGA 1Q0TA 3QOXA 2CQKA 2A3SA 1K6OA 1J5YA 2JHAA 2PKWA 5F2OA 2P5VA 1FBNA 4GUAA 3HVHA 3FF5A 1D2GA 3FTEA 3M8FA 1XDUA 3B89A 1HSTA 2MBFA 2RC4A 1P1BA 3IV6A 3WTWC 2DK5A 4A0YA 4PDKA 2Z6QA 3RODA 4CZZA 3LA3A 3GEZA 1R23A 1USSA 3WGIA 5FD6A 3F23A 2EFPA 1C0WA 2MLGA 2AR0A 5ILUA 4RYLA 3K9TA 3DXZA 3B3JA 2HNKA 5GM1A 1WRJA 3J7AO 5CCBA 3AAFA 2PMUA 3RKWA 2IVMA 4HF1A 4HV5A 2G8NA 2ZIFA 1VP3A 3R4KA 2K86A 3H3UA 4ZYHA 2PWPA 5FGMA 2FU4A 3MQ0A 3UJCA 2GZWA 4IJAA 4DMGA 5GWXA 3NW9A 3FPJA 3FM5A 4HBLA 2VONA 1F9NA 4N9IA 1RJDA 3KP5A 1T98A 3I64A 3H92A 4KIGA 2V6CA 3EVDA 4S04A 1XCJA 1TTYA 3T7RA 1ZH5A 4RV9A 1R74A 1R00A 3DKWA 2K4BA 4HX4A 4E33A 5AONA 1YZ3A 3LQRA 3KR1A 1RI7A 3G3ZA 5K0JA 4F7ZA 3A7DA 1YFLA 1XCVA 1J9IA 1X1CA 5KQSA 2EFNA 3V8KA 4HX8A 3MTIA 1NV9A 3FXUA 3ERCA 2RKHA 4LK1F 3RIRA 2ZCWA 3GFIA 2DFIA 3GRVA 4O29A 4AUKA 2HMYB 2A69F 5CYVA 1NBIA 1XSDA 2ONZA 1T6SA 1LDKB 1DDNA 2YQZA 4XLNF 2YXEA 3BUSA 3EVEA 3O6BB 5IH3A 3OE5A 4JXJA 2VC1A 4M71A 1MJ9A 3MZYA 4UNOA 2OA4A 5G02A 4GCVA 3P8ZA 1T2KA 3PQJA 3JTGA 4BLVA 4PONA 1BI2A 2VBXA 4PZJA 2C7OA 3CO7C 1HW5A 3TDUC 1Z9CA 4Q4ZF 4P7FA 1AQIA 1XB4A 1BM9A 3REOA 1BC5A 2Y48A 4XLPF 1FBSA 2BZGA 3R6TA 5KYGA 1Z6TA 3OFKA 4RTPA 1N2XA 1DUSA 2GLUA 1HMYA 2XYRA 1O54A 2COMA 1Z1DA 2CL5A 2ZZNA 1W7PA 3UJ8A 2WTEA 1XCBA 2P3LA 3IRRA 4HTFB 1GXQA 3UZUA 3T8RA 1FP2A 5U4XA 5MHTA 4OIOF 3HVJA 3HCFA 5K03A 2QQ9A 3SXYA 2FNAA 3K1PA 1QANA 2HKOA 2AOUA 2R3SA 2YVLA 2ZIEA 1X1AA 2JH8A 4GO1A 2OU2A 4DQ0A 4FT4A 3LSTA 2VDVE 4PYIA 3WTUC 2EG5A 2JPCA 4M36A 3LCUA 4E2YA 1VQ1A 5LQKA 2RVCA 1RJFA 5E1MA 1JG3A 1NV8A 2HWKA 4GOLD 4X61A 2EB7A 2ZSUA 1JE8A 4Y15A 3D0SA 3V7RA 4R6XA 3M8EA 1MJBA 5GIPE 1KA8A 1NBHA 3LGAA 3ZMDA 3HCAA 1XMAA 3HSRA 3HA7A 5HDNA 2ESHA 4R8SA 4A5NA 3E05A 5EKXA 3KLNA 4HYEA 5BW5A 2ZBPA 3TM5A 5DUKA 4FR0A 1IN8A 3I59B 4YIFA 3HYIA 4JK1X 2G72A 4E30A 3BWMA 1E2XA 1KU7A 4RTNA 5CVJA 3GZ5A 3C3PA 1YFHA 5DXAA 4KUMA 1DP7P 5DD8A 2IDJA 3B5IA 4OBWA 4CXMA 2VXZA 1T39A 4U0WA 4RGUA 3KU1A 1I27A 3ORHA 4QVKA 1N7JA 1BC8C 5K5OA 4A5MA 1F4KA 3DF8A 1IN6A 1KIAA 3KQOA 3HIFA 3KP2A 2CGPA 2KJBA 3LKDA 3L2CA 2YXLA 1U5TB 2BE5F 2H94A 4I2OA 3DLCA 5HFJA 3TM4A 2ESNA 1XXLA 4RTKA 4H0NA 2PQ8A 4G56A 5E9QA 3UJAA 3PB3A 1BBYA 3A4TA 1KP9A 1ZQ9A 3FYDA 1FT9A 2CWEA 4MGRA 4L9VA 3CJTA 3E23A 1ZG3A 1SD4A 5H6RA 4BNCA 2Z5UA 5FWDA 3FUWA 4YG2F 1UFKA 4BP1A 3A26A 1G55A 3FMRA 3WTXC 1S7OA 1P39A 4KDRA 1CGPA 3VC2A 2K02A 3LWFA 4O6JA 3UWPA 3BJOA 5DEQA 4U0VA 1M0EA 3ML6A 5BPDA 1JG1A 4PYMA 5EPEA 3SXJA 2STWA 3OZRA 2EA2A 3LDUA 3KP7A 2GA2A 1NW7A 5T6BA 4DQ2A 4P55A 3BGVA 2RDPA 4P96A 1X3UA 3G5LA 4PYLA 4MQ9F 3G73A 3NVKI 3ERED 3ER8A 3V97A 3CC8A 5E1XA 2GXBA 1ZRDA 3EQLF 2Z99A 2ZFUA 4QWQA 4ZZLA 5LBQA 3CBGA 2FBKA 3F8FA 4HTFA 2QENA 4C05A 1XGOA 2HEOA 2IBTA 3IKTA 4KNYA 2H00A 2QVOA 4G6QA 2B2CA 3TQSA 3KQYA 1WI9A 4PINA 5CJ9A 3C0KA 5K0NA 4EKIA 1D3YA 4X1OA 3EVCA 2XAHA 3GXOA 4RTOA 1MGTA 1IF1A 2K4JA 3CUQB 2AOTB 2PGXA 4RSRA 4BH9A 4C03A 3E3VA 3NQOA 3CKKA 3FZVA 1H9TA 3IL2A 3KQWA 3RTRA 1FP1D 1YO5C 1O3SA 3A7EA 4ZYEA 4HQEA 3I59A 2HTSA 1YZHA 3P7NA 3B73A 3DOUA 1Z6RA 1TPYA 1W5TA 3KZZA 3MWMA 4R79A 1X1DA 2PG4A 4RTLA 4L7VA 3P9NA 3ME5A 1B9MA 5JFRA 4CHUA 1VE3A 4G9YA 4E70A 3EMDA 4FSXA 3EPPA 3V8VA 1Z05A 2M30A 3JSPA 5AIPA 5K0LA 4BP3A 1XTPA 1SFXA 1ZAOA 1ZGAA 3FXRA 1XSVA 1USTA 4YV2A 2V79A 5CIYA 2HKXA 2DQRA 2D2WA 3G88A 3KEQA 3GNLA 1JHFA 3GUDA 2PX4A 5E8IA 1B42A 1HKTA 3ABTA 1RUOA 1I1SA 3BWBA 3CUOA 1I4WA 3QOWA 4MHGA 2NNYA 2P5LC 5LQRA 2IH2A 4M38A 4LLGF 2LF8A 3R0QA 1G38A 3I5UA 9MHTA 5BXYA 4FT8A 5K1YA 2V1UA 2LDUA 3RYPA 3S2WA 1PUEE 1IN4A 2I6GA 4Q5SF 2EWNA 2FXAA 1V4RA 2OQGA 1STZA 2AOWA 3B7PA 2RQPA 3WU0A 3Q9SA 4M9ZA 2W85A 5EGSA 5D8LB 3ZN0A 3LX6A 5JR3A 2P3OA 5LQNA 4R05A 1KPIA 1HSJA 1H1DA 5DM1A 2LF7A 2IT0A 2PI0A 1Q1HA 5CVEA 2R6ZA 2PVCA 2C7RA 4P58A 4KA4A 2J5PA 4HX7A 3DTNA 1RIOH 3LPMA 2DTRA 2AOVA 1AF7A 1EJ0A 2HFHA 4IXAA 1TNTA 4MEXF 4OMZA 4U7PB 1BIAA 3KR0A 4L9NA 1ZRCA 3K6RA 1IUYA 3BXOA 3BWCA 3KP4A 4HSGA 2RV8A 3SVZA 1G6NA 3EVGA 5JI6A 1KU2A 1O3RA 1XCLA 2L3DA 3KEOA 2V7EA 1IY9A 5DUIA 4I98B 3SQNA 3UA3A 1S8NA 1P92A 3ELKA 3VC1A 5HOQA 1BHJA 5F2KA 4BHCA 4OMYA 1QBJA 3B3GA 4KICA 2ZWVA 2ORED 3HTXA 3UJBA 3NDJA 4R8RA 1B4AA 5EZQA 1S3JA 2YX4A 3WTYC 1PDNC 3CLOA 1JQ3A 3C6MA 3QOPA 3FX3A 3Q9VA 1P91A 2CG4A 2EFQA 3F22A 3WTTC 1SMYF 1Q0SA 