4EVIA

Crystal structure analysis of coniferyl alcohol 9-o-methyltransferase from linum nodiflorum in complex with coniferyl alcohol 9-methyl ether and s -adenosyl-l-homocysteine
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
368
structure length
360
Chain Sequence
MDAATAVELLDAQPQVWHHFLGYINSMTLQCALELDIADVIHRHGHPIPLNQLAAALEIPQTKAPFLSRLMRMLVHLGYFTQVITKLPSYWLAPLSRLLLKQNPYNARSLTFCSVHEHLVDPWRQMSAWLRTGKEDGKDTPNAFAFAHEGKKVYEVCSEDANFSQLFSEGMAGDSWLFSRALVSKCRDAFEGLSSLVDVGGGTGNTSKVIAETFPNIHCTVFDLPHVVSGPKQTHPNLDYESGNMFTDEIPHADAVLFKWVLCDWPDEPVLKMLKQCKKALTKNGVKGKLMIADHVLDHESCNDSNSMGTSLILDMLFMSFLEGSLRTEKQWAKLFAEAGFKDYKITPVGGLRVLIEVYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of coniferyl alcohol 9-O-methyltransferase from Linum nodiflorum reveals a novel active-site environment.
pubmed doi rcsb
source organism Linum nodiflorum
molecule tags Transferase
molecule keywords Coniferyl alcohol 9-O-methyltransferase
total genus 128
structure length 360
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4eviA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4eviA02
3CJRA 3FUXA 5CLSA 3K69A 3P97A 5FD5A 4O3MA 2UYHA 1YLFA 5LQJA 1R23A 3ZMSA 5EHIA 1J75A 1PJZA 5FADA 1B42A 2EFNA 2LSOA 2HQRA 3HCBA 4FR0A 3JTHA 1IW7F 3TKAA 5LHGA 4AIJA 2EV5A 5DT2A 2M1BA 1S7AA 5DPMA 3T8RA 5K09A 3F4KA 4LB6B 5T67A 4ZTBA 1X1CA 2MH2A 4EKIA 1G3YA 4HYEA 3O31A 1KPHA 3DMHA 1BJAA 2JPBA 2I9KA 1M0EA 1OYIA 3IYLW 3BWMA 2FRHA 4EJOA 3NWBA 5K5QA 3SGLA 3L9FA 1W7PD 4YUYA 2ISYA 3IHTA 4RTKA 2DU9A 3F72A 3Q9SA 1PUEE 1W4MA 2UYOA 5GIPE 2O0YA 2AOWA 1RI5A 4L0ZB 3F6VA 3QU6A 2HTEA 3MTEA 5K1YA 5KYGA 3QP5A 3BGVA 4LLGF 3IKTA 2QRVA 2XYQA 3THRA 1ORHA 3UFBA 4GEKA 2ZZNA 1WXWA 2VS1A 3TKYA 3LKZA 4X60A 2ZCJA 3O3KA 1ZGJA 4WXDA 1FC3A 4RB2C 3CBGA 2PGXA 2IJLA 3DR5A 3HVJA 3TDZC 3T8TA 4OMZA 1MKMA 3M4XA 1U2WA 1MDMA 4BLWA 4Q4ZF 4K6MA 2ZSUA 4RTNA 5FA8A 2FNPA 4P5OA 1QPMA 2ACJA 5K0BA 3N97A 2XAJA 1X19A 2WA2A 3UA3A 1R1VA 1RI1A 4OOIA 1MZBA 5DUKA 3IRQA 3GJYA 5E9JA 5FCDA 4V0RA 3PFHA 3WTSC 3LKDA 3I71A 5DCFA 3FYCA 3EYYA 10MHA 2EA4A 2O03A 3CJQA 3LDGA 5ICFA 3TLJA 3MERA 4HA8A 4YV2A 4LLNA 1KQ8A 1XD7A 4O5VA 1R8XA 1YS7A 3UWPA 3PB3A 2ZJ2A 4H0EA 3FPHA 2TDXA 4HQMA 2A3SA 3KLOA 2D45A 3G8BA 4RVHA 1DPRA 4AZVA 4RB1A 2ZBPA 2STWA 3JWIA 2DPUA 1PDNC 3DV8A 4HDVA 2IA0A 3HCCA 3MHTA 5EC8A 5EEHA 1ON2A 3C0KA 3M1EA 1I1SA 2FRXA 3DF8A 1BM9A 1O57A 3CCFA 1YW7A 3C3YA 4X63A 2V1DA 3R0JA 5DXAA 5P8WA 2GAFA 5DSXA 1G55A 1J9IA 4YG2F 1F38A 3S68A 1UHMA 2GZWA 1HSJA 3ECOA 1EJ6A 2EB7A 1S29A 3I59B 2PXCA 1LB2A 3R9XB 5CM2Z 4MTEA 3N4MA 2NXJA 1BHJA 4IV8A 5EGSA 2VDVE 1X3UA 3L09A 4CO8A 2FXAA 4RTRA 1Y8CA 2GA2A 4HX8A 2ESRA 3B3JA 2CW0F 1XVAA 3HHGA 3ROUA 3HHHA 3BT7A 4I09A 4XSXF 1CF7B 1Q1HA 2QM3A 4GUAA 3RIEA 4ISCA 3PLAE 5LGUA 3GZ6A 4PONA 3LDUA 4KIBA 5BMZA 4P7FA 4YIFA 2KJBA 5F2KA 3FTCA 3KE2A 1S6LA 1Z3CA 1C0WA 1ZLKA 3KQOA 3ML6A 2EG5A 3HOSA 1VBFA 1R36A 3K2ZA 1NW7A 2ZMEB 4L9VA 3OZSA 5LGTA 2OQGA 1K78B 4IXAA 2DQLA 3ZQ7A 2XKPA 1O54A 4GC9A 3VYWA 3P71T 4RB0A 3GWZA 1G6NA 4FT8A 2ONYA 5HIMA 2V1XA 2HEOA 1Q0SA 1LDKB 1W7PA 2P6SA 1SVUA 2F2EA 3LX6A 4GGGA 5HFJA 3KLNA 5HZMA 4IHSA 5LQCA 4YUWA 1W5TA 4ENNA 3FPEA 5CUQA 1GXPA 3BJAA 4HF0A 2ZNYA 1TBXA 5CIYA 4A5NA 3NDIA 4OINF 4OIQF 1MJBA 1YG2A 4IV0A 5MHTA 4RGUA 1YZ3A 4PYJA 1K79A 1G3SA 3V4GA 3FXRA 4E2WA 3VEPA 3FZVA 1G60A 1F5TA 2JRTA 1P4XA 2EFPA 1LVAA 1U5TC 1QNTA 3BWGA 3VFZA 2RV8A 3CLOA 2ZZKA 4X1OA 5HLIA 4DMGA 4E30A 3F8FA 2PVCA 2VBWA 3DFGA 3P2KA 5E8JA 5LR6A 3L00A 4ZZLA 3V8LA 1P91A 5DSTA 2XV4S 2RN7A 5DDGA 3FPJA 3V7RA 2P7HA 1RI2A 3MZYA 2UYQA 2C7OA 5DTMA 3IKVA 3ANXA 4KNYA 2GH1A 3A27A 5LBQA 2QQAA 2K4BA 2BBYA 4BAYA 3GNLA 2P35A 5E9QA 4KUMA 3OE4A 3LA2A 3V7CA 4CKCA 1YQAA 2OAZA 4ZYGA 2WWYA 2O0LA 3BKWA 3KHKA 3ULQB 3IEIA 5FLXZ 4DCMA 5DV5A 2NRAC 4M9SA 1QZYA 1N7JA 2PT9A 3WSTA 1INLA 1NW3A 1JE8A 1FPQA 4QDJA 1PRYA 3R6TA 2NXEA 2GXBA 5JFRA 2W85A 3FX3A 1HXDA 1JTEA 4PYMA 3LAPA 5J8CA 4AIHA 2OZ6A 1R5HA 1XCJA 3E7PA 3LL7A 3OV8A 5EG5A 3GU3A 3EVFA 1SUSA 1FYMA 4JXJA 2AZTA 5CD1A 5LQUA 3BGIA 5DM4A 5H02A 2FK7A 2R7FA 4A6EA 1WXXA 2OBFA 2ZO4A 4JK1X 3M33A 2VT3A 1P39A 3DXJF 2PY6A 2X0LA 4KIGA 3EMDA 4P7JA 4AX8A 2VBZA 3R3HA 1IN6A 2M5WA 1O3SA 5DTQA 3GF2A 4M74A 2V6CA 1QAOA 1N2XA 4RTOA 1XTPA 3V8VA 1XSXA 4Q5SF 5AIQA 2A6EF 5FULA 4FT2A 3HYIA 3J80Z 2Y0MA 3R4KA 3M8FA 5K8VA 5DRTA 3UJAA 3CO7C 3ELWA 4RAZA 4ZYEA 2ONZA 4EJUA 1IRGA 5H20A 3TO9A 3GRZA 1SD7A 4AUKA 1SD4A 4Y13A 5GOZA 1R7JA 2FA5A 2OZVA 3JTGA 4NECA 3CUOA 3ME5A 3E5UA 2HV9A 2DFIA 1NBHA 2YUIA 3KP3A 2A68F 4LG1A 2VONA 4UVAA 4CWAA 5E2BA 3JW4A 1JHFA 3T5XA 4HC4A 2OY0A 1ZYRF 2G72A 4YUZA 1JXSA 4P9UA 5T64A 2HYGD 3WTZA 5AONA 3C3WA 3DULA 4IWNA 1V4RA 3ER9A 2FYTA 3E5XA 3CUQA 4EJVA 2LD4A 4YV0A 4U7PB 4EV0A 2K02A 2FBIA 1YF3A 4MNUA 4R8SA 2QYOA 3TMAA 2OZUA 5E17F 2XRNA 2YX7A 3FUVA 2W24A 5KQSA 2K86A 1A04A 1YIOA 4RWZA 4MGRA 2A5YB 2Z3YA 3EMBA 1U3EM 2P5VA 5FB2A 5DRYA 2IA1A 1NE2A 1FBSA 2BR5A 5E1XA 1HW2A 3KP5A 2XYRA 4A6DA 5ILSA 4RVFA 2WV0A 5E1WA 4A12A 4N0BA 3C7JA 1IY9A 2PV0A 3DPLC 3PX3A 2PX5A 5LSAA 3AY0A 3G2OA 2UYCA 4KDCA 1O3RA 1JQ3A 2PX8A 4QPNA 3WU0A 2H09A 4LFUA 3DXYA 3HP7A 4PYQA 3EEOA 2VE8A 4V0QA 3SFZA 3GGDA 1G4DA 2IDKA 