5DTQA 3WG9A 3MTEA 2QUFA 1TQPA 4ZZDA 1WQ2A 4C06A 3M6UA 2PXCA 3JSOA 1L1EA 1AOYA 4A2UA 3ELDA 4B17A 3P2KA 3I53A 1QQIA 1IXSB 4PGHA 1T38A 2G7HA 1RJGA 3EMBA 4EJUA 2JH9A 5K0FA 3VEPA 2HWVA 4LJZF 1UFMA 5KK1A 5EEGA 4EJWA 1A04A 3K69A 4Y13A 3VSEA 3IRQA 1XD7A 4WXHA 2E7WA 4ISCA 5FD5A 1SMTA 4RGRA 4KT5C 4GC5A 3TQNA 3R61A 1J75A 1YIOA 2VC0A 1WXXA 2QE6A 3UJDA 5EMLA 5FHRA 2GIVA 2GB4A 4U7TB 4P7JA 2O8XA 4PYJA 2HR3A 4ESFA 3V8LA 1B59A 1DPRA 3NTVA 2H11A 4PCQA 5D5UB 5HILA 3KZYA 3JWJA 4Q47A 1VLMA 1S29A 3HSEA 2JT1A 5LGTA 5P8WA 2P35A 1ZREA 5EIWA 3ECHA 3PVCA 1PP8F 5DWQA 2O03A 2PV0A 3FUXA 2VOOA 5K0CA 3FYCA 2AZTA 10MHA 1RI3A 4HA8A 5ILVA 4L18B 2DO7A 3PQKA 2PLYA 2O57A 2IW5A 1FLIA 2PLWA 4ON0A 2YTZA 3I54A 2JZYA 3GZ6A 3THRA 1P4AA 1VTNC 2XASA 3VODA 1LNWA 3QPHA 1DUXC 3FRHA 4MWZA 2YR2A 4C4AA 5EMJA 4OQDA 1FX7A 5D5XB 3EYYA 1WSUA 4A6DA 3TGNA 1KHHA 3ZMUA 3HRSA 4LWPA 3C3YA 4FS8A 2QQAA 3IEIA 5F2NA 4EGYA 1GHCA 2CSOA 4RB3C 4IKPA 2HS5A 4I7HA 3V8JA 3KR9A 3WTZA 1PP7U 4ETSA 5H20A 1R1TA 2YX7A 5BOXA 1FC3A 1OPCA 3DMFA 3BT7A 2M8EA 3PX3A 3O4FA 3F8NA 3F21A 4PCLA 4WVLA 4AZTA 2HTJA 3SZPA 5HS7A 4DM3A 2RN7A 1IM8A 1WZNA 4EKGA 5GIOE 3I58A 1FWZA 4MTLA 4KIFA 5DX1A 3LA7A 1FYLA 4U7DA 3RIEA 3GF2A 1IRFA 2VBWA 3HSFA 3A25A 5ED4A 1ULYA 1R58A 2JG3A 5E18F 1BOOA 3RW9A 5EG5A 2JRTA 4AIHA 4RVHA 3EVZA 3J81K 2R7FA 3K2ZA 1R1UA 2UWMA 2YX1A 3X0DA 2ETHA 1RI1A 3GU3A 5E20A 2HZTA 2ZFWA 1JR4A 3IC7A 4F86A 3I4PA 4UHTA 1FSEA 4MQVA 3QU6A 3ZQ7A 5LHHA 5E9WA 1D2CA 5F64A 2ADUA 5HDKA 3J80K 1K7AA 3R24A 4KFCA 3QPTA 1UB9A 5CLSA 4OU0A 4RAYA 1XN7A 1O7FA 1EG2A 5HVQC 3Q5FA 2HOEA 3OFJA 3OU2A 1OR8A 4KWCA 5ICEA 1FNNA 1MD0A 2PFBA 3CJNA 5E2BA 3G2PA 3E5QA 1IW7F 1YW8A 3DXJF 4A0XA 3HVIA 1VBFA 4ZYGA 2ACJA 5FLXK 1BC7C 3FXQA 2EFJA 5D1NA 2DULA 4OQEA 3PTAA 2XVCA 2QY6A 5JHUA 5JVTA 4XRFA 4EGZA 2DI3A 4IRHA 3FUVA 4G7HF 1YYVA 2M5WA 2MLKA 3WE3A 2W25A 4FX4A 2ZKZA 4ENNA 3GLXA 2IH4A 1D8JA 3HOTA 2DAOA 1RUNA 4RTRA 3F6OA 1SD5A 2NS0A 3P71T 3ABUA 4L5IA 1S7AA 4L9JA 2EK5A 3KETA 1FZPB 5E1BA 3SSNA 3F72A 5GM2A 4RTMA 4CKEA 1NT2A 1QAQA 4CKBA 4OX9Y 1MJAA 2AN3A 4X60A 4Y30A 1J0RA 4B8XA 2Z3YA 2IIPA 2H6CA 2WA2A 1XGNA 5BMZA 4DA4A 5KVRA 1SUIA 5DV5A 4ER7A 3G89A 3WGHA 1G3YA 3P2IA 4X41A 4NB5A 1WY7A 5F1RA 3FUUA 1IAWA 3LHDA 1Y0UA 3BJAA 1KXZA 4GF5A 3AXSA 4H0EA 4K6MA 2O05A 1WS6A 4UV8A 3IKVA 3OU6A 3EVBA 2XROA 2ESRA 1N7IA 2OO3A 3R0AA 2P4WA 4AIJA 1UWVA 3SM3A 1DPUA 5L3CA 5LEKA 2Y1WA 5HIMA 2PJPA 2XBMA 1H9GA 4FZVA 4IVNA 5FWAA 3GGDA 5LQUA 3EEYA 4KDCA 1ODDA 4S05A 4ENJA 2FPOA 2VS1A 4HRAA 3GJYA 2K27A 2EV0A 1WXWA 3AY0A 1GVJA 2MH9A 3V4GA 4WX9A 1KYZA 2DQLA 1KU9A 2V74B 1ZHFA 2FSWA 2ZNYA 3BZBA 5LQAA 3M6VA 3O3KA 3T0YA 3MFKA 3WGGA 1YG2A 3ZMTA 3UJ6A 1G3TA 3HA3A 5CUQA 2M45A 5L3FA 2EA4A 2G70A 2ZVJA 5FQOA 2KIMA 3L00A 1SD7A 1IN5A 5HEKA 2I7CA 4I01A 5KQRA 1EQAA 3BP8A 3QP5A 2YUIA 4CICA 2K7LA 1NKVA 3LFKA 3G7UA 1XGSA 2NXEA 5CVUA 4KVZA 2XRNA 3TPZA 3HHGA 4YUVA 3TOSA 5EVJA 5E8GA 4HAMA 5DXJA 3KPJA 1O3QA 5FO5A 4MTDA 3CJQA 2L4MA 3V7CA 1SG9A 3GFMA 2XKOA 3EGIA 3M6WA 4LG0B 2IFTA 4HH4A 2P7IA 4BHBA 1ZKDA 4KW7A 3BKXA 3KP6A 1FSHA 1O3TA 3KQVA 2VE9A 3HNRA 3THSA 1J59A 1QPMA 5K0GA 3OZSA 3KPWA 3GO5A 4CGZA 3U9GA 5HIIA 4YFNF 1G6Q1 1KPGA 3M9AA 2PJDA 3GRYA 3MAGA 5L3GA 4I09A 3J81Z 4WXCA 2IRFG 3E5XA 4LB5A 5L3BA 1FJXA 2NP7A 2DPUA 5LR6A 1W7PD 3SFZA 1RJEA 1AWCA 2XGXA 4I0AA 2CMHA 4KN4X 4K2EA 4QQNA 5D4SA 4M72A 3QRFF 2ZCJA 4XUCA 1PJZA 2JHPA 2LNBA 2FMLA 3ULQB 1HKSA 4MQ4A 4ER0A 4ESBA 4GYGA 2VDWA 4E2WA 1BIBA 2BEOA 3COAC 2O06A 1RI4A 1Z7UA 1YQAA 4FP9A 3OE4A 4WF2A 2P6SA 3L09A 4G6DA 3TDZC 2IJLA 1UCRA 1CF7B 2PSSA 1ZLJA 3DUWA 2PBIA 4HDUA 1O57A 4BQAA 3WTSC 2KKOA 1KPHA 2Z33A 3C1DA 4LK0F 2Q41A 2B9EA 3B02A 4EJVA 2QZ8A 5FLXZ 3OPNA 2EV5A 4NQWA 1JQDA 5IT9K 4PWYA 2XHKA 2F5CA 5ILSA 2EFWA 3LQQA 1W4MA 2M87A 1R8XA 2LKPA 3IWFA 2ZULA 1VL5A 4OA8A 3BROA 4V0RA 4CXFA 3HTSB 4ER3A 4GC9A 4M73A 4DCGA 4YMHA 4GBED 2DPMA 2OZ6A 3K1NA 5DX8A 2P5KA 5CVIA 2CYYA 1VPTA 1U78A 4PIMA 1P4WA 2O0LA 2VP3A 1JTEA 1BI1A 2RGVA 2ERCA 3TO6A 4BAYA 3FWEA 5B1SA 1SVUA 3LBYA 5FADA 1MZBA 3I71A 3ELWA 1X1BA 2OBPA 3P9CA 4EJOA 4HV6A 3HCEA 3LCCA 3B3FA 2BGCA 4OIRF 4LD5A 1ZGJA 5BP7A 2C7QA 3TO9A 4AWXB 5E8JA 2IH5A 2L02A 1NW8A 4U7BA 2NXCA 2FOKA 2YPRA 4M37A 2XAGA 5CCXA 5DT2A 2ZJ2A 2NAZA 3BOQA 1JGSA 2ONYA 1LJ9A 4ZYDA 4R1HA 