2M87A 4DA4A 2ESHA 3E8SA 2QQ9A 4LK1F 2AOXA 1VPTA 1QO0D 4ER6A 4F84A 2FNAA 1O3TA 1ZRDA 2H1RA 4HZFA 2EFWA 2A69F 4C06A 4EVIA 2JJQA 4JQFA 3EVZA 1XMKA 2L01A 2W57A 2P3LA 5EKXA 3GZ5A 4I98B 5IT9K 5BW5A 2CGPA 1STZA 3LAJA 2M8EA 4R8HA 4G7ZF 2ZVJA 1W5SA 2HOEA 1KR5A 1HNNA 1T2KA 4MHGA 4YFNF 2JT1A 2FCAA 4O6JA 4PGGA 4GXOA 3MFKA 4MEYF 5F1RA 2JPCA 2DW4A 3WTVC 1Q0TA 3SM3A 5LQNA 3K0BA 3SSMA 3UJ6A 3KCCA 3DXZA 2E1CA 2MD5A 3GRVA 1UWVA 3RYRA 3MZHA 2OA4A 3TDUC 3TPZA 5D4SA 5DLYA 1ZAOA 1J5YA 5ERIA 5E9WA 2HR3A 1MJ9A 4E32A 4IHTA 1NW6A 2RDPA 1EAMA 3Q7EA 1YFHA 4MQ9F 3WTXC 1NV8A 2LDUA 2JHCA 4CXFA 1SFXA 1RZ4A 3FTFA 2ESNA 1KPGA 5K0CA 4LG0B 1MGTA 3SXYA 3O2PE 2RVCA 4EMSA 2GWRA 2EK5A 1JG2A 3BZ6A 2FK8A 2LNBA 1TQIA 2MBFA 2H00A 1DUXC 3FUTA 4FHTA 3DP7A 1P4AA 3SXJA 2Q41A 3BJOA 2CL5A 2EWNA 2A07F 1RJEA 3HVKA 2F5EA 3RJPA 3C1DA 2BM8A 3FPGA 3G2QA 5D1NA 5EMLA 2IIPA 3NQOA 1BOAA 3GRRA 1HBXG 5F2NA 2IH2A 5D5WB 1DDNA 1R8YA 5DWQA 3HRUA 4C04A 3HA3A 2EFQA 1BOOA 2VDWA 4ER3A 3KPYA 3K1MA 3UA4A 2V1UA 1FBUA 4MQ4A 3NVKI 1AF7A 3GDHA 1SG9A 1BKYA 5JUWA 1HKQA 2HQNA 3IL2A 3FMSA 3KEOA 2V7EA 5C0OE 1BN5A 4A2UA 4LK0F 1TNTA 1KU9A 3GCZA 4Q47A 2HWVA 3AAFA 1MJFA 3H3ZA 3A26A 1J59A 3UJ9A 2H6BA 4I01A 4ER5A 3R6SA 3GUDA 4FS8A 2Q8KA 5DM0A 3A7DA 5FA5A 1U2ZA 2GAUA 3HSRA 5EZQA 4GYGA 5DD8A 3MQ2A 3LCUA 2CKDA 3IV6A 2XUBA 1UCRA 4B17A 2A6HF 4P55A 3G2MA 1O7FA 2JH8A 3KZYA 3P9CA 4FGZA 3L2CA 1BI1A 5EKUA 3X0DA 3HIFA 4AZTA 4ZZDA 4RTSA 4QLCU 1BI3A 3E6CC 3MQ0A 4YFXF 5ICCA 4G6QA 5FUBA 2E1NA 3ZPLA 1WQ2A 4I0BA 3DQVC 2Z9OA 3B89A 5HS8A 1GHCA 4TV7A 3AXSA 3F23A 1HW5A 3TM5A 3GO5A 1NT2A 1YO5C 2HFHA 5EMKA 2I6GA 4RS8A 5K5OA 3TQNA 2ZWVA 3B7PA 4FZVA 1O9HA 4BH9A 4UXNA 2YU3A 5DM2A 4GYIA 3AWIA 3BGDA 4QTUB 4EM2A 1B9NA 1MDMB 1NV9A 3ABUA 3BROA 4HF1A 3HVIA 4E2ZA 3I4PA 2XHKA 1X1AA 2BZGA 4RTLA 3SHFA 2PKWA 1I9GA 1R18A 5FFXA 5E1MA 2PMUA 3GFJA 4WF2A 3MGGA 3QOPA 4KFCA 5FO5A 3IHUA 2OYRA 1XGMA 1JG3A 4HV6A 2IPXA 3H92A 3MCTA 2W84A 4L9NA 1HQCA 2BM9A 5DUIA 2NAZA 2CMHA 1L3LA 3EVGA 2AN3A 5K05A 3SSOA 3SVZA 1JG4A 2OBPA 4POOA 1R1UA 1FX7A 3M7GA 1DL5A 5HIJA 3A25A 4I7HA 2QENA 2ERCA 2CWWA 4AWXB 2PJPA 3BKXA 5E1BA 1YTYA 3ZN0A 2PX2A 3GIWA 3KPVA 4M38A 2QVOA 3FF5A 1FNNA 4WX9A 3I0TA 3FTDA 2OPBA 2A14A 2AN4A 2VBXA 3M6VA 2ZFWA 5FWAA 1RIOH 5BQTA 3VOEA 1ZG1A 1R6AA 4KMFA 2G7HA 4Y2HA 3G2PA 1ZKDA 3T7SA 2ADUA 2AOUA 5IH3A 3I9FA 4FT4A 3CO6C 3LECA 4H0NA 2P7VB 1JHHA 1FP1D 3OE5A 3I64A 4DZRA 4BHPA 4L7VA 2WC2A 1IRFA 1OPCA 2YTZA 3FUWA 1JSXA 2DK5A 3PQKA 2P5LC 3KQTA 3PFGA 3E6MA 3LA7A 5E8IA 1L3BA 3LBFA 2VC0A 1I27A 5DCMB 1NKVA 3T7RA 2XAFA 4PIPA 4BLVA 3DLIA 4IPAA 1TQMA 2ZMEA 5FD6A 1XXLA 4IJAA 2DAOA 3CUQC 4HG2A 3BZBA 2PXAA 4RX1A 3OFJA 2F5FA 2BV6A 2P5KA 2YSRA 2HMYB 1T98A 7MHTA 1OKRA 1W7PB 4U7TB 2E7WA 1E2XA 5CYVA 3KQQA 2Y48A 4UOEA 3T0YA 2IBSA 1YUBA 3CKKA 3JAMK 4OQDA 3TM4A 2EJRA 4KWCA 3PQJA 3TOSA 5EIWA 2QE6A 3F6OA 2C7QA 1DP7P 4Y17A 1JGSA 4EK9A 3ZN1A 1X1BA 3EVEA 4M9ZA 2ZNZA 1BC7C 3P9KA 2IPQX 3KQPA 1QANA 1P2FA 4XCXA 1YW9A 3V8KA 1WS6A 3I54A 1S3JA 4ER7A 5LRRA 1LJ9A 5CCXA 1XCBA 4FP9A 2FU4A 2HGCA 1I5ZA 1O7LA 2CFXA 1FSEA 2GB4A 3W6JB 2V74B 2AOVA 2HZTA 3GW2A 2QLZA 2R7DA 4EJWA 5ILVA 4PNEA 1WI9A 5IKMA 3KKZA 4GC5A 3MAGA 4YMGA 2C7RA 3BOQA 3U9GA 1IXKA 2VC1A 2BR4A 4CKEA 3CJNA 3U2RA 1WSUA 1ZRCA 2G7UA 1REPC 3RI4A 1H9TA 3WTYC 3QPTA 4LGWA 2FOKA 1QYRA 2O3FA 1H0MA 1WWXA 4HOBA 4HGYA 4GCVA 2E5WA 2B0LA 3B5IA 4PYKA 4HLYA 4UHTA 3F8CA 5F2OA 2IP2A 4F86A 3EPPA 2GQQA 5CVDA 5E1DA 4MHTA 1RJFA 2JZYA 3HCEA 1J0RA 3KPJA 4C4AA 2B9EA 1NBIA 5EVJA 2FMYA 4PCLA 5K0GA 4AD9A 2XVAA 2IRFG 2RKHA 1IF1A 4ER0A 1DCTA 2ZIFA 4OBXA 3FWEA 4G94A 1QAMA 5K0EA 3UJBA 3SR4A 1QGPA 2EJUA 3SMQA 4HH4A 3BP8A 5FFZA 1Z7UA 5DCMA 1CGPA 4GQBA 4DM3A 1TW3A 1FYLA 3PX2A 4FX0A 4R8RA 2OB2A 2CYYA 2OQRA 2HTJA 3V8JA 1T6SA 1BC5A 4S05A 3GRUA 4OA8A 3WODF 2H11A 2L3DA 1KYWA 2Y1XA 4QQKA 2F5DA 5L3CA 2K4MA 4BYYA 2UXNA 4S04A 1FBQA 5DYMA 4R1HA 2DO7A 1QQIA 3LA3A 1S8NA 2ZBQA 2XGXA 1RJDA 3MEXA 4IF4A 3RTRA 3HRMA 2Q0OA 2NS0A 3OCJA 3E6DA 2VDUE 4GOOD 2OO3A 3J80K 4RGXA 2BYVE 2DPDA 4Q48A 4GF5A 3ZMUA 3UZUA 1HSTA 3KU1A 3HTSB 3IWFA 4L18B 2A61A 3V7SA 3GX4X 2I7CA 3G8AA 4QTTB 2XBMA 2K4JA 2PX4A 1R1TA 3A4TA 4HAMA 5IT3A 2H94A 1K6OA 1D2HA 3EEYA 4PYLA 4OIRF 1FP2A 3HM2A 5EZSA 3BWCA 5GM1A 2VBYA 3ABTA 4CHUA 1ZREA 2R6ZA 1EH6A 3HVHA 2ZTHA 3CUQB 4QDKA 5D6FA 2C6YA 3EVCA 1USSA 3HSEA 1VTNC 1SD5A 3F22A 4DF3A 4R6WA 3NMUF 2Q2EA 3GRYA 5CVRA 4ETSA 1FOKA 4IRGA 1KHHA 5K0JA 4L9TA 2AVNA 1Z91A 4BQAA 1I1GA 2PQ8A 3DLCA 5CVVA 5M5BA 2HKXA 1P4WA 1T0FA 4XRFA 4L5IA 1RUOA 3LQRA 3E6BA 3FRIA 3G73A 3KZZA 1G8SA 3U1DA 1SKMA 2PWYA 2O07A 3KP4A 4UV9A 2C7PA 4P7GA 2RGVA 3RIRA 3ZMTA 4XUDA 2GS9A 4UNOA 3HCDA 3ZMZA 3SSNA 5HIKA 2RC4A 2IA2A 3RDIA 4M71A 3NVMB 2GPYA 1F9NA 4QVKA 1G6Q1 3EGVA 2L54A 5G02A 3FM3A 1AWCA 4B09A 4YV1A 5DX0A 1S7OA 3HTUA 3EGIA 1XSVA 1U8RA 4QVGA 2FMLA 2GXGA 3HRTA 2P7CB 2O8XA 1XGNA 4ESFA 5K5RA 3HEMA 5DM1A 1X1DA 4YUXA 1ZQ9A 6PAXA 2ZIGA 3Q87B 2W25A 4XLPF 2G1PA 1K7AA 3NW9A 2DBBA 3LBYA 2P4WA 1ODDA 4MTDA 4G56A 4A0YA 1HMYA 2PFBA 2QUFA 3KP6A 5DTRA 5L3EA 4EQQA 5HEKA 5LRSA 2G70A 3VODA 9MHTA 5BPDA 2XAHA 4ESBA 1Z6TA 1YFLA 4G8XA 2Z5UA 8MHTA 1SMTA 4EM0B 4Z2YA 2AVDA 1VLMA 3OU7A 3CJTA 1Z1DA 1L3CA 2FF4A 5EMJA 4ENMA 2YX4A 4KIFA 2GA9A 3K1PA 4A0ZA 4AVPA 2UZ4A 3OU6A 3O7WA 4ATNA 3Q9VA 3AXTA 2ORED 2ZULA 1UIRA 2Z6AA 4HDUA 5F6FA 2IT0A 3PT9A 5BW4A 2XVCA 2XVMA 4N9IA 1JR4A 4CZZA 5FHQA 3P9NA 3SX0A 4U7BA 1H1DA 5HDKA 5LHHA 3FYDA 5K0LA 4XSZF 5B1SA 3G5TA 3F8NA 2HNKA 2P6TA 5DX8A 4XUEA 3P7NA 2UZKA 1KA8A 5IT9Z 2QBYB 4RGSA 2AOTA 3TRKA 5HS9A 1J2XA 1XSDA 4RV9A 3VC2A 3C3PA 3DPTA 4E31A 3P2EA 3F21A 1OMIA 2PI0A 4HLXA 2AR0A 4BNCA 3BWBA 5D5XB 5FQOA 2NP7A 3LQQA 1M6YA 4OU0A 3KQSA 1AOYA 1EJ0A 3QU3A 3FM5A 5A2QZ 2M30A 2KJCA 2G71A 1LDJA 1KIAA 4GOLD 4HTFB 1J7KA 3G5LA 3GFMA 3DEUA 5HOOA 4M6YA 1XN7A 3C6KA 1ORIA 5T6BA 3DOUA 2ELHA 3D5LA 2P7IA 2PBIA 2J5PA 4Y30A 2EX4A 1OYWA 5D4RA 2NNNA 4YMHA 3LDFA 4G7OF 4PCQA 3ZMVA 3REOA 3WTTC 5FTWA 4PZJA 2KIFA 2KKOA 1BIBA 1KYZA 1O9GA 3T7TA 2ZW9A 5FHRA 1T39A 1KQ0A 1TW2A 2OB1A 1TLHB 3EQLF 3FMQA 3TQSA 1I6XA 3ORHA 2M45A 2WK1A 4CGZA 3CC8A 5AIPA 5JR3A 5ILUA 4BXUA 2CQKA 4LWOA 1F3LA 2QQBA 1IN8A 3M6UA 3DTNA 5L3BA 3NTVA 3FUUA 3IC7A 5EOVA 1FY7A 4BHCA 3B3GA 2JHAA 2D1HA 2KRFA 4HV5A 4MQVA 4NB5A 2L02A 2PWPA 2YXDA 3P2IA 4PYNA 2CWEA 3D2LA 3ELUA 3M8EA 3FXQA 5E8GA 4EQZA 4P58A 5CJ9A 2PEXA 3WGIA 3E05A 3WTWC 5DXJA 1JG1A 3JWJA 1IZ1A 3KR0A 1USTA 4E33A 4YIIA 4CICA 1ZGAA 4B8XA 3HRSA 2AS5F 2STTA 2ZFUA 4PYOA 2DPMA 1IN7A 5D6EA 1ZH5A 1KQ9A 2CMGA 2OU2A 3RKXA 5KVRA 4CDGA 3DMGA 2VZ9A 3MB5A 3FXUA 1DUSA 1VQ1A 2FE3A 1IUYA 3OPNA 1EH8A 2V9VA 3KQYA 3WU1B 3OOPA 2Z99A 1GVJA 4XBFA 4PGHA 1EG2A 1I4WA 3M6XA 3G7UA 4CKBA 2ZCWA 4IRIA 3G89A 3KQMA 4RVGA 3BPVA 1JTFA 1SFUA 2BR3A 3K0LA 3LPMA 2QBYA 3LGAA 3GFLA 3L7WA 5D5UB 3FZGA 3KPWA 2IGTA 2XIGA 3SZTA 1WG8A 3FMRA 4WXCA 4ESJA 2Y1WA 4QWQA 2MC3A 2BH2A 5L3FA 2H6CA 3F8BA 3HA7A 2H27A 5GWXA 2ZWAA 3VB2A 1JQEA 4GBED 4RTJA 1YFJA 1B59A 4HTFA 3QP6A 5BOXA 4MEXF 3HCFA 4M37A 1XDUA 3Q5FA 4M6XA 2ZXJA 2O05A 1MHTA 3PTAA 3H3UA 1D8JA 1R74A 3KQVA 1KU2A 2FEZA 5BP7A 2P3OA 3KR1A 2D2WA 4FSDA 1MJAA 2JHPA 3ERED 5FGMA 2X4HA 2VOOA 1L0OC 1BI0A 4A0XA 3E23A 4XUCA 2BGCA 3K9TA 3COAC 2P1DA 1IAWA 4UV8A 3QPHA 3QOXA 3ELKA 2VE9A 1XDZA 2QRVB 1RNLA 4MTLA 2QZ8A 2WTEA 1P6RA 2NYXA 2ZZMA 2YXEA 1U6GA 2XROA 3J81K 1FZPB 3IRRA 5ERGB 1LQ1A 2O61A 3R0AA 4YFKF 3NWEA 2O6GE 4ENKA 2AOUB 3P9IA 3DXXA 3OZRA 2YPRA 1LDDA 3MAJA 1N7IA 4AIKA 4PWYA 3I53A 4NHJA 4O29A 1FT9A 3HUGA 4M36A 3MCZA 1WZNA 3O6BB 1AQJA 4KT5C 5F64A 5HDNA 3R61A 4OQEA 4RVDA 3F3XA 2DT5A 3BDDA 4RTPA 1Y0UA 1TTYA 1KXZA 2IFTA 3KETA 3OZTA 1FWZA 3P8ZA 1ZHFA 3TOAA 4C03A 1KU3A 1FSHA 5TJJA 3SQNA 5E2AA 2K7LA 5LQRA 1SQGA 4ZYHA 2L4MA 2QWWA 2O57A 2J5OA 3FRHA 3LHDA 5DX1A 3BY6A 2PMHA 3M70A 5HS7A 2VT2A 2F8LA 1SD6A 4C07A 1ZG5A 2ISZA 3LCCA 2JH9A 2AXLA 1D2CA 2KW5A 4HF2A 4KICA 1R22A 1DPUA 2PBFA 3TGNA 1IXRC 2YVLA 3W6KB 3ZP5A 3M6WA 4KW7A 4FX4A 1UHWA 3WTUC 2GA1A 3LFKA 4IVNA 2DULA 1RUNA 2FBHA 3I59A 1AV6A 2FSWA 4LWPA 3ERCA 1ZG3A 2RQPA 3NEUA 1YW8A 4Y15A 2DTRA 5LGNA 4G7HF 3TO7A 3HA5A 5FQNA 1R00A 4OIOF 2E7XA 1IN4A 2PLYA 5FWDA 3RODA 4PDKA 4HX4A 3L8DA 2MH9A 5LEJA 4EJTA 1KU7A 5TRDA 4LMYA 5GINE 1RJGA 5HDGA 4WK8F 1CF7A 4HQEA 3G88A 5A2QK 4BP1A 3WGGA 3ZMDA 4BHBA 1TPYA 5CVEA 1KP9A 2NNWB 2PLWA 3H2BA 4X41A 4ASNA 4P96A 3GLXA 4ZH4F 4GOND 1YYVA 1ZARA 1L9KA 1SAXA 4HBLA 4UUVA 2AN5A 1VE3A 3QV2A 3FHZA 4P7KA 1XDSA 4RTMA 1IXCA 1G3WA 2XAGA 4U88A 1F4KA 1RI3A 4PCAA 1ZN2A 3ECHA 2ZBRA 5E20A 1I1NA 5J6XA 1VP9A 1RI7A 1D5VA 3BPXA 2R3SA 3EVDA 4EGZA 3T0IA 1K78A 3J7AO 3TOBA 4LD5A 3QRFF 1U78A 5EIFA 5D8KB 1ZRFA 3UJCA 4F85A 3HOTA 2EFOA 3M9AA 4M9XA 4KRGA 5LLQA 3R60A 3E97A 3RPUA 1QAQA 5D8LB 1KPIA 2B2CA 1G8AA 3RKYA 3JSOA 4UVCA 3CGGA 4IKPA 5E1OA 5CVIA 2IH5A 1FYKA 1BI2A 4LECA 5EPEA 2EV6A 5KK1A 4MWZA 2HYFA 3BJ6A 3GYHX 4L0YB 3OFKA 2B25A 1FLIA 2XYVA 1XCLA 2KIUA 3C6MA 3QOWA 1KGSA 2ZKZA 2B78A 4C08A 2L4AA 1JSZA 2EFJA 2LF8A 1WRJA 2ADMA 2IVMA 2PJDA 1P92A 4L5JA 1PP8F 3A7EA 3R24A 2LF7A 2IW5A 2IBTA 1FBNA 4OA5A 2CO5A 4LB5A 4DQ0A 1L3IA 2P8TA 1HW1A 1V3FA 1PP7U 4E2YA 1ON1A 4U0YA 2PG4A 4KDRA 4N9HA 1MD0A 3KP2A 3HSFA 3E5QA 2VP3A 4P9FA 3JWGA 4U0WA 5L3GA 1NW5A 4F7ZA 2P3QA 4DKJA 1IM8A 2AS0A 2JSCA 4HRAA 3O4FA 4OX9Y 4BP3A 3EGEA 2QY6A 2YQZA 4OIPF 3UBTA 4R05A 5E8RA 2WA1A 3V97A 3DH0A 4HX7A 5H6RA 3OU2A 1H9GA 1ONVA 3R0QA 2Y75A 4EKGA 3NRVA 1XGSA 2VOPA 2DQRA 3HNRA 4K2EA 3CVOA 2YR0A 3QAHA 3PS9A 4AZSA 5CVJA 5EHGA 4KYWA 3MTIA 1NW8A 2COMA 5HIIA 3WE3A 3RYPA 1SFEA 1U5TB 1GXQA 2PN6A 2FHPA 3AJDA 3JWHA 3KR9A 2DLLA 5JVTA 5HVQC 2NXCA 4OBWA 1B6AA 2JTVA 3BXOA 3I5UA 2Z33A 3LCVB 1XGOA 2F5CA 3G3ZA 1SUIA 3HCAA 1V39A 4I02A 3S2WA 3KP7A 2O06A 3C18A 1HKSA 5EEGA 4DNCA 1Z6RA 2OXTA 2KIMA 4CTJA 3JAMZ 1G3TA 3RW9A 5FLXK 1SQFA 2OD5A 4RTQA 1VIDA 3F8MA 2Z6QA 1ZLJA 3K6RA 3E3VA 2BEOA 2ETHA 1Z9CA 4PYIA 5CCBA 2VODA 2NXNA 1UB9A 3KFWX 1O3QA 3B3FA 1EIZA 2IDJA 3NDJA 2G8NA 2P40A 3ELDA 2HWKA 2MLKA 1L1EA 4R79A 4RB3C 4EM1A 1XB4A 4WXHA 4RGRA 1F1ZA 2YX1A 4G6DA 2K27A 2I62A 3KQWA 1D3YA 5ED4A 4RSRA 1VL5A 2P41A 5K0NA 3THSA 4OMYA 2XKOA 4YUVA 2YR2A 1D2GA 2PSSA 5HILA 4RYLA 1QZZA 2MA3A 4KN4X 5HLHA 4WWCA 4D0PA 1EQAA 4LLLA 3MWMA 4XLNF 1FJXA 3GXOA 3JSPA 3NJRA 5EMMA 4DCGA 3RKWA 3WG9A 2D1VA 4QPPA 3K1NA 5GP1A 2DI3A 2YXLA 3CTAA 1E17A 1ULYA 5DD4A 1LNWA 5BPIA 1R58A 3UJ8A 3ID6C 4PINA 1T43A 4FSXA 1AQIA 1R5GA 1LEBA 5CVUA 1WY7A 4KA4A 4M7RA 2FQ3A 4CYDA 