1G60A 3GRUA 1UHWA 4A0ZA 4XUDA 3NVMB 2FHPA 5E1ZB 1ZG1A 3KE2A 2F5DA 2E1NA 1TBXA 5BS6A 1KGSA 2B25A 3FTDA 1FPQA 1HQCA 3O31A 1GXPA 2O61A 3F4KA 3GRZA 3KQTA 1U5TA 3QP6A 2B0LA 3T7TA 1TQIA 2O3FA 4RVGA 3KR2A 3DPTA 4LG0A 1XMKA 4HLXA 4NECA 3ZPLA 5HOOA 3GVAA 4GOOD 4M7RA 2XAFA 4QPPA 2JHCA 2STTA 1EAMA 2BM9A 1I5ZA 2XAQA 3CGGA 5KVAA 2AN5A 5K09A 3DV8A 3E5UA 2F5FA 3PFGA 2AS5F 3G5TA 3GWZA 3L7WA 2UYQA 3UFBA 1F38A 3ANXA 2XV4S 4ENKA 4LLNA 1R18A 3T0IA 1EIZA 2W24A 5HIKA 1P2FA 7MHTA 5DSXA 3JTHA 1U2ZA 1AV6A 2AOXA 1V3FA 1BN5A 3E6BA 4C07A 4DZRA 2ZMEB 1OKRA 1INLA 3T5XA 2OB1A 1K78B 5E8RA 4RX1A 2UXNA 4CDGA 3NEUA 2IGTA 3TR6A 4RTQA 3TFWA 4L0YB 2ZBRA 3CCFA 3EEOA 4ZH4F 1WWXA 2QBYB 2V9VA 1CF7A 2KIFA 2ZIGA 2GPYA 4PYNA 5J6XA 3DXYA 2HQNA 4WCGA 4M6XA 2G71A 3OV8A 3HA5A 4RVFA 2X0LA 3H3ZA 4KMFA 1BI3A 5LQJA 1H0MA 4UUVA 1HW1A 2GAFA 1F5TA 2FK7A 2QRVB 4PNEA 3DEUA 3KHKA 4M9SA 3MZHA 2NNWB 4YIIA 1SKMA 3EVAA 2P3QA 3PFHA 3CUQA 2AOTA 5GINE 5HLGA 1I1NA 3EYIA 2PWYA 3FM3A 2OD5A 1D5VA 3E6MA 5ERGB 2NYUA 3UJ9A
chains in the Genus database with same CATH superfamily
4A9AA 3CPJB 5BOSB 3OUTA 3A1FA 2R7RA 5AI4A 1WOMA 1MMDA 3AU9A 5D85A 4D4JA 1T3HA 2ZBGA 4X8OA 2M7BA 1C81A 1VJ0A 4FUQA 4BEHB 3Q87B 2FSPA 2Z2IA 4WKGA 4FKZA 3LGSA 1NVVQ 2K2WA 4XCVA 1JKPC 1J0AA 3CVVA 1PFQA 3LW7A 5B2EA 3MCUA 2EZKA 2DVMA 4B2PA 1M6EX 2AJBA 2FLVA 1GSAA 4EO9A 3C6ZA 1TVCA 3PJFA 1HQKA 4DLXA 2YJTD 5CPFA 4M3EA 2PT5A 2BCEA 2OR3A 3WLFA 2QEXI 3PQCA 3QP9A 3C2QA 4GG1A 1VLVA 5CP8A 1V8ZA 3VPBA 2DYKA 2YFKA 3FXAA 4YRIA 4LZZA 4G0OA 2EJTA 3MJVA 4EITA 1JXSA 2ZMEA 1UZUA 1M1NA 1WCXA 2O1EA 4BGIA 5ECGC 1UL1X 3NAZA 4DE5A 4E13A 2ETXA 3K70B 1T3ZA 4NIMA 5IW8A 1OT5A 2LLKA 4D46A 3WIOA 1G8MA 3JCUC 4HMPA 1JKIA 1ZYUA 2MIIA 4L9AA 2DSNA 1FIPA 2XE4A 3WU2C 1E5LA 3FKSD 4C4OA 1IJBA 7ADHA 1ABFA 4YASA 1DQSA 3C43A 1UBMS 1S8OA 2F2EA 1Z6YA 1A7UA 4EK9A 4O02B 3VTZA 1ADJA 1F6BA 4W7SA 1Q84A 3KPYA 2ZIXA 5F7JA 4PHFA 3B5JA 4BKQA 4B84A 2RAUA 3WL7A 2CSUA 4YJ2A 4G8BA 5LFAA 2P6OA 2AG1A 4UOZA 2IV2X 1X8JA 3R9XB 5E17F 1U65A 3AL3A 5JNWA 1T5SA 4DPMA 2FZ5A 3HOSA 1GUFA 1U8CB 3G0OA 2DR2A 4E31A 1E5DA 5IPAA 4N39A 4W4TA 2QUJA 3DWIA 5F1KA 2P1DA 2PX8A 4LDQA 4KFTA 4IYJA 1IMOA 4XDYA 3GZJA 4OK6A 1MABB 1KVTA 4MPDA 5EHGA 1JKFA 3RU7A 2DFVA 1VYVA 5F0FA 3HZRA 1WJEA 4WCFC 5CLLA 2J0UA 3LCVB 2WTUA 5IARA 4PYQA 1AT1A 3WQSB 3MEXA 3ZCSA 5FTMA 3IE0A 3WO1A 1CFZA 3BR0A 4Q3KA 3PQ7A 2JIBA 2BONA 3RS3A 1J33A 1QNLA 3KL2A 1C0EA 3GUYA 2ISZA 2AR9A 1Q12A 1XCOA 2PMHA 1LEBA 4LBWA 1PIWA 3RSSA 4NCBA 1WH5A 4LYFA 2FPSA 1EZZA 4PSUA 3UMMA 3WAGA 4YRTA 1QQ5A 4C2BA 5KOHB 4YO7A 2AXLA 4HLYA 3P0JA 1I2ZA 3CNNA 2PD6A 1PBNA 4ECEA 2G1JA 2P41A 5HRUA 1FTSA 1FMLA 1MAWA 2F55A 3TSWA 3UHJA 5AXAA 4RV4A 1LVUA 3H1FA 4EPWA 2XGCA 2ZPTX 5JWHA 2CFXA 4MNTA 1ZM9A 5JJIA 3K4CA 1PS9A 1S2NA 4U6NA 1XYVA 4UXNA 3G2JA 1IUKA 4BN5A 3IUEA 3MB5A 1LLUA 2ACKA 3VFZA 4L0ZB 3ANNA 3L92A 3J80Z 2LRDA 3E7PA 1FMFA 3OZ7A 3HUGA 5JJ5A 3NBZC 3TXYA 2Q99A 3BJ6A 2UZ1A 3R5JA 4LXTA 1F1ZA 1YFJA 2AB0A 1DAKA 3O8OA 4OXNA 4ZAYA 4NF2A 3AEXA 1ZYRF 3SX4A 3KTDA 3VUEA 4HQOA 3LT1A 2HYGD 4EHHA 3PI7A 4D9NA 3PXCX 3EIHA 2LNDA 5EVCA 3WSTA 3IJEB 2D3TA 1GNRA 4CLOA 1E2UA 2IXFA 3QX9A 1EH7A 1MOQA 5KSPA 1Y89A 3T5PA 3FTFA 2D6FA 2QSGX 3C2BA 4BB5A 4IHJB 3ZEIA 3RSCA 1Z63A 2V1XA 4WE3A 3VNRA 3SLRA 3O73A 3T1BA 3ZMZA 2WYOA 1IO2A 2P7VB 1DIGA 1RXVA 1M83A 4MQMA 4JI4B 1EJ9A 4KNWA 3RQ4A 2DY0A 3ED1A 4LZJA 3BMQA 5CXXA 4B45A 4NFLA 1QLJA 1RWBA 2L2OA 5BN3A 4F1KA 2AMJA 5E4JA 5IH7A 2OXEA 3I6ZA 5DCMB 2O7OA 3TIIA 1FRQA 1YI2I 1ZGHA 2YC2C 4HGZA 4XNFA 4CN9A 2OPHA 3OJEA 3RYRA 3FZYA 3AERB 2OAEA 4GMGA 5G1OA 1DBWA 4P0TA 3DLPX 3CVXA 2DK8A 2UZIR 1BDIA 2W4QA 1T3SA 2IEAA 1BJZA 4K28A 1BZYA 2OF7A 2PL1A 4A1FA 2JGIA 4EYSA 5BN4A 2H4HA 1FOEB 3IBGA 2JJQA 1XQWA 2BEVB 1ODCA 3NYQA 3BRWD 4TWJA 5BQ3A 2P62A 1Y8RB 3FPAA 4BGVA 4ZVLA 3SZTA 2AW5A 1W6UA 2OHXA 1S4MA 3BTUA 4R1PA 4B9EA 3GAFA 3UGQA 1UT5A 2OVFA 1UQUA 1B14A 2UXXA 4E09A 1AUOA 4N01A 3U7GA 2RBGA 5HF8A 3PFYA 4YONB 4YMGA 3CX4A 3N2NA 2ZVQX 3T7KA 1V3UA 4IOKA 1HDPA 5CB8A 2HCBA 1HA3A 2OG1A 5H0IA 2CLFB 1XBTA 1YRLA 1U9JA 2XEDA 1FQOA 3W78A 3VO2A 3WJAA 5CDUA 3L46A 3HC7A 4ER5A 1NK2P 1UBUS 4WXDA 4IZHA 1Q6YA 3B6JA 4DV3B 3THOA 3QLVC 2BJWA 3AUXA 3DDCA 1TLTA 4J4BA 2HC9A 2DPGA 1TU3A 1XJQA 3OZUA 4MI3A 2RKOA 2BFCA 2GNPA 2VQCA 