3FPFA 3ELYA 4LJZF 4CXMA 1RI4A 2JG3A 4E2XA 3KR2A 1SMYF 5LQAA 4GO1A 1IXSB 5JI6A 1EH7A 4WCGA 3BUSA 1U5TA 4JBAA 4BY9E 1B4AA 2PT6A 4GOMD 4HSGA 5LQKA 3TR6A 3TO6A 4DQ2A 3GFIA 3UJDA 5D1HA 5C9ZA 1G38A 3KPUA 2VXZA 2EV0A 4ON0A 5L3DA 2OKCA 2CG4A 5D5VB 1B9MA 1Z05A 4RAYA 3WGHA 2HDCA 2AOTB 1XMAA 5DEQA 4A5MA 2NYUA 4BLUA 3VSEA 3UJ7A 1IN5A 1XJ5A 5LHIA 2Z6UA 2UXXA 4ENJA 1XCVA 2G9WA 1BIAA 3BWYA 3CDHA 1T38A 4QQNA 4AZWA 3IWZA 4I0AA 2FBKA 2P8JA 3EETA 5J8FA 1HKTA 2PXXA 4L9JA 3DMFA 4HW0A 1WKMA 2VN2A 2ZIEA 4M73A 2NP6A 2IH4A 5GIOE 3ER8A 5GM2A 3B73A 4WVLA 3VC1A 2DK8A 2XAQA 4I2OA 2B3TA 3DKWA 3I58A 1BBYA 4M72A 3GVAA 3EVBA 2ZBKA 5C1IA 5K03A 1P1CA 2GLUA 3T1BA 1OR8A 3PFIA 3HTXA 2HS5A 2XASA 3KEQA 5LEKA 5K01A 5E18F 4HGZA 5E1ZB 5EQJB 3WE2A 2HKOA 4KN7X 1BC8C 2GIVA 1UFMA 1JQDA 2EA2A 5BXYA 1YZHA 3RPQA 3TFWA 4IRHA 4KDPA 4U7DA 5ICGA 3SZPA 2N47A 4KMUX 3J81Z 5ICEA 1P1BA 2ZLBA 4E70A 3ISPA 3LWFA 3D0SA 5HLGA 1YS6A 4X61A 3GO4A 4PIMA 1D8KA 5H6QA 1UFKA 4U0VA 1NHAA 2LKPA 4LG0A 5K0FA 4R6XA 1LEAA 1OR7A 5KS2A 1TQPA 2UWMA 3GEZA 4NQWA 5BS6A 5U4XA 3FTEA 1OYYA 3EUHA 4G9YA 2BE5F 1EV7A 3EDPA 4UVBA 1YB2A 3B02A 4EGYA 2NNYA 1B1BA 2RNJA 1QBJA 3EYIA 4KVZA 4MIKA 2V79A 4ZYDA 1VP3A 3PVCA 2FPOA 3DUWA 2MLGA 4C05A 2HR1A 5JHUA 2CSOA 1M6EX 5KQRA 5HOQA 3LSTA 2HTSA 5KVAA 4CTKA 2EJTA 3EVAA 1TNSA 3U81A
chains in the Genus database with same CATH superfamily
1E92A 4RCZA 1AGPA 1LVKA 3DDSA 3NTXA 4N65A 5ARDA 4BV3A 3ONNA 1MX3A 4CR8A 5CLSA 5FD5A 3K2BA 3DEAA 4O3MA 5JI3E 1YHNA 4UZFA 3IUYA 3SOPA 4BP9A 2PPVA 5AICA 3GD5A 2VSXA 3DJYA 3ZD6A 2OQ2A 5CGQB 5F3WB 2WFLB 4BJ3A 4JHLA 1LX6A 2OHOA 5EHIA 4ITVA 2HOAA 3O95A 1PJZA 3NQ41 4RPGA 3FKIJ 2FSUA 3VO8A 3ZHZA 5HK9A 4FOOA 4UUTA 1YZVA 3F7TA 4GQAA 4XM1A 5CB6A 4D43A 1K68A 1B14A 1L4BA 1HNWB 1TAGA 5IYZA 2E21A 3DS8A 4QOSA 2EV5A 4AM3A 1G19A 3SEQA 3EXHB 2J85A 3VZCA 1Q1VA 1QRTA 2HHAA 3OL3A 1W4CA 1VF9A 3UPTA 1TNDA 1E4OA 5KOYA 1JYFA 4GI1A 4NOLA 1A5ZA 5LJIA 4DZJA 3D8BA 5HE9A 3F4KA 2OTJI 3RRBA 1SU4A 1H8HA 4HEA6 4ZTBA 2QL9A 1B1AA 2XQKA 4HDSB 3LUJA 3ZGXA 2ECPA 3O8OB 1W93A 5LU9A 2EGUA 3F90A 5ALZA 3HXPA 3WVNA 2DCUA 3WRXA 1KMQA 1ACLA 1HG1A 2PV7A 2ZI6A 4EJOA 3BWMA 3N39C 4QOHA 1VJ0A 3UJ3X 3FBIB 1AVTA 1WLYA 5J4LA 3DBLB 4YUYA 3INTA 3IHTA 2W1OA 1NZJA 2IYLD 1GPKA 1A9TA 3C7TA 3NM5A 3EXFA 3F72A 5T4EA 1W4MA 4F6CA 2EX1A 4O4IF 4XLCA 1GR0A 4ECAA 1RWNA 1G4HA 4K9OA 4F06A 3GTJJ 4BNTA 1GV0A 3MC1A 1DXHA 1DEHA 4OU5A 5IHXA 3K9BA 3LPLA 5HJEA 1W581 2IW3A 4FDLA 2BD0A 3MTEA 4IDDA 4JA0A 5HNFA 4YRTA 4XWWA 2AZXA 3KEYA 1CERA 2LP0A 3IKTA 1PFVA 2HF7A 4JI1B 2ZZNA 2BHZA 5IAGA 1G7TA 3BDAA 2NUAB 2JEYA 5JSQA 1ISRA 3LKZA 2PU7A 1ULSA 5DIZA 3VVCA 2G5TA 4E7ZA 4F2GA 2YWCA 3TB6A 3L7DA 2AW5A 4J2TA 4RA6B 3CPHA 3VI3B 4WXDA 5ALLA 2H4WA 4FYVA 1U5CA 2PGXA 5L7TA 2XXJA 1TM4E 3F6EX 3KYDA 4AF7A 1KVTA 4LK3A 4OY3A 5EUBA 2ZYSA 1U2WA 4XLTA 5EXEA 4JI2B 1J0AA 4O0MA 1MF7A 5FLXA 2ZSUA 4DLTA 2L7ZA 3THOA 4XLAA 4L8YA 3A4NA 3D7SA 4EFLA 2ACJA 2D0PB 2QMQA 3FB1A 5EJ9A 4EY8A 4UAUA 3GF4A 1E2EA 4OX9B 2WA2A 3UA3A 1Z8DA 3CX8A 1MMSA 1R1VA 1FSSA 1RI1A 5DUKA 3IRQA 2RI1A 3OURA 3QKUA 1JV2B 1JUMA 3BIWA 4HBGA 4Q02A 3SZ3A 3KQLA 3DM9B 3PFHA 3WTSC 2H8KA 2O2DA 1FFWA 4W9NC 5DCFA 3R3WA 3ZGYA 5LDHA 4EAQA 4B34A 3A4YA 3UCFA 4AJ1A 3VNVA 2EW8A 3DAOA 3RIGA 1ENPA 4JEIA 2AJDA 4YV2A 4DEYA 1HQKA 3DO6A 5KQGA 1TAQA 1VG1A 1O8CA 4O5VA 3UQYS 3KQNA 4JIMA 5I7EA 3W2EA 2ZJ2A 5JD5A 4Z53A 3W6ZA 2W2NA 2TDXA 1XTIA 1YX3A 3IMGA 3JAKB 1OYOA 1P1FA 3KLOA 1U1EA 1Z29A 2B94A 2P9EA 1QE3A 1V8PA 1PR9A 4RB1A 2INGX 3MUNA 3QFTA 4LXHA 3EEBA 2STWA 4MIYA 3ZDCA 2DPUA 2OHXA 4AX4A 4D02A 4DJDC 1EI9A 3NR2A 1ZA2A 2WKSA 2BJVA 3H7AA 2CDCA 3TZEA 4F21A 4BQNA 4ZANA 2TMKA 1SXQA 4I50A 2R84A 1GDHA 5EEHA 1KL7A 5FKLA 4L22A 1L4HA 4YRFA 4EHNA 2FRXA 4PX2A 3OMXA 1BM9A 1O57A 3CCFA 3P0FA 1Z25A 1YW7A 2QQGA 3C3YA 1MB0A 3QVJA 2O8EB 3I12A 3R0JA 3PC4A 3S17J 3R3VA 4M3FA 3KTAA 3AEUA 5KJ1A 2R7ZJ 2QQ8A 3A2KA 1Q74A 1JFLA 4N18A 1HSJA 4BLSA 3T3GA 1EJ6A 3JRBA 5K8CA 4XRSA 4Z3OA 3AVXA 1MX5A 5EZYF 1ZIXA 4R8LA 4B3DA 3S44A 2PXCA 3R9XB 1GSAA 2B92A 1M9NA 4A1OA 3GLQA 4BMOB 1OLSA 3AR6A 4IF6A 3RUDA 1PWXA 2QQEA 5EGSA 4WIAA 4CEIB 1BU8A 5BNFA 4PLGA 3RHZA 2VDVE 5C4MA 4CKCB 1PF7E 3L40A 4PEVA 2CVQA 2W4IA 4OAQA 4WZBE 1ZTRA 1FSFA 3MLBA 5KTMA 2ZUDA 3RWOA 3B2NA 1JAYA 1E5DA 4Y3UA 3ROUA 3W0LB 5E4FA 4PXYA 4XSXF 5F52A 2CCGA 1Z2OX 2V7PA 2L18A 1JKJB 3CZPA 5FPSA 2HXOA 4MYSA 5I47A 3NU1A 3GZ6A 3ADKA 1ACMA 4BEHA 1ZNYA 3VSKA 1EP2B 1K86A 3NJ4A 5DH9A 3ZHRA 4C20A 3DTKA 1OX6A 1KFKB 2JGJA 2Q27A 3DD1A 4YIFA 3BIOA 4KSBA 3NRJA 2KJBA 4P2GA 1QHEA 5BNGA 4DSZA 4ZHQF 4QU0A 5F2KA 2ATEA 4Z0TA 1NA5A 4TLEA 2H06A 1GTSA 1WZUA 1EGVB 3S8EA 2Y9ZA 1YE3A 1TAHA 3HYSA 1C0WA 4EY5A 2I22A 5ALOA 2XZLA 3ML6A 1V96A 1VBFA 2FSVA 1GV2A 2BPOA 5GGXA 1IEVA 2C3MA 2J5BA 2WJ6A 1UEIA 2VQ3A 4L9VA 3CF0A 3LT1A 3OZSA 4ZA2A 5A71A 4EG6A 2YJ4A 5AM5A 3A36A 1KC3A 1LWNA 4IXAA 1RYNA 5ALUA 3ZUGA 4HDQB 4MA0A 5AJYA 2VJAA 5I7FA 4IGEA 4HNGA 2RMKA 4XD2A 1NVAA 2N3ZA 4GC9A 5HF9A 3VYWA 4DA6A 1GNSA 1G41A 4B40A 5BR7A 1U98A 1XD2B 2HSZA 4RB0A 1FX0A 3BMCA 3OYMA 2A6PA 5LQSA 2QS9A 1KMHB 3AY7A 4FDVA 4B1RA 3TMYA 3AUJB 1FQOA 1W7PA 2P6SA 1FSZA 5TQ0A 2G9UA 4UCFA 4EZEA 5CLGA 4YXWA 1JDTA 1KDOA 3PJEA 4QTZA 3C3CA 