1E5QA 2L01A 1TWGJ 1SIWA 2RI6A 4N76A 3I34X 1A98A 5ICCA 4F92B 1H93A 4IDFA 4GXRA 4PGGA 3L4JA 1X7DA 3O8DA 1PKEA 1HNNA 1GCAA 1X3ZB 5IN4A 5A2QZ 3I55I 5DYIA 4KRGA 1T0HB 1D2GA 1Y80A 3LMKA 1SFOJ 4DRZA 3GVHA 2OCEA 2RQQA 4N8DA 1SMKA 2OGZA 5IDWA 1E6WA 5A05A 1O6GA 2WD8A 2XHEA 5ILUA 1J8YF 5DULA 5IMBA 3MQFA 1W85A 4BNVA 2G8NA 4PC6A 3R5HA 2Y0SA 1KYTA 4XIFA 2V0GA 4QXOA 5K8LA 3HJTA 3H2JA 4MLCA 4DIDA 4TQ9A 1TWFJ 3T7RA 1P62B 1WLYA 2BOLA 4E33A 4V0NA 2A94A 5E4YA 4QYWA 5TEWA 1E64A 3IMFA 3CR8A 5KQSA 1GSOA 4HX8A 4BTEA 4OUDA 4KAXA 1Z6XA 4MVJP 1Y7IA 4WXRA 3GFIA 1YDGA 4O2BA 2BFWA 2B63J 3H99A 2Q5OA 1C4XA 4NDNE 4RDHA 4M71A 4J0QA 4UNOA 3F7NA 2BKAA 4YJ2F 1Z17A 2X9VA 4U9IS 2GBLC 4WXYB 3TDUC 1DKQA 2WAEA 4HDCA 4P7FA 1QRYA 3ZI4A 2WJHA 4I46A 2VHCA 1GPYA 4G86A 4HDRB 2ZZNA 4YJDA 2P90A 4HTFB 5AUNB 5EXPA 1H05A 1PZMA 2QQ0A 1JHPA 1T9CA 1SURA 3LC2O 1HTWA 1ZISA 2YRWA 1MDBA 2JH8A 1GUBA 2AMLA 4QXPA 4HQRA 4UNPA 1EUDB 4EHAA 2V97A 2ZSUA 4P0QB 3K0KA 1AZSC 2WPDA 2C94A 3BIOA 3WFZA 1CU1A 1H2ZA 2AFHE 4DEYA 1XMAA 3RNOA 4Y7NJ 3BH7A 2QTVB 2Q2NA 4NARA 3N2YA 5F77A 3V80A 2EARA 3UMVA 1ZJ4A 3G82C 5TVKA 1VJ5A 1X7ZA 1P2TA 3GXBA 3TTUA 3Q9UA 4TTRA 1SCIA 3IIMA 3H2SA 2VI6A 4JVOA 3A6FA 2C3UA 2P4HX 3IEUA 2J8ZA 1K4YA 3ZWXA 3ZQHA 1HM5A 2PXHA 3VU0A 4ENUA 3G02A 3DLCA 4I2OA 5JDCC 3HXLA 4RA6A 2CXPA 2F9LA 3GR6A 3WLTA 1NF8A 2FG5A 2P9TA 4YRJA 5ALEA 2PAAA 4ABTA 4Q1FA 1XIVA 1UELB 2DHEA 2E85A 4BNKA 3WTXC 1L4LA 4TVBA 4C7KA 2PKRA 1YH3A 2BCGY 1TLLA 1GA1A 5LP6B 4LC1A 2F3QA 1UM9B 4CR6A 2RB5A 1NW7A 4W8HA 2J31A 4A15A 1DKNA 1ZJJA 1GZSA 2KRHA 3ONNA 3G73A 3ERED 2M6RA 2YHIA 2GXBA 4QWQA 3TPCA 2O3QA 5LBQA 3NDBB 4AS3A 4CT4B 3KV3O 1BMFD 2B2CA 2VQEB 1TM2A 3L02A 3M4ZA 4BUJA 3WL4A 3GG9A 2BHZA 2JK1A 3NETA 4MMYB 3N2ZB 4MWBA 2X23A 1I0ZA 3RAFC 2QN7A 4F5ZA 5D5PA 3FZVA 4PGMA 4X44A 1DTSA 2ID9A 2FJ1A 2ZJ1A 3MWDA 3E8XA 4EBFA 2A05A 3U3KA 4B3GA 2BHTA 2ZUUA 5CHEA 3UG7A 1PR0A 3UXMA 3IXMA 5ENDA 2PVSA 5A6SA 1ZAOA 2W6JA 2GKOA 1C0IA 2ZPUA 1JDPA 2OHVA 4WGFA 1B42A 3DEAA 2HT1A 2R1TA 3BWBA 1XU4A 5DI3A 1YJ5A 1N75A 1NN3A 4ZV4A 5F78A 2J4FA 4FYJA 1SVLA 5BXYA 1RLTA 3TLBA 4ACBA 1KAOA 2P79A 2YWCA 1IY8A 1PQYA 1STZA 1DUVG 3FCSB 3J7ZI 3RUFA 4BC1A 4C4YA 3IAAA 2G8LA 1KPIA 2VJIA 1H1DA 1W5AA 2JFXA 4Z0HO 4X20B 2PVCA 1BE0A 2J5PA 3VZCA 5F35A 4B0PA 2RFLA 5IXYA 2I80A 5CTJA 5LKRA 5K8IA 3DEYX 3TK1A 4CG2A 3HGGA 2OA0A 3KNZA 1G6NA 5SYMA 3HP1A 5D84A 1SCQA 1WMDA 4U4AA 2HPMA 2D13A 2KL4A 1H8AC 4AX4A 4FMCF 5E4TA 4XKVA 2WADA 1BVYF 1BHJA 5A5FA 5JZ9A 1MQ9A 3B3GA 3UJBA 5IVIA 2YX4A 3ET4A 1JQ3A 3LU1A 1AXGA 3DVLA 4R8MA 4KMOA 4WUTA 2D5VA 3IQIX 4H7JA 2I6QA 1VL1A 1CTQA 2YXBA 1WDMA 3K10A 5MN6A 4NG5A 2FFQA 2O4CA 3RPUD 1RJGA 3AMVA 4R68A 4XLCA 1N5OX 3FLAA 3CA8A 2NN3C 2KS6A 4QC2A 2EL9A 5G40A 1BVRA 4BQOA 1EFTA 1Z2AA 2X3FA 3G5MA 4R2JA 4U7TB 2H11A 2VQDA 2P35A 2QIPA 3ZU6A 4BP8A 2H65A 2OZLB 1GQQA 2ZYHA 3FYCA 2CT8A 4D74A 1RI3A 4ZYLA 1LK0A 3DQQA 4DM4A 4XFJA 1Z0AA 3D6HA 3MKWB 3H6HA 3URKA 4PW0A 3GTGJ 1R1DA 3A03A 4S2EA 1PJ4A 2IUYA 4RL6A 4CIWA 2NQTA 4DYDA 3ZMUA 2WILA 4HBZA 1UBSB 4EGYA 3U1BA 2Z8ZA 1IE3A 3H5LA 2ENUA 3WP0A 1Y48E 5KJEA 3MOGA 1HYEA 2NO4A 1QG0A 2J9FB 4RAOA 4RA9A 3DTVD 4O63O 5IWCA 1GTMA 2JRCA 4JLDA 5EJAA 3JQAD 1WZNA 2QRZA 2YZGA 1N6LA 4KIFA 3NAGA 2Z83A 1ULYA 4PK4A 5E18F 2Z2ZA 1QYCA 1G59A 2UWMA 4YIKA 1YCFA 3BWVA 3X0DA 3WYAA 1XTVA 1CT9A 2A0WA 1OOEA 2XB5A 4KWEA 1OXUA 5LIPA 3CNOA 4PG7A 4MJXA 3KOZA 1Q7TA 3NS7A 5LHHA 3D4BA 4EA7A 4IDPA 3H5IA 1QIJA 1NY5A 1K7AA 4KFCA 2YN4A 5WRFA 2FRVA 2PNFA 5F23A 5DO9A 3OU2A 4Q05A 1FL9A 4HYYA 4IW3B 1MD0A 1L7RA 4P2BA 3QXHA 4DAOA 1VBFA 2GEJA 3VPSA 2XCSB 3KFLA 3AVTA 4X45A 2HZ7A 1JILA 3MT7A 1IATA 4R7TA 2IAIA 1G4AE 5AMXA 3TE6A 1YRHA 4E7KA 1U9OA 1G6HA 2O2DA 4RNDB 4LY9A 4O2BF 2HY7A 1ULTA 2HF9A 3FNIA 3QELA 2Y0PA 2VHXA 4R9UC 2V59A 1I2CA 3C87A 3AF2A 3VZDA 4BX9A 3AXSA 4OFWA 3EAFA 2O05A 4NBKA 3W5JA 2XROA 5DBIA 2HHHB 2OO3A 4DR6B 2FDCA 3FHTA 1AKNA 4FISA 4Z4FA 1PVEA 4IVNA 3EEYA 4HWSA 5KYVA 3D5SC 3WDMA 1ZKMA 3T9DA 4ZCLA 3AP3A 2XMCA 3AB7A 1C8LA 4NONA 2JVHA 1H9CA 1BN6A 5LVAA 1CS0A 1RM3A 5KQRA 4PXYA 5DLQC 2E48A 3C8DA 2G7MC 3NJ4A 2FX5A 3ZCRA 2QX6A 1DGRM 2M9MA 3DBVO 1EM6A 4HAMA 1T4DA 4EMTA 3BJRA 2I3DA 1SG9A 1OCZH 3KHTA 1PG5A 2JKYA 4LG0B 4MW9A 3GJQA 2Q9CA 4B46A 2CHQA 2OAP1 3KP6A 4MEJA 1PL7A 2OV3A 5J63A 3OFVA 1RZRD 1BD3A 1RXCA 4RIIA 5K3BA 4EH1A 5HKBA 3BIXA 4D26A 3Q9NA 5FWXA 2DPUA 1RLMA 2FOXA 2Y99A 1FFAA 3O9MA 4MYRA 4EG0A 1VBNA 4K86A 4BY7J 4J43A 1IJKA 4G9GA 2HU2A 2JK3A 5JEEA 3WGJA 2V55B 1JKRC 4F91B 1DQZA 4PZDA 1IM2A 4QUHA 4GOJA 1LW6E 2PSFA 1PHPA 1GP2A 3IR6A 3MPUA 4HQFA 2I22A 1WW2A 1TA0A 1VL5A 5A4FS 1A2QA 3RREA 2HO5A 1JBQA 2YRXA 2DLCX 5H9VA 3ZLUA 2OZ6A 3VXKA 2G04A 3HOUJ 3WG7H 3ZQLA 2WHPB 2QLLA 3DU5A 2VPWA 4MQLA 2IH5A 2FOWA 4PY2A 4YIHA 2FOKA 3HEFA 4G84A 2JUGA 3VDQA 3V9PA 4X9XA 1JGSA 3NT2A 5F21A 2LWIA 2FHPA 1ONPA 4AMVA 1NMEA 3FTDA 1QPIA 3DZKA 2O61A 2W2MA 1YQWA 4FZ5A 4QYMA 1PUIA 1TQHA 1BE1A 4HNQA 2PGNA 1XMKA 3ZPLA 3L01A 2R8PA 4JOCA 2VLIA 5EWLA 4Z2AA 2BZ1A 2H07A 2FAXA 4E7PA 1E9EA 1RYHA 2AS5F 2WSMA 1Z5PA 2I4TA 4OJNA 4J76A 1KE1A 5EIBD 3KXIA 3RTEA 3Q4GA 3BLYA 3KQNA 2C3PA 3VVCA 1P2FA 5A3QA 4BNFA 1SHLA 1HDCA 3ZWYA 1ATZA 4AUNA 3BIJA 2IGTA 4XOUA 1Y1RA 1TZKA 3KEYA 5CA0A 4ZYTA 2GN9A 2GZDA 1HX7A 1KR2A 4XYGA 3N58A 4XIGS 1JAIA 4FLMA 4NHOA 3KHKA 4F3QA 3NUZA 1M6WA 5DTJA 1TUIA 1UJ2A 5ERGB 4B32A 1LBIA 2FQXA 5L3EA 3PICA 5L3VA 3LDGA 2J4DA 3LBFA 1P75A 2H4FA 5FEMA 1SVKA 3IVRA 5JBIA 1XZKA 1MW7A 1P7ZA 2PRJA 4Z4QA 3ZKWA 5A4JA 3ABIA 4MMXB 4YV0A 2V7GA 2BV6A 1NF9A 5GOTA 3LUJA 3GLHB 4TKUB 3GT3A 1LRJA 1FE8A 4OGFA 2IZ0A 3F8TA 4H7DA 4PWZA 3AVWA 2QV0A 2VHEA 4M46A 1QSGA 4CUZA 1KYQA 3T61A 5I7HA 2VBYA 5JOQA 4EI7A 1RQ2A 4K03A 1X2BA 2A88A 3NC0C 4G5FA 2GFQA 3F49S 3TLYA 5TY0A 2B7LA 3S2IA 2LFBA 3HCWA 4C7OB 2XW6A 4I50A 5ESXA 3E9EA 1ODFA 1CPYA 2BFEA 2WUEA 4NDLA 5DOVA 2BLNA 2DT8A 3RGWS 4RNCA 1SC6A 1PG2A 3WGUA 1TU4A 3I28A 2WB2A 4RAZA 2F4VB 3ZBQA 3M4NA 4G8XA 2GBFA 2Y76A 2H7YA 3ZQ4A 1XZJA 5KX5A 1L5YA 1AGRA 1JKJA 4MOWA 2QLTA 2X41A 1MO2A 4MV5A 4QECA 3MQ2A 2BEUA 3CVOA 1F4LA 2OBMA 3S70A 3QQ5A 2ACWA 1Y0BA 3H0DA 3WSVA 4M6VA 1IRZA 1BHQ1 3L41A 3FHJA 1JG2A 1CEEA 4EY3A 1CRPA 4GP7A 4IHTA 3A1CA 4L9RA 4RETA 1Y1VJ 1GGNA 4DC9A 4PEVA 2W5UA 1IHOA 1DUIA 2O4UX 1RJ9B 4O4LB 1E2KA 5ISMA 4MRNA 1MBEA 3UMSA 1P2DA 2V9KA 3WXMA 4DWWA 1KGDA 4MWOA 1TM7E 2FSSA 3CEMA 1N2GA 1Q22A 1GPBA 3KZMA 5LQCA 5LMCA 4HW0A 3AONB 1NVBA 3EDYA 4AYBN 4V0QA 3WIUA 3O03A 5KINB 3AVXA 4KPGA 1Q21A 4IUCS 1WBBA 1RYYA 2UU9B 2GERA 2Y1GA 2RHGB 2GA1A 1YRAA 4D9IA 1KZYC 1GPH1 4KQHA 4WY2A 2O6GE 3CCEI 1W4CA 1PR1A 4CIAA 4ZEVA 1AU9A 4FYYA 1CDEA 4B6EA 5AOAA 5LXTA 1LKZA 1U2GC 5H82A 3S2FA 2GZ2A 5CH3A 3I05A 2NU8B 1LB2A 5HP4A 2O7RA 4LOJA 3FCYA 3FMSA 1YS9A 1DGWY 2BBYA 5KHDA 2VRBA 4BNHA 3ABSB 1UFQA 1N2OA 3F5MA 4M49A 1TT5B 1OI3A 3BXHA 1I3MA 3I0TA 3DDUA 5BW8A 2QSZA 2GKSA 2EOAA 1P0PA 1JEDA 1C8KA 1SPXA 4XD7A 5CPRB 2RBEA 1AUXA 2D5CA 1N36B 2E55A 5K7ZA 2P67A 4YVFA 3KPVA 4DSOA 3DMRA 3CZQA 3WYCA 2VODA 3ESYA 4OXIA 3GFGA 4Q9IA 3A1UA 3U4QA 2IZ7A 3PF8A 1RW4A 3UA4A 5B5SA 1AMUA 2XDQB 4FM9A 1RZ3A 3NP7A 3BCRA 1PYVA 5LB4A 1R22A 5SY4A 2DT5A 5CBPB 4ACAA 2CYCA 1H8HD 3BGSA 4EPRA 3QFSA 4R9RA 3M1IA 3UW3A 2DX7A 4ITUA 4E0BA 4J2HA 4HDOB 4RVCA 5KNBH 3P96A 3BE4A 3FZQA 4LXYA 2QN8A 2Y4OA 3PUIA 2CQ7A 1FBUA 2BR4A 1LI7A 4PG5A 1PRYA 3QYFA 3N3BC 4URZR 1L9KA 3WNVA 1BCRA 5BT8A 2CZGA 1CVLA 4QU8A 3MUNA 2R84A 3Q11A 3ML1A 3WMEA 1P31A 3VNSA 3EXHC 4OBXA 3L8ZA 4UUNA 4UNNA 3R6SA 1BE8A 2GN0A 3WL8A 3LLCA 3X2EA 5GOZA 3OQNA 1F2VA 1M6YA 4R51A 3DQPA 1TQMA 1E6LA 3HJBA 3JU3A 1W1IA 2QN3A 5I3ZA 4DDKA 2JFNA 2AW3A 1IY2A 4F21A 1WPKA 1PD0A 2CXUA 2CFSA 1EQUA 1XCGB 3HVKA 2X7HA 2JFYA 1UWCA 3DD1A 2QLZA 2E5NA 1GRRA 2D3WA 2DA6A 2GF2A 1P60A 4PHCA 4B09A 1LNZA 4D97A 3OQPA 5NULA 1LD3A 1V9SA 2W0SA 4TKMA 3G1OA 2XKAA 4LNAA 3GBPA 1KU6A 2CLHB 4XJXA 1X77A 2JJ2A 4BCCA 4A10A 4DLZA 1NQAO 1NX9A 2GEFA 4F5EA 4MYDA 3UMFA 2OB2A 1JIXA 2V65A 1ISFA 4J7UA 4QSMA 1HE2A 1QIDA 3AT1A 2CXXA 1XWWA 2ZIVB 3SFTA 1U2SA 5BWCA 3ENKA 4PYRA 1HXHA 2WB4A 1J2EA 2FZWA 2IP1A 5ALUA 2WG0A 1YI0A 1ZM4A 4H6XA 3TOAA 4BDSA 5MN4A 1KS2A 1P5JA 1U0BB 4BHPA 2I34A 5DIZA 1DEAA 1Q0LA 3DBLB 4WY5A 4HNHA 1KYYA 2GRAA 4QYXA 1SK8A 2V7XA 1U0HC 4B7ZA 4JYPA 4WECA 1EZ1A 3EWAA 4ID9A 4JNKA 3RRYA 5H7XA 4C3ZA 1B1BA 2AJTA 3QOFA 1V7ZA 2B99A 4M9QA 4JP3A 4BDZA 2ZCUA 5A71A 4DQUA 2FJ0A 1P1CA 5G0UA 3M3HA 1L3IA 1EDDA 3TP0A 4ZV7A 4OI4A 4C76A 1YL5A 4LNUB 3PHCA 4RMJA 4BOYA 4UC0A 1BGXT 3Q8WA 5J8CA 3WQRA 3EDQA 2G67A 1RC1A 4MEAA 3NLLA 3H1CA 5K3EA 3QYPA 2CHVA 3JAWA 4WDRA 3GCMA 3BJEA 1BOAA 5IN5A 5JXJA 2E9SA 1NRWA 2WK1A 