1DJPA 3A3KA 3H1GA 4RK4A 3ROQA 3LC2O 4R71A 3IAUA 5HFJA 2X2OA 3AU8A 2DFDA 3ZKWA 3KYCB 4MR7B 3WK9A 3MFQA 1XCMA 5HZMA 1MW8X 3MD2A 5L3VA 5CIQA 2BTEA 1JHUA 3EHDA 3FPEA 5ES3A 4C0KA 2AG8A 4EKNB 1RYEA 2RGAA 1H8HD 4WCVA 1MLDA 1TBXA 5CIYA 2X4DA 5T4FA 2K5CA 1J7JA 4FCYA 2F6CA 1WU7A 2QXYA 4G0ZA 2JWTA 3NHPA 4LHVA 1MW7A 4HBZA 4AXBA 2D3WA 4HY3A 5MHTA 4P0QB 1A2QA 2MYNA 3RQSA 2ZG6A 2BHRA 1WDTA 5AVXA 2BFFB 4EEFG 3CCRI 5GGYA 2FWIA 3JQ7B 4JLMA 4FU0A 1F5TA 3Q8KA 1F51E 1KK3A 1GZ6A 5IU6A 4GR4A 1KI8A 1W5CC 1V7ZA 4LXIA 5JNVA 3K2QA 4NBRA 2NU8A 1X80B 5AW2A 4FASD 1U2DC 2IL1A 4BB6A 1ML4A 1XHLA 1ZPDA 4LJ4A 2RV8A 1QHHD 4DCTA 4TV9F 4RFLA 4WESA 5M7EA 4NBSA 3E58A 2IK8A 3R76A 2BFWA 3F8FA 2FUCA 2VBWA 3HJCA 3P2KA 5AK4A 3I6YA 3RH0A 1ZBQA 2CFRA 4ACAA 5FDFA 4C7BA 3LSPA 1RZRA 1P91A 1PEDA 1RPNA 2C03A 3H84A 4XOIA 4E3WA 3V7RA 2PJRA 1Z28A 1VYUA 2DMRA 2OV2A 2X3UA 3GUHA 4AG3A 4AP6A 4URXR 3S40A 4BVEA 2C5FA 1OFUX 4D3YA 4QUEA 2EIJH 2UYQA 2YWEA 4Y0VA 3SS7X 3ZGVA 5GADl 2JCXA 4HEQA 3UXHA 4BNDB 5JDIC 4RA2A 4RGBA 1ELOA 1ISGA 1F8YA 1VI6A 2G5GX 3QU2A 2AC2A 1M8FA 5AVWA 4K6KA 4KLCA 2BTOA 4R0VA 2FPMA 3A27A 4KQ2A 4RK7A 2LK2A 5LBQA 2JIMA 3V48A 1XLTC 2H1VA 2IY8A 5A62A 4K0KB 3JS5A 4YCLA 3QPVA 3NDBB 2AL7A 2VPZA 3JQAD 3GNLA 3UWPA 2JGIA 3D7KA 3I30X 2FWRA 2VF5X 4WK0B 3DBRB 3CWQA 1YQAA 1GSOA 1XTRA 1JAHA 2C5LA 3IUMA 2EQ5A 1VIAA 4MVCA 5LXTA 4N7MA 1UOPA 2NO6A 1XD9A 1H8EA 3BKWA 3BICA 5FKJA 1RPTA 1LE8B 3UT5A 3CUVA 5FLXZ 3JQ8B 2CV2A 3GCMA 5DV5A 4F4IA 4UW9A 2ORYA 1T2UA 1Y5IA 2P9YA 4NBVA 4PQGA 4R9NA 2C00A 2H7YA 1XU4A 1GPBA 1QSGA 1FB5A 2PT9A 5F23A 2YJGA 3DFFA 1JE8A 2MINB 1FPQA 5KAFC 3KRTA 3R41A 3R6TA 3H4TA 3TW8B 4ZC1A 4IZOA 2FMIA 3R5HA 4M54A 1D0YA 3WIDA 1DQUA 5GJVC 5J8CA 3KE9A 3L8EA 1CEQA 5AM2A 1DAPA 4RUKA 5DCYA 1VNDA 4JI4B 3TQTA 1R5HA 3JASA 3OYKA 3DZHA 2EW1A 3E9YA 2XE6A 4LVUA 3PR3A 3RC9A 1FYXA 1ZCAA 4KOEC 2IZZA 3GU3A 4OQQA 1FEZA 3EVFA 1SUSA 4JXJA 2Q0SA 2HF2A 5CXQA 3KNZA 4P4NA 4NJMA 3SYKA 4U2FA 3V7FA 2DCMA 2Q1SA 3W9BA 2OILA 2OKGA 4FILA 2R7FA 2IEZA 4DXDA 2GESA 2ZO4A 2GN6A 2E1MC 3QUQA 3VOBA 3ZE1B 5E1MA 1WO8A 3WIBA 2FR0A 4JA2A 1P39A 3DXJF 4MWDA 4PTZA 2X0LA 2LUOA 1WXGA 1N0UA 4KIGA 2IBMA 1NUPA 1FNDA 1UHSA 2V6IA 3ASVA 3EMDA 3JXEA 4MOWA 4S35A 3VU3A 1V47A 2I55A 2Q3JA 1OZFA 2BFCB 4CMJA 2WVHA 5HTKA 2P9HA 4TL7A 1IJKA 4TMYA 2X5XA 1Z2DA 4KREA 3ASYA 3HPHA 3O5AA 4ZI5A 3J80A 5KJ6A 5TT1A 1ZGZA 2JJ8A 2M5WA 3HCNA 5DTQA 4R2KA 3CZ9A 4WLVA 4MDFA 3WLRA 3RREA 4HRIA 4LZJA 3EFBA 4M74A 2VQ6A 1ENOA 1N5MA 2GPNA 4OP3A 2OYCA 3RVLA 1OC2A 1RJ9A 2V6CA 5IASA 5FO0A 1XTPA 3Q0VA 2BJHA 4B8YA 4ZT3A 2K9NA 4COOA 2AQFA 2XOXA 4P2BA 2A6EF 4MUMA 3GEMA 5JECA 1E79A 3DEJA 5JS6A 4ZJZA 1NASA 3HYIA 1Z6ZA 4R68A 2ZYRA 3WGMA 4OHUA 2JGMA 4EY7A 2M6RA 4C21A 1NJ1A 1W96A 4LOJA 3DBOB 4EJUA 1IRGA 2AH5A 1UC9A 4FCWA 1FFSA 1KI9A 2YRWA 3WQQA 3I01M 3QJ5A 4UEJA 3GRZA 1ZD4A 1GA6A 1JPUA 4Y13A 2GZRA 1ONBA 4OXIA 5GOZA 1R7JA 4KPUA 1HLPA 4LHWA 3UBMA 4BMZA 2XITA 2OZVA 4NECA 5TPZA 4KGZA 3FPCA 5EXPA 5C7LO 2HV9A 3RABA 2QRZA 4OVKA 2DFIA 2MU1A 1Y89A 1T8UA 2Q3BA 2YUIA 1HUQA 2F4IA 3OM0A 4V0KA 1DX9A 4LG1A 2P9GA 3NAMA 5EE1A 3CURA 2DY0A 4KZKA 3RFCA 3USCS 1GQSA 5E2BA 2G1AA 1GUBA 3B1KA 2O2YA 1HDDC 3IMKA 3T5XA 3TX6A 4GR5A 1XS9A 4WXPA 1YVRA 1PUFA 1ZYRF 4JGBA 4QNMA 1GYPA 2JJ2D 5TQ2B 2P8SA 2CK3D 3AB7A 4LKRA 1HO3A 1EE9A 2F4NA 5BNIA 1NE7A 2IS6A 2HA6A 4CYCB 3NP9A 5I7OA 3RROA 2VHEA 2PQ6A 2WW8A 2LD4A 3ZHSA 5JD4A 4YV0A 5KTTA 5HFNA 1TK3A 2K02A 3S29A 2PNFA 3PQFA 3WIEA 2CJWB 4DR6B 1IBRA 4KE9A 4MNUA 3IPXA 1GVHA 2BM1A 3FZYA 4JH0A 4R8SA 1YF3A 2QR2A 2KHZA 2D7DA 1LS6A 2Y0SA 5IJWA 5SZJA 2XRNA 1Y4UA 4DLSA 4BGDA 5IPAA 2HXSA 2HMSA 5K6AC 1HM5A 2YWBA 5KQSA 4HSRA 1E7YA 1JEOA 2DEUA 5EESA 4X20A 4WKBA 3OOEA 3VSEA 5C4IA 4QX6A 4CEJB 3URMA 2OGWA 4JD5A 5FB2A 2RGCA 4IJ6A 2PUGA 1RKVA 1SVLA 3LRPA 1FBSA 3MVPA 4YRPA 1UDXA 3KG2A 1PTJA 4JJ6A 4ZQEA 1LBIA 2YWFA 3GARA 4J76A 1LCIA 1PJCA 3KP5A 2XF6A 3A4CA 2FSFA 2I99A 1OI7A 3GNTA 2QN1A 2XKBA 5E2IA 1VQMI 3FFWA 1JBEA 3VR4A 3MGAA 5E1WA 1IN1A 3MS2A 2VYQA 2W6JA 4RCVA 1TRHA 4Z9FA 4MNTA 2P62A 5BOSA 4RMNA 3DPLC 3PX3A 2QRNA 3RB8A 4K88A 1YRLA 4TT3D 5JH7F 4AJ9A 1DAHA 4OK5A 4FYMA 4P7BA 4U2GA 5DLPA 2Z4SA 3L7OA 3N70A 3BJEA 3PGXA 4KDCA 4O2BB 3SR3A 1LTHR 4IRXA 1CEXA 2ODQA 3M1YA 4RAOA 4EB6A 1VB5A 2MSKA 2DOEA 2Q1WA 2XT6A 4YWJA 4QGAA 2CKMA 2WE8A 2FFJA 3B78A 1ZJ4A 3PPXA 4QPNA 4MXDA 4XSGA 5F4BA 4D9KA 5KU7A 1DELA 2CY0A 4B9EA 2SCUB 4L0MA 3GLFA 2ZT7A 1X7WB 2VE8A 3ZQLA 2VP9A 5HK8A 4F97A 4PE5B 3LSIA 3ESBA 3EDQA 4QGFA 2D54A 1PJ3A 2AZMA 2CE2X 2DHEA 2QQ9A 2YRXA 4PLWA 2PLAA 2IH5A 1VPTA 1DV2A 4RFSA 5AKEA 5P21A 4UPVA 5BQ3A 4ER6A 2G06A 2FPIA 5FEMA 1T0HB 2EIKH 3CMEI 1RWVA 2YFYA 4MRNA 3TTXA 1T3HA 2CGEA 4E7HA 2D13A 2NZYA 2Q4TA 3VPAA 5ICMA 1WTAA 3KT3A 4LNAA 1L5KA 3NFYA 4BQIA 1V1MA 4NDAA 2IP4A 1R4NA 1NBMA 4JQFA 1FLAA 3R75A 2J1LA 3QQAA 1NN5A 2XMDA 2BGMA 3EH2A 5JWOA 1JKOC 3EVZA 5DI3B 1XMKA 2W57A 3JRNA 4HFNA 1RWKA 5EKXA 3TEMA 4ENPA 5ITSA 3D5EA 4AU1A 4FISA 3NDRA 4DY4A 3LAWA 1PGOA 3WXBA 1U7DA 3PQ3A 2X9NA 4WUVA 1W44A 2IKSA 4YJ2B 1XT6A 3CUWA 1T5OA 1QYVA 2H1CA 3GI1A 1L4FA 1RP7A 1BG6A 2F2TA 4EI9A 3Q0TA 3F5SA 1W5SA 1KR5A 4D9IA 3NYQA 3N2NA 5C46F 1RMTA 1J23A 1TJPB 1T2KA 2DT6A 1NSYA 3ZWMA 5A2GA 