3ER9A 1MJFA 4BDYA 1UFVA 2A5YB 2VSQA 4XJVA 3MERA 4PLFA 3SYMA 3FF4A 5F04A 4OLHA 5LP1A 1G9XA 3M81A 1R1VA 3VPHA 5PNTA 1K7XB 4REMA 1NHAA 5I9NA 3Q6MA 1EB8A 1XYGA 2YV3A 4LIPD 4WXPA 3Q3CA 1GNSA 4UTZA 2RG7A 4A3MJ 3C5VA 5D7NA 4QULA 1Y81A 2BMDA 3C1OA 2W9XA 4TM8A 3DMNA 2PGJA 3HPRA 4FIZA 2CUZA 3VOAA 2FSGA 2XVMA 1RZUA 4CM4A 4M3NA 2H08A 4IXMA 2OWDA 5M2QA 4K1LA 1ONSA 3GLFA 4J91A 2WA0A 2R8OA 4PJLA 2VDPB 1EEHA 2RC5A 4ND7A 3ZCXA 2IIQA 3RJPA 3GDFA 4ZTUB 1U3TA 4I50F 4A16A 5BSMA 3FUCA 4WLOA 3CO5A 3A4LA 1WVMA 1FBNA 2B34A 5IDQA 4HO1X 4NMWA 3HSSA 1Z68A 2FMUA 1HKUA 1AHHA 1KSJA 1QK4A 4M1MA 4BTLA 1USSA 1UDXA 4KTTE 3OD1A 4U9HS 3FHOA 4XUGB 2IF2A 5GM1A 4KMSA 3J7AO 5CXQA 3R6GA 2GA8A 4IHVA 5KX5F 3OMLA 4L5CA 1N6NA 4XWWA 4FHFA 2GZWA 3FPJA 1Y1TA 1RLIA 5LDDC 4N9IA 1A8QA 2R96A 1WSWA 3LOUA 3K6GA 3GAAA 4CMEC 3MUEA 1Y4DE 6REQB 1XCJA 1BX3A 4G4JA 1RI7A 3G3ZA 5TQJA 5K0JA 1NASA 1ONBA 4D45A 1CY8A 5JSFA 2XUIA 5JXIA 4BS9A 5J1SB 1D5CA 2EU8A 2C54A 1ZOSA 1LDKB 1Y3HA 2AT1A 2XEXA 4OUKX 2P8SA 4PFQA 3E1SA 2A9JA 1A5ZA 5DNEA 1PD1A 4J0CA 3GJ0A 1TYAE 3ZVMA 5FROA 3RROA 2XTJA 2Q0QA 1XEXB 1CRQA 4QYIA 4JLWA 2PUVA 2A2ZA 3OFKA 1N2XA 1Q1ZA 4MPJA 4LXHA 4DZJA 1W7PA 4D96A 5CNKA 1EVKA 5GV7A 3AVPA 1ZRHA 1H9BA 2QSUA 5C5CA 1KKUA 1IWBB 3OO0A 2F3RA 5TGZA 4FT4A 1KJNA 1FP4A 1V3VA 5I4KA 1E2GA 1C9KA 4QBHA 1WUYA 1JE8A 5LXTF 5T41A 5BYJA 3F6YA 2JJ1D 3V2HA 2GYYA 4F5YA 4AM8A 1UJNA 5HDNA 4A5NA 2BGRA 1L7BA 2HA6A 4RAQA 4BN0A 4RZSA 5DYYA 1ZH2A 1U9YA 1FIAA 1XJWA 3G2LA 1OTYA 5HQTA 4IVQA 2WAQA 2JN6A 4CCMA 2PT7A 4BACA 4KXFB 3HWRA 3AIKA 1I27A 1TUBB 2OZEA 5AI0A 4QVKA 2HOTA 2X5XA 5F08A 2Z8YA 3R3XA 2PL9A 2ZRKA 4YWHA 2D0PB 4NBRA 1RQRA 3ZHOA 2DA4A 2RHJA 5CU7A 5A3RA 4XEHA 2C82A 3RYHA 5KYTA 1RZVA 3Q2IA 1T8SA 1KI8A 1P39A 5B6PA 3H9BA 2VYVA 2QSHX 4CZ2A 1YVRA 4CF5A 2IEGA 1YHZA 3ZV7A 3EF0A 2SECE 5JV5A 4HB0A 2AV6A 3ZGLA 3D1LA 2I2DA 3C6BA 4LDZA 4PLPA 3RYIA 1IQRA 2OO7A 4X8MA 4ALMA 2IBTA 5F0CA 5J59A 3C3AA 1X7WB 5BV7A 3O8NA 4UEOA 3EPJA 1GG9A 1JHUA 5JMTA 1OV4A 3W1WA 2VYFA 2G40A 3DAOA 5KAFC 3O2SB 1RPNA 3GTKJ 1SKQA 2AC2A 1DOHA 3G1WA 4U6QA 3CLTC 5CIQA 2XLCA 4OPMA 3KEGA 5C7LO 3DJYA 3GGGA 3DHEA 1Q77A 2RH5A 2IEYA 1IG7A 1SVIA 2R6JA 2WOOA 4W5HA 2AN9A 3JRBA 1WZEA 4NABA 4RTLA 2I1LA 1I4DD 1VE3A 3MPOA 3EPPA 2Y71A 1M1UA 3EPZA 2N46A 3JSPA 1TT7A 1OBCA 2BC9A 1GDTA 3QFRA 4Q3AA 4M88A 2UV8A 2YWDA 4JODA 3MIIA 3P4XA 1JHRA 5E8IA 2V5VA 3U49A 4ABYA 1GGVA 2PH7A 3GLIE 4UNQA 1S9DA 3IALA 1NGSA 4MHGA 1ZM7A 4G09A 5IXSA 4JR0A 5DM6F 4YN3A 2LF8A 3TQOA 2EW1A 5CR9A 3FVRA 3S2WA 1IN4A 3ZE6A 1V4RA 4ND8B 1BFUA 3A6DA 3WU0A 2FF5A 4QTZA 4BWYA 4JLNA 3HG7A 2JFHA 1S3IA 2VAXA 3E9YA 4TVSA 1GLNA 3LQ1A 3C41J 2GZMA 1QMPA 3O74A 4K88A 2MINB 2H5LA 2UVDA 4EA8A 1TZBA 3QU9A 4HSGA 3EVGA 3L7OA 4L8LA 1PSDA 1IQ0A 3NARA 3M83A 3O38A 3KEOA 4GM0A 1KONA 5HF5A 4IR7A 4F2HA 3MTBA 3MSXA 5AKIA 5T4EA 1U1DA 2W6OA 2XGSA 1M2HA 1QR6A 3RS5A 1QGUB 4F7WA 4CKWA 3WG9A 3LY8A 2DDBA 4YT2A 5DHFA 3TNYA 2B1GA 5FLEX 1D8AA 5D2CA 3GLGA 2AKYA 3ELDA 3TGWA 3KSZO 1II9A 1AO3A 3P7MA 2MSEB 3B3AA 3GTJJ 5JISA 1EP2B 2F8SA 2RJNA 2VA8A 2VBGA 4OXRA 1K6YA 3UYLA 1USIA 2ODEA 4GC5A 1X7XA 3UJDA 5IY5H 4RK4A 2NZYA 2WG1A 4RQTA 3V1YA 1N5DA 2VQLA 3BC1A 1SQ0A 2Z5LA 2FRDA 3PQKA 4LIVA 2HF7A 3NTQA 1N0WA 3GZ6A 4F1WA 1OPXA 1BN7A 1NTRA 2IGBA 2BRUC 3VOTA 3QSGA 1JMYA 3C8UA 4A6DA 3UKJA 4A3CJ 3M9LA 3R7BA 3EC2A 4X5OA 2JA1A 1P0FA 1NHGA 3MEQA 1SQSA 3D6JA 3L7KA 4XCQA 2HI0A 3SZPA 2X9DA 1ZZGA 3W7AA 4EKGA 5GADJ 3KWFA 1GSIA 2UV1A 1OLSA 1IRFA 2ZAMA 2JG3A 3RRXA 1CNMA 1M7HA 3AUTA 1A5JA 1GAJA 1ZD3A 4IO1A 4CM3A 4IZ6A 1O77A 4UHCA 3X1KA 5IUNC 3W5DA 1E4OA 1V5FA 1I30A 1IZ7A 3R5KA 4XWAA 1FRNA 4ZQGA 1IUFA 1QNFA 1P1JA 4WNYA 5HRCA 5HVQC 5C8YB 3MWFA 2C04A 1DC8A 5E2BA 1E63A 4WFQA 1GV0A 4FFWA 2LXNA 1XNGA 2EFJA 1AMNA 3K9GA 1D0YA 3ZVRA 4ME6A 3U39A 1T0UA 4OVKA 5AHWA 3CURA 4WCFB 4K0RA 2X6WA 4FX4A 2IH4A 1P5HA 2J5QA 1J24A 4IQ0A 4BMPB 4DJEC 1II8A 4F96A 4MIEA 3F72A 1R10A 3SXPA 1P9RA 5C8ZA 1QTIA 2O0HA 4ERNA 3JR7A 5LZ7A 4DA4A 3VPGA 4ER7A 5BMVB 3NNNA 3ZH9B 2QLMA 4E1VA 3LBAA 1XTAA 4K6MA 1I3CA 5LKAA 3GDOA 3I04A 2IHUA 4AIJA 1C9JA 3OI7A 2ZYWX 2DXIA 4JLMA 1L7XA 4LV5B 4A23A 3X1YA 1HUQA 3W90A 5CXSA 3DFFA 4IBOA 3U9TA 5GJBA 1KFCB 2WYUA 3HU5A 2H1WA 3ZJ5A 1G3TA 3HA3A 2M45A 1C3OA 4QFBA 2H85A 5FQOA 1HC8A 3JV7A 3WYFA 2HOSA 4MWSA 3EXEA 1XMPA 1W4AA 3CMYA 5DN9A 5IZCA 1XPRA 3HHGA 1ZAKA 5CT9A 4DBVO 1SZPA 4QELA 2VBFA 1U1GA 2L4MA 4RCZA 2ZBVA 2XD9A 2PPLA 3H2GA 4CF6A 1XU7A 4UJ3A 2XKOA 1DZIA 1QKKA 2X15A 4KW7A 4H0FA 2CHUA 4K7JA 4J1TA 1EVEA 4M0DA 5LLSA 4KHZA 5KNDD 1G6Q1 3QMMA 2C5FA 1EVQA 2C07A 2R1VB 2ONCA 3BR2A 2QI9F 4QEDA 2LW7A 4CDNA 1D0SA 4YRRA 1LK7A 4NLLA 5HSGA 3L09A 5KVVA 4DLVA 3CLUD 2AA3A 1H2YA 2H1CA 3WTSC 4PSDA 1PTKA 1R5JA 3FN4A 4P3KA 3IUQA 3QLUA 2VNIA 2QZ8A 5FLXZ 2QMOA 4INJA 5J4LA 2GF0A 4H3HB 1VHLA 1SOAA 1XD9A 4X1YB 4M3GA 3AFNA 4DA0A 4YX9A 4KSCA 3ROMA 3QITA 5HE9A 3IULA 4D4HA 3R2JA 1VPTA 1U78A 1P4WA 1P2VA 3IS3A 3I2JA 3CVUA 2ERCA 1EWKA 5JCOC 1D2EA 4F4UA 2A59A 4ZTFA 4TLLB 3ELWA 4BFWA 1SUDA 3NIFB 4W1PA 2FMHA 4UXHA 3P9YA 4MAAA 1XPOA 2PSDA 1A1VA 5MF6A 3H35A 3OLVA 1JJ8C 4JB8A 3OCXA 2ID4A 1QQ6A 2OHHA 3PC8C 5JVGF 1AD2A 4KCGA 3OYFA 5JY1A 3GCGA 1T0PA 3BREA 5HNFA 2VNAA 3E7LA 1TQIA 2BWJA 3ESAA 1M2GA 1DOAA 1WQ1R 3DD5A 2BVNA 4WZBA 1S9HA 1SBNE 4JJZA 2JHCA 1Y3BE 1K8ZB 2AEFA 1GCOA 4C0XA 4J49A 1C3XA 1C0KA 3DZHA 3ESQA 1QF6A 3IV5A 4QDUA 3NB0A 1GR1A 5C3MA 2QN6A 3BYZA 1ICIA 4GLOA 3JVEA 1DMSA 5K7SA 2W6NA 1J2JA 1UHSA 2EILH 4CM5A 5DSXA 4A93J 1RAGA 1KQGA 4DZRA 5TDHA 1Z6QA 4HF7A 3PDHA 4CDGA 3NEUA 3TFWA 2PMZA 2ZIGA 2HQNA 3JRWA 1BGWA 3WB9A 4BMSA 1U0NA 3WLLA 2ZJBA 3ANMA 1QUFA 2WMOB 4L51A 2CW7A 2VAMA 3RASA 3WP1B 3PDIA 3EVAA 2FSIA 5DGHA 2VVTA 4BV3A 2NYUA 821PA 1A9PA 4YQZA 4AX8A 1Q14A 4KH1A 4P4UA 1HH4A 4KGDA 3F3XA 2R7UA 4HDSB 5M5WJ 1FS6A 2DB3A 1Z82A 3NVAA 3PC4A 5LOVA 1RWQA 1MHPA 1C3JA 5JRZA 3HWWA 4BBPA 4JH0A 3A9CA 3AM5A 2ECPA 1AK2A 3D6VA 4YALA 3RK0A 4BMVA 3QPDA 2JCBA 1TUGA 3T54A 4BE7B 5E3JA 4WFKA 3BWYA 3FOWA 1NRXA 1U90A 3K1MA 1KDPA 2E6UX 4JCCA 3SMQA 2BI7A 3BA6A 1U1EA 4OHPA 4BLPA 4ZCTA 3LD9A 3DTKA 3CUYA 5I4IA 1YAHA 4ES6A 1OI7A 4CKCA 3DPLC 5KTYA 1N2CA 3SIRA 4KACA 3GD5A 2I71A 2OZUA 4QE3A 2Q0OA 3SC4A 4DKJA 1QV9A 5BNIA 1CJMA 1ULZA 3FFTA 2ZU0C 3T6KA 4TMZA 4W6ZA 4IFBA 4Y2YA 3H8WA 4HDKA 2PEZA 3UUFA 4PC3A 4XH9B 3K94A 2YS9A 3LPAA 5TJHA 1LPSA 1GAWA 2Z2XA 3E4DA 5IJXA 1K9VF 3AEYA 4MQ5A 3BPVA 1IXCA 4M4SA 2ALJA 1Y63A 4EG5A 2ZR7A 4YDHB 1RPAA 3RLIA 4IDOA 3GJ3A 5G4KA 3L0ZA 4B33A 4NYMR 4MEYF 3CMAI 2Q3JA 5JD6A 5F0HA 1U02A 3ILXA 4Y98A 4HX5A 3GPBA 3HI6A 1KDZA 4LF8B 1R5GA 1DL5A 3HJRA 1X2MA 4IHAA 3ND9A 5AK0A 3ZD6A 4DR1B 3A4CA 3M5WA 3Q3SA 1GQ2A 3DLIA 2XMRA 1JAYA 2JAOA 5A0FA 1HCRA 2DBRA 3KC2A 2ZSAA 3HKCA 1EGHA 3AKZA 1N2JA 2B82A 5BNGA 2ZE8A 1DFGA 5KQGA 5BR1A 1Z5OA 1NOKA 3NTOA 3GCDA 3LNTA 2QP9X 5CA1B 4CV2A 4GKJB 2J3IA 4UTRA 3L0BA 4HNAB 1T4CA 3NHSA 2GPBA 1VM6A 3I9OA 2PRIA 3TOBA 1XGKA 2XDVA 4R2XA 3HCNA 1GG8A 4J1QA 3MJTA 3FFWA 1P8JA 3T0GA 1ESCA 1S2LA 4ENWA 2UKDA 4MYCA 1Z2EA 1E3WB 2PLFA 4DPKA 3CTAA 4HUTA 4LWOA 4J2TA 1VXOA 1IZYA 2PX3A 3JX9A 1WU7A 4JUIA 1GRVA 4IILA 1RADA 2WC2A 3AHHA 3IUMA 1QPZA 1PAUA 1HYHA 3IYLW 1CCWA 1KP2A 1T1EA 2DTEA 2RKWA 4N9QA 1W5CC 4U88A 2XNSA 4F84A 2VCYA 1YACA 3MS7A 5EUBA 2IYYA 2DTDA 1PJ8A 5KMGB 2ZT7A 1MDMB 4BNMA 4RJJA 3LAPA 5CDHA 1F2UB 2V6BA 3ZE9A 1WBJB 3O91A 5IABA 5K3DA 3BMXA 3MINB 4TTPA 1MBJA 2Z4RA 3T7DA 2J9YB 2WAAA 2MSCB 3GD7A 2AVDA 2YZMA 2EX4A 5AVYA 1FX0B 4H9GA 1P5FA 1TKRA 2FPPB 2VDQB 3ZX4A 1J8DA 4NAHA 1B72B 1SIBE 5LU8A 3ZGYA 3KIOA 2OXCA 2P6MA 3RFXA 5EXXA 2OV4A 3TH5A 2OBNA 1WFXA 2BSQA 2C42A 2ZXFA 621PA 3MTGA 2C8LA 4DR4B 3IOMA 1DRVA 1M2NA 1EFCA 3C6KA 5LEJA 1NYRA 2NXNA 3MILA 3D9QX 5JLWA 5AM0A 2JAQA 4N49A 2A9FA 1M66A 1ZX1A 4JEMA 2OE2A 1JEYB 2B7EA 2R93J 3CUQC 1CUSA 1YS6A 4M1ZA 3L1PA 4FMDB 5LZ2A 1E2IA 5JYDA 2HWXA 1W96A 3GNTA 5TMPA 3D59A 1PV2A 2XA1A 1XPUA 5L7WA 1G21B 1M1EB 1G19A 5DTMA 2OV6A 2OXRA 1P80A 2G1KA 3IUYA 4GT1A 2JARA 2A6EF 1CUXA 2WBMA 4JP8A 2GBYA 4ZK6A 2WYVA 1P4JA 1WHSB 1TQ8A 5AKKA 4D8UA 3IV7A 5KREA 4G6TB 5CT8A 4NE7A 2DBYA 5CGQB 2CXOA 4JT8A 3BBLA 2ZKIA 4KZPA 1H85A 3E5MA 2I6SA 3N59A 3ID6C 3H86A 3K0LA 2ID7A 4FHTA 4CKZA 2BH9A 3ZCTA 3PPVA 1C1HA 4D0PA 3VU8A 3CEHA 1DWPA 1JUDA 3JAMZ 1BI0A 2HR1A 4QJ5A 5ALTA 2CUEA 4MVJM 5CITA 5KU7A 3EGDB 1MGOA 3ZDFA 3OG9A 2R0QC 1C4WA 3IGFA 4RB2C 3AJ9A 2FX3A 1WY5A 4Q4AB 3MCVA 2FMXA 3JQEA 3T5BA 2C3OA 1TIBA 4PZEA 3T5CA 2ANCA 5FTKA 4JT4A 2A0YA 3MW8A 3U16A 1UC4B 1YB2A 2ZR0A 4MV8A 2Q6OA 2GYWA 1JE0A 3TLKA 1BU8A 1QMGA 2LOOA 1O8CA 1GNVA 3GJRA 2WJJA 1V37A 1YQGA 5IT9Z 3EGVA 3CO0S 1JFVA 3ELUA 