4EW6A 2JT1A 2FCAA 5B3JA 1Z4JA 5CJ2A 4O6JA 3MQFA 3L01A 4KE7A 2CBXA 3NNNA 1DKMA 3NVAA 1HYQA 3C5WP 3RYFA 2G9ZA 5KJFA 1S5PA 3OF5A 2VN8A 1WUTA 1Z2PX 2JPCA 4MRRA 1G7SA 1WPGA 4QICA 1Q0TA 4PRZA 2AKAB 3SSMA 1CX9B 2IZ5A 4TQAA 3KCCA 2VJQA 4A3CJ 1LPMA 2E2JJ 3VSLA 2XQGA 6ADHA 4H7HA 5AXAA 4ALLA 4C0JA 1HMPA 1LGYA 1QTNA 2O7NA 1E7RA 3CUUA 3NXSA 1ZHOA 3H42B 1WHSB 1E3DA 1TUBA 521PA 5IWAB 3WAJA 1U2PA 1Z0UA 1C9JA 3DQZA 1R0RE 4E32A 2SKDA 1MC4A 4BFTA 4KQCA 1WHTB 1MO3A 4ZVSA 1IDYA 1QR2A 2HPZA 4G0MA 3CZAA 4KMRA 1LVUA 3PG5A 5ITZA 2CLCX 2Z2JA 4JOBA 2QD1A 3EOAI 2JHCA 4EW1A 3H36A 1Y48E 4PYRA 3K6KA 2P0YA 4NENB 4CNQA 4DSAA 2VYVA 4V19K 4KQEA 3S1NJ 1NUAA 2QAGB 2JGLA 3BK2A 1MGTA 1KFCB 2WAEA 2I6XA 2JK0A 2HK7A 3O2PE 5L45A 3MA0A 5EGOA 3Q4GA 2HI0A 3FD8A 3GEBA 4LF6B 3SXPA 3ESXA 2GWRA 4J7AA 1B00A 2EK5A 1HOXA 2GEDA 1OGIA 1GQ2A 3PDJA 5AKGA 5I4IA 1Q22A 1SZDA 3BZ6A 4MQMA 2Q4DA 1L5WA 3GJTA 2MBFA 1I5EA 3R3ZA 2EHDA 5EUQB 2AI3A 2OCBA 3TZ6A 5CJPA 2GXAA 4C0WA 4DRYA 5L3SA 5IEJA 1P4AA 3SXJA 1WNFA 1EK5A 1UDWA 3L0IB 4OHFA 5EUCA 3HVKA 5H80A 2A07F 1UFQA 2HRDA 2Y9PB 4DYHA 5C52B 3ORFA 1HOTA 1LPQA 1CE8A 4REOA 4HDCA 2JUCA 3JD3A 2PA0A 1U8BA 1VB3A 1E61A 1G2OA 1KDVA 3VDNB 2IIPA 3NQOA 1MEOA 4LGMA 4XOPA 4DSNA 4IZ6A 4F2HA 4ZV7A 3FKSD 2YRFA 3S2EA 3GDGA 4FOPA 3S1RJ 2IH2A 4ZO6A 5IJXA 3K2IA 5B1BH 1CSEE 4A3DJ 3B53X 4WN9B 4CUGA 3FTNA 1NKSA 3HA3A 2ZPUA 5IJ9A 1BOOA 2QGNA 1XE3A 2VDWA 1DMRA 5KNBA 4Q3BA 2QD5A 4LBVA 3JZIA 2C4HA 5BT9A 2ZC2A 2I8CA 1AF7A 3T5GA 1QXSA 4YELA 1SG9A 4HLCA 3RHSA 1F8GA 3BFXA 4WK2B 3E0XA 4QOEA 1VLVA 1QG2A 4MWOA 4KPGA 4OGWA 4G8BA 4WH0A 5I9BA 2KQUA 3V4VB 4DZTA 5CBKA 3ZJVA 1FTTA 4QLBA 5F7XA 1HKQA 4AQYB 2WSIA 3FROA 2HQNA 3A10A 4AZVA 2GNOA 5LXTF 4BO6A 4DCSA 3FMSA 4F5EA 5C0OE 4UBKA 1N2HA 1LD3A 2AMYA 1RAAA 3BF7A 5JD6A 5KSOA 2GRAA 3AJEA 4P4SA 2IPOA 3FYSA 4BPRA 4Q47A 3AESA 3ED1A 2HWVA 3M8JA 3AAFA 1W9HA 3GPIA 3H3ZA 3L77A 3LIIA 2QJOA 3UOWA 4EO7A 2H6BA 1ADBA 5KREA 3MKWB 1M8PA 1Q83A 2FWPA 2Z2KA 2ATVA 4UCWA 1VQNI 3VH1A 2JFPA 2M4KA 3WLJA 2ZM6B 4CIAA 3H86A 1NXQA 4KQGA 2ZZMA 1UT6A 1OA1A 3WE7A 5EZQA 2FPKA 2DA1A 2R6HA 4AB1A 3K0HA 1ORVA 3H13A 1ISFA 4LI3X 3QWAA 3FNGA 2PUDA 2OYSA 2V3VA 1R10A 2K2WA 1RLUA 1HKUA 2WJAA 4FYWA 5HQ3A 2XUBA 1WR8A 1WZIA 2OG1A 3FLBA 1IPEA 2FZEA 2L2QA 4JLDA 4WINA 5LUBA 2C29D 2A6HF 3G2MA 1YBMA 5C1DA 3NI2A 1RYDA 4JZKA 1PWEA 5H4HA 4B82A 2VJPA 2IX3A 1XC5A 3KZYA 2R4QA 3C6XA 3GXBA 3P9CA 4GVLA 4MUFA 5C5DA 1JXOA 1RXUA 3L2CA 2COUA 2QRJA 5GJWC 5JQGF 2WKPA 3HMQA 1AHNA 1IZ9A 1JEJA 1GPMA 1WUJS 2W2OA 4IDGA 4RGQA 2A0FA 4BIMA 1PFYA 1ZQ1A 1PK7A 4ZZDA 5FBKA 3EXFB 1E5LA 3SLRA 2EJCA 1LLUA 3RTGA 3PTLA 1BI3A 4LZLA 3CP2A 4L2IA 2IV3A 2QU7A 2WYVA 1XPXA 5GZ6A 5ICCA 2AFHE 1X9HA 5FUBA 4I99C 3ZPLA 4I0BA 2A4KA 3S4YA 3TJMA 4B74A 5LPNA 4D8YA 5KSWB 1GNQA 1KF0A 1KP3A 3B89A 4RQUA 1IEWA 1CS0A 2RAEA 2GZMA 4TV7A 1KNQA 2WPDD 3NEPX 5FTNA 1YIAA 4BATA 1F8UA 1NT2A 1NXVA 3ZY4A 5BWLA 1K4TA 2GCPA 5GMOA 5DNAA 3ZDQA 3Q3JB 1WMAA 2ICWG 5SY6A 3VHXA 4MS4B 1DO0A 1RWOA 2WU0A 3HR8A 2L9VA 3P4UA 4WOKA 1HYBA 4UU0A 4XJTA 1LFUP 4F11A 1IHXA 1WV1A 3TUJC 3TQNA 2PT5A 1NUSA 2B4TO 4TSFD 3PF8A 3A4MA 1LA2A 3BGWA 3BFJA 2VP6A 4GMDA 1UBKS 4JT2A 4BRUA 3NTOA 5LZ5A 4DQDA 4TKVB 3IT1A 2H4XA 1IE3A 1MB4A 2D0OB 4QTUB 4EM2A 4H0CA 1DWUA 1KKUA 2VKTA 3DCYA 2XPCA 3GPLA 3PXBA 1MKYA 4O1MA 3K10A 2WYOA 2CNBA 4EGSA 1ZR2A 2VHUA 2PL5A 3ABUA 1V16A 4WCDA 4WKPA 4N41A 3CS3A 3EJWA 2PO7A 3HVIA 3WGKA 3HC7A 2BZGA 3SHFA 3W8FA 4L76A 4UKDA 2PKWA 3VV2A 4TYMA 3VVBA 3K1YA 3E48A 1MB2A 3MGGA 2QGFA 3LZDA 1E6CA 1E8MA 3CVWA 5HFAA 1P45A 1QHSA 4KFCA 1NQAO 5BNTA 1KI6B 2GZHA 3BH6A 2CSXA 4I1YA 4PZDA 4RHCA 1SOUA 4CF7A 4C4ZA 3OBBA 4HWRA 1MH1A 2V7GA 2JAQA 1HYEA 3ZV7A 1OXMA 2X6TA 4MUEA 3UVEA 5CT5A 1YMVA 4E5SA 1G3QA 4IDNA 5DHFA 4KXLA 2REOA 3ZQCA 1RRMA 1MR3F 2YL2A 4Q7KA 4RZSA 3SQWA 4HAWA 1HQCA 2EILH 1W0KA 2G4CA 3QV1A 2JVHA 1UDCA 1VPVA 1N2JA 2VWGA 3A1TA 2I5PO 3KKPA 3LTEA 4MI3A 3MM4A 1L3LA 2WINI 3DDZX 1CR6A 3EVGA 4Y6QA 4ILEA 1P5RA 1T36A 2AF4C 5K05A 2KBFA 3C16C 4XGNA 1Y6IA 1UJ8A 2JIQA 2BFEB 4R81A 5U4QA 2CT8A 2HD4A 4RKWA 3QSYA 4OIMA 1GGJA 2Q28A 2OBPA 2FKAA 4UJ5A 3ZXYA 4LDQA 4YXWD 3PJGA 1UQRA 1FX7A 1DL5A 1M7BA 4YAJA 5CNJA 1GTRA 4LI0A 4REQB 2QN7A 1V8DA 3LDAA 1M5RA 3KZOA 2PEYA 3OY9A 5ESRA 2A9JA 3DTVB 3L2OB 3L0ZA 4XIFA 4BLTA 4HNAA 2GN2A 2JCGA 4WV3A 3F0CA 2CWWA 2PKEA 3WKCA 4EGQA 4Z7NB 4FEEA 3R3JA 1E1CA 2ZJ4A 3R3YA 4KUHA 3OCCA 4A0QA 2O8EA 1YGYA 3VZPA 4JJZA 2QLFA 5JCOA 2A0YA 4PCVA 1ADGA 2PX2A 2FW0A 3KPVA 4AC9A 1YD7A 5BSWA 3FF5A 5C8YF 3DBIA 3X44A 1KERA 4NV0A 4JLUA 1TL7C 4J0CA 1FNNA 4WX9A 4E1AA 2RONA 3BR6A 1SR8A 3PD7A 5LM3A 3F97A 2A14A 2IHYA 3M6VA 2ABWA 3NJ8A 3CLRC 1XD8A 1H0KA 1TA4A 1RIOH 3F6PA 3WYFA 3FXLA 1YBAA 2BFMA 2XDVA 5DHAA 2HWWA 3QTLA 4NV1A 1I3AA 4CN8A 1DOAA 1ZG1A 4QIWN 1U1FA 2RG7A 3GJ8A 3TK1A 3R6GA 2P9TA 4EHKA 3UICA 3G2PA 3H0CA 3VKFA 1WZEA 1XROA 1YI0A 5I3CA 1A5AB 3OJCA 1NBWB 2AOUA 4J3JA 4MWEA 3K1AA 5BSUA 1U9IA 1Z88A 1KSHA 3GA7A 3CO6C 2NTYC 2P67A 4GT1A 4GPZA 3UAWA 3C7AA 4OHBA 2D2VA 1FP1D 4NZYA 1ENYA 4UTRA 1GN9A 3MEQA 2XB6A 4KQFA 4Q7LA 4DZRA 1TJ4A 1GKKA 2RHTA 1TJ3A 3EF0A 4GLFA 1OPCA 3CIOA 1JSXA 1P33A 4UE6A 2W5UA 4M83A 1U2QA 1SUFA 5REQB 2JA1A 3ZWDA 4NF2A 2P5LC 3PNYA 2VSOA 