5IT5A 4IHQA 2VHJA 3D4NA 3UNXA 4KUEA 4J1NA 5CDSA 4QPNA 4UMVA 2AZXA 4K9LA 3G2MA 3AB3A 3EGEA 3C3BA 4MS3A 3AC0A 5LOVF 2QRQA 4YRDA 4QYTA 3A2KA 3ADPA 1X9IA 1GO2A 4FTWA 3EEIA 5B3JA 2UYGA 2HV9A 4K26A 1XD2B 3LNQA 3U4CA 4IIGA 4P3PA 2HYFA 3B1XA 3CUSA 2JIZA 4X0GA 1NVUQ 1TTQB 3BSYA 2AXEA 1E3MA 5GP9A 4DNFA 4K87A 4PS1A 2RGNC 3O7WA 3PUHA 2FBHA 3WNBA 4CMIB 3HU1A 2WV0A 3WHBA 5G1PA 5TXGA 1DBQA 3TAUA 1Q0TA 3EQ9A 3DFIA 2P68A 4QJ4A 2I5PO 2PKWA 4HUQB 4D3YA 1OLUA 2NQ2C 1HSTA 2AE2A 1P1BA 3SYTA 3E5NA 4M55A 3WSWA 2PAFA 3DOHA 2ZRCA 3K16A 1PHRA 2O8FA 2KT0A 3PD7A 3WMXA 2SICE 1G3IA 1E2MA 2QG4A 3L7NA 4JL8A 3RKWA 4NBQA 4NATA 2MYTA 2PWBA 4BNYA 4EL0A 3MJ4A 3NW9A 4HBLA 3QXCA 3S5JA 1A9ZA 3LSIA 3OL3A 2PX6A 1QFXA 2G9ZA 1EP1B 1FCJA 2N3ZA 2UVPB 3QLJA 2R87A 2BBWA 1YZ3A 3E9MA 2QQGA 3KR1A 1J5EB 3K0CC 3HRIA 1VOTA 2EFNA 5H2FC 2A30A 2V45A 2DFIA 3BXPA 2VWGA 2A69F 5CYVA 1SOMA 3ETHA 3OP4A 2JSPA 4JXJA 4GCVA 3P8ZA 1O6BA 4F60A 1YDWA 4IPTA 3FNQA 3G68A 2GARA 1EKEA 3A4NA 1XRNA 3RRBA 4Q37A 5DGDA 1Z6TA 4Z9FA 1V5EA 2JGRA 1Z1DA 2QM8A 2CL5A 3FOFC 1QRDA 3OZBA 3U4GA 2WTEA 2WJAA 3CQ9A 3HVJA 2VRWA 2WHQA 2C58A 1YC2A 4MUHA 1L5ZA 3T7CA 2OU2A 2QN2A 2BZTA 4YTEA 1Z07A 3OIOA 3QU4A 2JRLA 1YFKA 5E1MA 3TLZA 5DE3A 4GYWA 3S2EA 1KA8A 3HA7A 1GSHA 1NT4A 1JR3E 5LMUB 2BGIA 5BW5A 2G72A 3I9LA 2R6HA 2CLLB 2QGNA 4RTNA 2Y2UA 3FLEA 5DD8A 3B5IA 5HJ5A 2ES4A 3BBPA 4I4LA 4AULA 2XNHA 1AUQA 3UBMA 3HBMA 5DASA 1MSFC 1X14A 1BEUB 3GJ7A 2IV3A 3TQQA 2PKEA 2QTRA 3C4VA 2PKQP 3T12A 2ACEA 2O8DA 1Y9AA 2HXGA 1B0ZA 4OAPA 3LWBA 2HK8A 2R00C 1RXEA 4ODIA 3L0SA 2W2KA 1DAEA 4POAA 3NNDA 2Z1MA 4LBYA 1TM1E 1CGPA 5AFSA 4BL5A 5K8UA 3I3SR 3HBAA 3UWPA 1YJBA 3R3ZA 3A1DA 2G63A 3ZQJA 1CR6A 3COVA 4G8DA 2EA2A 4K5QA 3H13A 2PS3A 4RELA 4YNBA 3TL4X 4OGWA 2GVZC 2H2DA 3JQ7B 5I9BA 5E1XA 3GTOJ 3NBYC 2YJ5A 3CBGA 1XV5A 4P82A 2ELJA 1T6BY 4O1HA 4IIUA 3ZIDA 1PLJA 2EBUA 5F3WB 2Q0XA 5A7GA 2REQB 4C0AC 1T2UA 3PRKE 3VBCA 4EGFA 1LU9A 4BH9A 1Q7RA 2IPAB 3SZOA 2RGXA 2PQMA 1H9TA 4AKEA 3RTRA 2LP4Y 3OHPA 1O3SA 1H9AA 2H8GA 5JSZB 4ZYEA 2HUNA 4HQEA 5CT6A 4A8JC 3T7IA 2HXSA 1PJBA 1JB9A 1TPYA 2ZI4A 3IMCA 1W5TA 5SYNA 2V96A 4HQ6A 1B9MA 1CJVC 3BC8A 4G9YA 2FH5B 2ZAIA 2M30A 3NYRA 2Z58A 2YZKA 4CI9A 3FNEA 4CQNA 2YICA 4A0RA 5FRDA 4G0WA 3GNLA 1JHFA 3GUDA 3GEEA 1HRDA 1PO7A 2MSNA 1I4WA 2B98A 3PM1A 3RYFA 4KIUA 4HNTA 4NCJA 1ND5A 3OYCA 4DDUA 4RY0A 1I3KA 4M9ZA 1GA4A 5JR3A 1RM5A 2HVQA 4PM4A 2IPMA 2IT0A 3NHRA 2I99A 5COAA 3MFYA 4RF4A 1KI9A 1LPBB 1VQLI 5BRJA 2ODNA 4O1MA 1I94B 3W77A 1KVUA 2NW6A 3NR2A 1Y8QA 2Z3VA 4EVRA 3CX8A 1IUYA 2EZUA 4XE5A 1YUMA 3H5VA 3TKLA 4QGGA 1VG1A 1JKXA 1Z37A 3MK31 3SQNA 2K3FA 1ODJA 3H2HA 2HQSA 2ZDHA 4UREA 4B3XA 3N8GA 3JREA 3ICOA 1PDNC 4P9NA 3QOPA 1P91A 5CLHA 3KU4A 1EVIA 3Q0IA 1C29B 2DF8A 3ZDAA 1NVVR 5B1YA 4TN5A 1OWPA 1ZLYA 5D7BA 3THWA 3O9ZA 3OM1A 1AOYA 2VPQA 4K3VA 2QTBA 6Q21A 4H4EA 5EF6A 2G7HA 1RMTA 3QOYA 3VEPA 2JJMA 1YZKA 5TARA 1FQKA 4A03A 1C2YA 3OFSA 3NBUA 1VFPA 5DHQA 1E7YA 1SMTA 4RGRA 3JXEA 3L8GA 1H4QA 2MU1A 4PQFA 3GLRA 4BNDB 1I8TA 4HYQA 1LKXA 5EMLA 1KQNA 2XGGA 1XTQA 4MO7A 4NEQA 4DQKA 3C5WP 1K4KA 4PCQA 5HILA 2WZQA 3IVAA 5LGTA 1RVV1 1VPVA 1HY3A 1QFMA 3LVQE 5DWQA 3IH3A 2VSOA 4CKEB 1RHRA 1XZIA 3RIMA 1P7JA 1RHJA 1M2KA 1PYDA 1Q7BA 4J16C 3DEWA 3THRA 2YNMA 4OAZA 4C4AA 2TMDA 4C3UA 4QLBA 2VJKA 3GA7A 4R81A 3CEPB 3BHIA 3ZHSA 1QPBA 2WTAA 4ZAGA 1APBA 1SFKA 2QQAA 1E9RA 2FR8C 3C24A 1OU4A 1OPCA 4Z9AA 5JNRA 2M8EA 2XF5A 2QRMA 4D99A 5HS7A 2SKCA 4JLOA 1IRXA 2KPOA 2W2VA 3U4AA 1QGYA 4N65A 4MCAA 4U7DA 2JB9A 3TD2A 1T29A 4QM7A 3A25A 3BJMA 1XI2A 1RABA 4C3OB 1R16A 2DHDA 2HZTA 3DE2X 3ZLVA 4OSOA 2IOFK 3H17A 3I4PA 3NONA 3SQMA 3BSWA 3KUKA 3UR3C 3S8PA 3EGXB 3GT0A 5DIFA 2BISA 4X84A 1XA3A 1LFAA 3D8TA 1XYYA 2PJRA 4PFKA 1R88A 1XC5A 4GMDA 3G2PA 4NV0A 3CSDA 3MB8A 3HVIA 2R5NA 3H6GA 3IKLA 5B2ZA 2I2FA 4MW7A 4U02A 1U7XA 1ORWA 3FWHA 1USGA 3WKEA 3KT8A 4HRYA 3O94A 4RZUA 5JATA 3GPIA 4CV0A 5BSVA 1NNUA 4FVTA 3P71T 3FBIB 3IP6A 4AU7A 1QAQA 1MJAA 2WD7A 3W5SA 2VDWB 5JCJD 4YDQA 2OJED 3GBVA 3T5MA 4EB6B 4NHEA 5EZ6B 1JB1A 2NUAB 1OIXA 3BXEA 2QRKA 3GGJA 3PTZA 1D4OA 1R0KA 3PGLA 4CFZA 1G42A 2GM4A 4WNCA 3AHEA 3NPAA 1DPUA 3FR7A 4Q12A 1M6NA 4Z9YA 1X1EA 4TKVA 1PSZA 1CK4A 4IS2A 4S05A 4OLJA 1V71A 3O3NB 4KL8S 1UH5A 5HKKD 3CFYA 3RARA 1CP3A 4O4JA 3U3MA 3DCJA