1J4AA 1W34A 3KQTA 3OEEA 4HRXA 1E0SA 4TT3A 2JA8J 3KZ1E 4XDGA 3SF8B 1GG5A 1R27A 2QRKA 4YMWA 3LBFA 1V3UA 1YZNA 3PFWO 5DCUA 5DCWA 4U3JA 3TEJA 4FDUA 3FDXA 1I27A 4A26A 5DCMB 4P53A 4Q4JB 3T7RA 3GZNB 2MT9A 3DLIA 2YY7A 3HUDA 4FQ8A 2ZMEA 5FD6A 2GYWA 3PGMA 2JKVA 3PL8A 5TGZA 1XXLA 1Z74A 4IJAA 1DO8A 3D0KA 4J43A 3AINA 1TLLA 5B7NA 4ZK6A 2P91A 1GUFA 4CMIB 1FZQA 3BZBA 2R2AA 3AF4A 3FCUB 3CKYA 4IGFA 5E0KB 4Z4FA 3TEDA 2TS1A 3OFJA 3C45A 5F76A 2BV6A 1QDUA 3GEHA 3M3HA 3RAFC 4RJLA 4U4AA 5ER9A 1OKRA 1ADYA 2EX0A 2DFHA 2XPUA 1K3FA 1ZVJA 2WHXA 3HLKA 2I10A 3HUFA 3OHPA 4NFLA 1E2XA 3ROKA 1JX6A 2HT1A 1I6HJ 1BMDA 1C50A 3KQQA 2Y48A 3JQFA 1RQGA 4HSEA 3ZTTA 4IDCA 3JTMA 3IIJA 4RVSA 3ZKWB 5KTPA 3TM4A 1DBIA 2CXRA 4KCGA 1GL6A 3PQJA 1J2TA 1QK3A 3BR5A 1X9IA 2F5VA 2IXBA 5EIWA 4B4WA 3FK6A 5DSZA 1H5UA 4JL6A 4JI8B 4OI2A 4HS4A 4FWTA 1E7SA 1RYMA 3ZRGA 2PL9A 4N6GA 2P6UA 2VHJA 2OE2A 3F6OA 1J21A 2H4FA 5UKDA 2BGGA 4HXGA 2IVFA 3PGVA 1SB8A 5JZBA 2Q4BA 2CYCA 1DP7P 5BSFA 1N5IA 4Y17A 1ZR4A 1DBVO 1KMIY 2YZKA 1CKEA 4G37A 4OOEA 4AMZA 3MGKA 3HFRA 2XDWA 4EUNA 1GAXA 4CZCA 2IGBA 3EVEA 3I5XA 4IMIB 3UAXA 1BC7C 1KP2A 4MW6A 2EKBA 3JQ7A 3L7AA 3WDKA 2WZQA 3AG5A 3KQPA 3KEMA 1AG9A 1LKXA 2FN3A 2B8TA 2WM3A 4PC1A 2OUMA 1NC1A 4XCXA 4BL0B 4XWOA 2NADA 4CCWA 1YW9A 1PE0A 1Q6YA 1VQ9I 3G9XA 2WOJA 1SVWA 3FCYA 3PSHA 4RBNA 4YJFB 3RJ5A 1OU0A 5CCXA 1FW6A 2QWXA 4QT0A 1I5ZA 3UUGA 1P8AA 3FJYA 2AW3A 1FVOA 1LVHA 1FSEA 1S7EA 4P6VF 4EA8A 4E88A 3W6VA 1DTSA 1G64A 4JJKA 2J4FA 4D4HA 5EA2A 5B4VA 2HZTA 2JCBA 4EPWA 1Y1SA 5ILVA 2WWWA 1J90A 2YJNA 3CTPA 3O1IC 4R1NA 1L5ZA 4A3SA 4DDKA 3HN2A 1MAHA 1OHHD 1V7PC 4POAA 4PRYA 4F1WA 4BKQA 3MJSA 5IXSA 4PJ0C 4U7FA 2C1EA 3DT9A 2BR4A 2R4UA 2YIVX 2WYWA 3PQ7A 1UBSB 1Q6ZA 1SBNE 2B35A 5FT9A 1REPC 3RI4A 4LW8A 1U2TA 5KOJB 2DPLA 3PNSA 3K2AA 2QR3A 4KIWA 4LYJA 3HBJA 4LGWA 2I2WA 2JLZA 4KN6A 3Q72A 3BPSA 4OSEA 3L5KA 2EZ8A 4HOBA 1YA8A 3E9MA 3GOHA 3L6EA 4HGYA 4L74A 4RU1A 4GCVA 1C3EA 3OCUA 4BECA 4M87A 5I8PA 4MULA 5HNKA 2V4UA 3BSWA 1IPHA 1BXZA 1RAIA 3K0FA 4UNNA 3V1MA 3CLUD 4HLYA 3DFMA 1X77A 2ECBA 1KH1A 2WIBA 4QULA 5C51B 2X6WA 2V0CA 2XE7A 2GWHA 3FTQA 1O89A 3EDCA 4JT8A 2GQQA 1NK2P 4CT0A 1SCQA 4IHJA 2JZYA 2X1DA 2Q46A 3HCEA 1J0RA 5E0OA 5JD3A 4C0LA 1RHUA 2CNNA 2XNDA 3E3NA 3F67A 5B37A 3TW8A 4YDHB 2HU9A 1GTVA 1RAHA 2PBZA 1ABEA 2FMYA 3WFZA 1P4SA 1ULBA 3K9HA 5K0GA 3WK4A 4AD9A 2Q49A 1NONA 2XVAA 5BXQC 2IRFG 3NHUA 2AFIA 1RLTA 4AY3A 1DCTA 1PD1A 3O3OB 2QL5A 4LGVA 3IBSA 1G9SA 1QAMA 5K0EA 2C83A 3UJBA 2VK1A 1P4JA 2EJUA 4IUDS 4BMNA 5DTEA 4P4TA 2I8DA 121PA 2WV7A 4GGOA 1YACA 4PRLA 1KSGA 4D3XA 2RK6A 1SD2A 2DH5A 5C80A 4DUYB 4DUZB 1GFSA 3TN7A 3HFJA 3ANSA 3W9SA 5AKXA 4PW0A 4XDZA 1XTKA 2JLWA 1PI3A 2JFOA 2MYTA 4RADA 1OYVA 2HJ9A 3PX2A 4LIPD 3VU9B 1XXHB 4K6CA 2XMRA 2TRSB 1MH4A 1TVKA 1QZ3A 2F43B 4RM2A 1WXHA 2IPMA 4HLQB 3B12A 2HTJA 1NX6A 4NIMA 4U2CA 5JMOA 1T6SA 1BC5A 1NXXA 2HA4A 2QJTA 3NHAA 4L72A 1QFSA 3EAQA 4C5BA 5IFLA 2WY2D 1F14A 1YASA 2HK9A 3VR3D 1MFZA 2H11A 3I05A 3HYLA 2MSEB 2Y1XA 4PFKA 4Q7EA 1V48A 3U4MA 3WQSB 4MAFA 3CEMA 2BFCA 2HSEA 3U3JA 2UXNA 3EISA 4F38A 2O3SA 4XM3A 5C4JJ 4E4TA 3UKGA 4R1HA 1A1SA 2DO7A 1H9BA 2G6BA 1PK9A 1QQIA 1WCV1 3KOZA 4MMYB 3LA3A 1S8NA 4JQSA 2W0SA 2ZBQA 5D3MB 3LUFA 1SOWA 3OCZA 3MTJA 1AU9A 1Q0UA 1U3DA 5CX1B 1GG8A 3RBXA 3ESQA 3RASA 5KC8A 1RAEA 2EWMA 2J31A 4HSTA 4YAKA 4NZZA 2NS0A 1HH4A 1L8AA 5G0TA 2IW1A 1GT0C 3F47A 5LWQA 1VE1A 4BKPA 4WLUA 4A93J 4BQFA 1T5LA 3G7NA 3KKMA 2VDUE 3O74A 2BEUA 1GZ7A 2X9LA 3C3JA 4GOOD 4YAWA 4ZU6X 1UPAA 2VI5A 2VNIA 3NC0C 1S7GA 5G0WA 3UNGC 4Q48A 1K7CA 1IBCA 4GF5A 4B2PA 2IUSA 2N0SA 3UZUA 4BV8A 4F0JA 1JHOA 3FIUA 1NF2A 1D07A 4IINA 3TD9A 5T5QA 2CXXA 4BMSA 1EVJA 1G63A 1N3IA 3KDPA 3GX4X 2OLKA 4YBRA 1JFSA 1LDMA 1IHOA 4QTTB 4V0LA 3TLKA 1AM4D 2ANBA 3OLCX 1EU1A 3NHJA 3REGA 4JX5A 1DFIA 4ENUA 2HCRA 1QKKA 4EHLA 2EAUA 4HDRB 1TO1E 2KYRA 1E6EA 5IT3A 4ZRDA 3X2FA 2O3TA 5DNCA 3SJCA 1S96A 1E3PA 1D2HA 3E22B 1ZU5A 2FZWA 4X7BA 2VUSA 1SZCA 1Q50A 1H2WA 4P82A 1A2OA 1RE1A 2XE4A 1P2TA 3PKZA 5H1YA 1FSGA 5TQ2A 2LH9A 1RBZA 4IMRA 1CUCA 2IT1A 4K03A 3M5PA 5J2UF 3W3ZB 2B82A 2CXOA 2RK3A 2XUOA 4OO3A 5LA6F 1ZREA 4WBNF 5IF9A 4MZDA 3NH9A 1GILA 3N5KA 5TLSA 5BQOA 2BL4A 2ZTHA 4LRYA 3K16A 1A0OA 1JNYA 1U7UA 5FWXB 2FXIA 4QDKA 2NT3A 3GOQA 1LY1A 1SHUX 3LA8A 4DYVA 1RP1A 1VTNC 2YVKA 3QYJA 3ZHBA 1P1JA 1LTQA 4OQZA 1DPFA 2IYUA 4HGQA 1C0PA 4TUYB 1G1AA 1RKTA 2JA6J 3LK7A 2BRUA 4XB1A 3FPKA 5AVJA 3W9UA 4DF3A 3RYCB 4UXIA 4LMPA 4MRAA 3BA1A 3U60B 2AN1A 2PTHA 3FDZA 1FRFS 1XMOB 3W1EA 1DC6A 3CRNA 4A3EJ 2AQ8A 3P7MA 4NDLA 2WFAA 4NFYA 3DF7A 3ABIA 5IC6A 4B75A 5K0JA 1VL0A 1Z91A 5D87A 3CF6R 1M2OA 3DLCA 5CVVA 2D5CA 2PYZA 1D04A 2ZSAA 3QXXA 1UWKA 4BACA 2UVPB 4WL0A 1P4WA 1T0FA 1Y6QA 4FN5A 5EYPB 2J3EA 2C98A 2FN9A 5FTJA 3I61A 3E6BA 1IV6A 1YDHA 1MVOA 1SEPA 1Z39A 2HFJA 3FRIA 1JB9A 4J94A 4B4DA 2PWYA 4IRMA 4HYQA 3W8NA 1SZJG 2R7MA 4KRFA 4UV9A 1SBIA 1CUBA 5FV7A 3DKXA 2FZKA 4U7WA 5A4KA 3BE5A 5NLLA 2LREA 2RGVA 2JKZA 3AVQA 4FFNA 4TRJA 1IFXA 1NM5C 1NUHA 2PGLA 4XUDA 5CBPB 3DVRX 3O1JC 4KN5A 3FBGA 4PSXA 1GDTA 1JDPA 2I2FA 3DV0A 1O96A 4H7JA 1EEXB 1PVVA 4CCLA 2GPBA 5EPUA 2IA2A 1U1IA 2AJTA 4WDQA 2GD0A 4LWQA 3KLMX 1T2NA 3HOXJ 4OHXA 4TLLB 2XUZA 4X8OA 3VX4A 4ZYYA 1XRMA 1JQJC 3NHLA 5BYAA 4K7JA 3PUFA 1WRBA 1HF3A 2AV6A 3E61A 3I4CA 4BX0A 3KVOA 5INTA 1TZLA 1RACA 3EGVA 2UV8A 2GM5A 4GI7A 2L54A 3BIXA 3DE4X 3N0RA 4YRGA 4W5NA 2BY4A 4B09A 4DC0A 4YV1A 5DX0A 2I1QA 4OH1A 1I1HA 1U8RA 1XC7A 3HYCA 4YIRX 4ETWA 4GRIA 4CG3A 1RBYA 2VXYA 5CLLA 3RVQA 3HRTA 2WZBA 3PI6A 3ZBQA 3A0BC 2JIOA 1YRNA 2LBFB 1WH7A 4ZGBA 3LQYA 5DM1A 3T1HB 1X1DA 2OMKA 4YUXA 3HKDB 2EQRA 2DUWA 3K70D 3EFEA 3EZ6A 2C9OA 2F4OB 1V5GA 5I7SA 2B34A 4P0TA 1Z7LA 3WADA 4E6EA 4MTDA 1ODDA 3TOCA 4CIDA 2CL0X 3WWDA 4EGJA 3GFOA 4JUFA 1CQJA 5F0CA 2DE0X 2DBVO 2IUFA 2V7TA 3BWDD 4I55B 5DTRA 1ES9A 1R8QA 5HEKA 4NEHB 3MKLA 3ISJA 4HXYA 3PQDA 4LRUA 1HT0A 4DM4A 3DTYA 2Z2YA 2EYQA 2QV0A 4H4DA 4K81B 5GAGJ 1W6UA 4TTVA 1TZBA 2BHSA 4PICA 4UDXX 1F9EA 9MHTA 1M54A 1Z6TA 1ZUWA 2GLTA 4G8XA 2Z5UA 1F4VA 4E4YA 4JYZA 3ADDA 4CVNA 3MJFA 8MHTA 1SMTA 3EIWA 4G0XA 5JS7A 3MCUA 1E0DA 3L6UA 4FHEA 2Z3WA 3W6OA 1SO8A 1NG6A 2RAVA 2YYSA 2GA9A 3RC3A 5LP6A 1K6YA 1RVV1 1VKJA 4O4JA 3ZI7A 3KCNA 4BKMA 2XUPA 3OU6A 4HPWA 1OWNA 3N74A 4GHWA 4BU1A 3RRFA 2XGGA 2KWIA 1JR2A 4MQFB 1ZUD1 1KJZA 3HOYJ 3HDGA 3WA7A 3TW7A 5JS8A 5K4GA 1XYVA 2YV4A 5IVHA 2Z6AA 4HDUA 5CT8A 1NVXQ 3WGTA 3ZWNA 2Q8QA 3PT9A 5FD8A 3Q8WA 5A3SA 1RXVA 3ABLH 1KMCA 3B48A 4RETA 3WK7A 3YASA 1E9CA 2IOFK 2XVMA 2JLBA 2WF6A 1XCOA 4KYTA 4YGYA 3L7CA 2I6UA 3DMRA 3JARA 3E84A 4JOCA 4JBGA 3J7TA 3X1ZA 3OYEA 5ITZB 3MT7A 5DCLA 1A6IA 5LHHA 1U90A 1UKEA 1E62A 1W25A 1X7ZB 2RGXA 4GM0A 4AYXA 1R4AA 1IK4A 1QIHA 4XSZF 5K0LA 4URVR 7ABPA 1MSEC 3EPJA 4DQLA 3G5TA 4LHYA 1RYHA 2P6TA 4I46A 4ARIA 3C15C 1DVRA 2EL9A 1A9YA 2RI6A 3DGEC 3PJDA 3QKRB 4A69C 1EXNA 3AV0B 4I66A 1PDOA 2UZKA 2H2DA 1UBNA 1ZRSA 3U44B 3T9BA 4TTSA 3ZQFA 4TYNA 2R7RA 2QBYB 2P81A 2PIDA 2BHYA 1TOAA 1PYGA 3IHWA 5J2UB 8ADHA 1BZYA 5GTIC 1CLEA 2UZ1B 2ZYGA 3CLSC 3L6DA 4ZZ0A 1DAMA 1IMJA 1J2XA 2AUNA 4F45A 1TYBE 2PFSA 3I2KA 3C3PA 2FOIA 2ILVA 3P9PA 3FHOA 3IFSA 4QQ8A 4RV9A 4P38A 2HFKA 1JJ6C 1ZICA 3DE7X 1ISPA 3DWIA 1G6OA 2GVDC 3QKTA 4HLXA 5EI5A 3BWBA 1XPRA 5FQOA 2OZPA 3GN2A 1J0XO 1Z68A 3NKFA 4OV6B 1M6YA 1X74A 1M6HA 3NBZC 1TUGA 3QM1A 3THWA 4NPAA 3DKIA 4O4LA 1A9QA 4Q66C 4YRRA 5J2TB 1EJ0A 4CQNA 3DVSX 4A82A 4LQCA 5A2QZ 5JVDF 1YE5A 4D25A 4A5OA 5AXBA 3PGLA 4LYDA 4ENTA 2E2IJ 2VQFB 1PZNA 2EQBA 4NCXA 2Y77A 2A1TR 2OP1A 3C6KA 4LRTB 4Y33A 4PSUA 2GEVA 4HL6A 4WAUA 1CEEA 4ARCA 3D5LA 4F55A 1DC5A 3KOUA 2PBIA 1T3LA 1TE2A 4IIJB 3ZCSA 4XKVA 3CN9A 4HQNA 4BLPA 4N54A 1M34B 4YMHA 1EDDA 5JXHA 2Z57A 4AO7A 1CWUA 4G7OF 3E03A 4TZKA 4X00A 1TF7A 3ZMVA 2I3ZA 3OICA 3REOA 1IQPA 2JI7A 3N9IA 1EE1A 1X39A 2UZ4A 5FTWA 1EFRD 1QOZA 4GPBA 4Q12A 4Q24A 1EFLA 3M1LA 1BIBA 2EATA 1FE8A 4XYGA 5I45A 3N7TA 4A0HA 1O9GA 2ZW9A 5FHRA 4Y8VA 1YDGA 5G3YA 1KQ0A 1A4XA 3NTUA 5ABPA 2ZXHA 1Y0BA 3MWEB 1OI3A 4KG7A 2OHVA 3FMQA 1ECPA 3LT2A 4L73A 5LZ8A 3ORHA 4P4SB 3UHJA 2ISSD 3FMIA 3KJQA 3QOFA 1L4YA 3D59A 4YYEA 3G2BA 2YINC 4RJIA 2WAQA 5ILUA 3ETJA 1TWCJ 3UH1A 1PJSA 2CQKA 3FF1A 3FOBA 4LWOA 5DTIA 1AMNA 3NWTA 5CIWA 1Q7EA 5DOZA 1IN8A 2WB1A 2C2BA 3DTNA 5JHHB 1N1GA 4IDHA 4CM1A 1QHNA 3SNHA 3TIIA 1T8PA 4NATA 4BNDA 3NTVA 4C4XA 1RQRA 1ND5A 3N0TA 4CM8A 1M2KA 4YI5A 5EOVA 1EVZA 2JBHA 4ARSA 5C7OO 5K8LA 3W5SA 3T1YB 3H1EA 1ODCA 4HV5A 4NB5A 2PWPA 5AWFC 2L02A 4OQNA 5DJ5A 3S55A 3ABMH 4PQYA 3W5UA 4NMXB 3D2LA 4JR0A 5K9ZA 5CW2A 2II6A 2XNJA 1JEAA 4P58A 4PFQA 5DXJA 3WTWC 1EBFA 5CA0B 3E15A 2E35A 3L05A 2OFOA 3CMCO 1IZ1A 2BZSA 2ZKLA 3LC0A 2AO9A 1Q0ZA 3TOXA 1A8QA 1USTA 1N92A 3FKSA 1CB0A 4YIIA 2B0JA 2ID9A 3A70A 3IULA 3A04A 4BJ6A 2ODWA 4LF9B 3V4SA 1LK5A 5JSKA 3MWGA 4B31A 2JGFA 4MA5A 5B2EA 2RE8A 3A2LA 2BVLA 1ZMXA 2A88A 1NMZA 3A9SA 4LQLA 3EFOB 3UHOA 1BEEA 1W5FA 1A8SA 2OU2A 1CUWA 3S32A 1DO2A 1E3TA 6REQB 3Q8MA 3OM9A 4XDHA 2XTJA 2OBLA 4G4IA 3Q5DA 4N39A 1FLDA 3QA9A 3UATA 3AIMA 4S1PA 1KY5A 4EF5A 4PNHA 4Q39A 3H2JA 4BNWA 5T57A 5C5CA 2Z99A 1F2UB 1GVJA 2HYJA 4XBFA 2HWYA 2VF7A 1U3GA 3VVMA 2EKPA 2DYKA 4PC6A 5CK4A 5E7JA 3BTUA 1NU6A 1ULTA 2B7LA 3OA0A 3OEYA 3VR6A 4C6HA 1X1SA 3DD5A 3RJTA 1EWVA 4YMIA 4E22A 1MVNA 2EP7A 2O8VA 2VYCA 3G7UA 2VO1A 4RVGA 5GAJA 2PUCA 4GH5A 4N49A 4EENA 2CEAA 4WXRA 1CU1A 2YFQA 3RNOA 4ECEA 5KWEA 4KQXA 5U9CA 1CJVC 3WTBA 1SFUA 2BR3A 4B6EA 5LVAA 3O92A 1Q91A 3TQHA 3K0LA 2EFDB 1FXUA 4KU4A 1E3EA 2QUBA 3CJRB 2OO5C 3PYMA 3MRVA 4WX2B 4MUKA 3KO8A 4YDSA 2DG2A 7GPBA 4OMUA 2BKUA 3UO8B 3BC1A 3GCGA 3FGOA 1HE5A 4ALKA 4DV7B 1U9JA 4OHMA 1RLIA 2QJWA 2ZRQA 2XIGA 3N8IA 3GFPA 3SZTA 2WMOB 4G5QA 4OB7A 4DUPA 3SS8A 3FMRA 2VNHA 3BSFA 3QE9Y 1ZNWA 4BB0A 3DVQX 2DWOA 3DEIA 3NC4A 2R93J 4E15A 3SC4A 4S1NA 5L3FA 3ZG6A 3PQ5A 4M21A 1YSCA 2GEBA 1KFBB 4RF5A 4BRZA 5FBLB 4DIUA 3K5HA 4DNXA 1K9VF 1R6TA 1FP4B 1GUYA 1ZSVA 2VXOA 5GWXA 3T3HA 4E94A 3VMMA 3GJSA 5IXYA 4D57A 3PIOF 5LLDA 3QWIA 4GBED 4RHXA 2K9LA 4RTJA 1B59A 1YFJA 3HJBA 2V6BA 4KKVA 4R9RA 4GOXA 4JCOA 3WOVA 4L78A 4M46A 5KQMA 2XD9A 1QKIA 2JKYA 5K51A 2PZJA 3HJUA 3NETA 4LXQA 4M6XA 2Q1YA 3KOYA 3E9NA 5CFOA 1AZSC 5E3HA 2B30A 3AHCA 2P5YA 1U7XA 1A7UA 1OMOA 1SXGA 3RSCA 1SAYA 3T4XA 4NK5A 1THGA 1KU2A 2FEZA 2QUAA 3UTCA 4IEIA 1ZYUA 1H1LA 3I9V2 5DGTA 2X9DA 2BMVA 3CLUC 2MMGA 5F0HA 5JNWA 2D2WA 5ENZA 3L7IA 2RI0A 4HK4A 4REQA 2VNAA 4DA8A 5KINB 2VOOA 5JVDB 3ZX4A 1NVKA