4EVIA

Crystal structure analysis of coniferyl alcohol 9-o-methyltransferase from linum nodiflorum in complex with coniferyl alcohol 9-methyl ether and s -adenosyl-l-homocysteine
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
368
structure length
360
Chain Sequence
MDAATAVELLDAQPQVWHHFLGYINSMTLQCALELDIADVIHRHGHPIPLNQLAAALEIPQTKAPFLSRLMRMLVHLGYFTQVITKLPSYWLAPLSRLLLKQNPYNARSLTFCSVHEHLVDPWRQMSAWLRTGKEDGKDTPNAFAFAHEGKKVYEVCSEDANFSQLFSEGMAGDSWLFSRALVSKCRDAFEGLSSLVDVGGGTGNTSKVIAETFPNIHCTVFDLPHVVSGPKQTHPNLDYESGNMFTDEIPHADAVLFKWVLCDWPDEPVLKMLKQCKKALTKNGVKGKLMIADHVLDHESCNDSNSMGTSLILDMLFMSFLEGSLRTEKQWAKLFAEAGFKDYKITPVGGLRVLIEVYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of coniferyl alcohol 9-O-methyltransferase from Linum nodiflorum reveals a novel active-site environment.
pubmed doi rcsb
source organism Linum nodiflorum
molecule tags Transferase
molecule keywords Coniferyl alcohol 9-O-methyltransferase
total genus 128
structure length 360
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4eviA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4eviA02
4R8RA 1JQEA 1G55A 1XGOA 2STTA 2LF7A 3LKDA 1JHHA 1V39A 5K05A 4B17A 1OPCA 1KYWA 1LNWA 3TQNA 5DM0A 5CVDA 1IUYA 2G1PA 3I54A 4WK8F 4G7ZF 5F64A 5L3GA 5JVTA 3ELKA 2AN4A 3RIEA 2V1UA 5EG5A 3GZ6A 2UZ4A 4BLUA 2FK7A 5H20A 2RC4A 4KYWA 3HCDA 2HOEA 4P96A 2I9KA 5HVQC 4B09A 3HA3A 3FRIA 2DPDA 3R3HA 1L3LA 4MTEA 3A7DA 4G6QA 5DM4A 4I2OA 3FYCA 1UCRA 2O8XA 4RTNA 4HDUA 2ZCWA 1STZA 4G94A 2H27A 3WGHA 2L4MA 1NV9A 2DO7A 3RKYA 4S05A 4IXAA 4N0BA 3E3VA 4P55A 2I7CA 2GXBA 1LDKB 1QZZA 4AD9A 1HXDA 3E8SA 4I02A 1H9TA 2KKOA 2EA4A 2D1VA 4HGZA 5DPMA 1WXWA 2CFXA 3C18A 1QZYA 1U8RA 2YR0A 2VBYA 3SSMA 1I6XA 1PP8F 1JHFA 2ZFUA 2F5CA 5KYGA 3ABTA 3A7EA 1LVAA 4R8HA 3TM4A 3UJ9A 1W5TA 2MH2A 2JJQA 4OA8A 1O57A 3I59A 5ICFA 3MCTA 5ILSA 4ZYEA 4I09A 1MJFA 1M6YA 2FNAA 4YMGA 4X61A 4AUKA 5EVJA 3SZPA 2ISYA 2AOXA 2R3SA 5EMLA 3DMHA 1JQDA 5LQCA 4HF2A 4Y15A 1KPHA 3GXOA 3ZMSA 4P5OA 2QQBA 4HLYA 2CL5A 4DQ0A 3AJDA 4JQFA 3CUQA 1L0OC 3TOAA 3ZMVA 5K09A 4HH4A 3M6XA 1KU9A 5AONA 5ICEA 4L9TA 5BXYA 1U3EM 2YXLA 3T7SA 1J7KA 2GZWA 4X1OA 2JTVA 4A5NA 2Z99A 5DUKA 3BY6A 1S6LA 4L9VA 3TDUC 3BPVA 2LSOA 3EVCA 1XMKA 3E6BA 3LCUA 3MB5A 2G8NA 3KQTA 3VOEA 2DW4A 2FRHA 5EEGA 2NXNA 1ZG1A 1FBUA 1FZPB 2ZXJA 5GM2A 4PONA 3BWMA 3SSOA 4CKBA 2UYHA 3U81A 1LDDA 4Y17A 4OQEA 4O29A 1F9NA 5DTMA 4OIOF 3ZMUA 2TDXA 3LQRA 3E6MA 4UVAA 2UXNA 3M6VA 5DUIA 4LECA 2OKCA 4OBXA 3DPTA 2VODA 1OR7A 3V4GA 5LQKA 3O2PE 1WY7A 2DPUA 4YUYA 3NQOA 4LB5A 2X0LA 3SHFA 3KEOA 1D2GA 1H1DA 3RPQA 4R6WA 3UJDA 4C06A 1XB4A 2ZMEB 4HW0A 3WTTC 4YIFA 1QGPA 2WA2A 3A25A 1YO5C 3GYHX 2XKOA 1EAMA 3FMSA 2C7OA 1UWVA 5HIMA 1FSHA 2PG4A 3K1PA 2IIPA 1NW8A 3MTEA 4LWOA 1OYYA 2ONYA 3LBFA 3NDIA 2VDWA 3RODA 5T67A 1XSDA 2GH1A 3BJOA 2DT5A 3GRVA 4RB0A 5J8CA 3BZ6A 2V79A 3M8EA 5ED4A 1XSXA 3G89A 3KR0A 5E20A 3V8LA 5EZSA 1P4XA 5DRYA 2B3TA 2DPMA 3G7UA 5E2BA 2AOTB 2EWNA 3H3ZA 2AXLA 4KICA 3FZVA 3P71T 3B02A 2FBIA 1ZRDA 3U2RA 1K78B 2DK8A 1U2ZA 3UA3A 2MBFA 4L5JA 1RUNA 1YFLA 5D8LB 4OU0A 3OCJA 1Z9CA 1RI1A 3DPLC 5CLSA 2AOUB 3I53A 1ZQ9A 3UJ6A 3C7JA 1LEBA 4ER0A 3NWBA 1KGSA 1ZRCA 4GQBA 3UJAA 3CDHA 4LJZF 4GGGA 4KDCA 2PWPA 5F2NA 1R5HA 1OR8A 4G56A 2XVMA 4HTFB 4OIPF 3B3JA 4X63A 5HLGA 2Y48A 2G71A 5F2KA 1Q1HA 2FF4A 2Y0MA 5D6FA 3ZMDA 5K1YA 4ZZDA 2HWKA 4POOA 5LSAA 3KETA 4DCGA 3R0QA 3IKVA 3EVEA 2IFTA 3ER9A 5HEKA 4CZZA 3HRTA 2JPBA 4A2UA 3DULA 1MGTA 1AV6A 2HR3A 1BM9A 1R7JA 1SD7A 5D1HA 1SMTA 1L3IA 1R6AA 5E1BA 5GIPE 1XDUA 1F1ZA 3Q9VA 4K2EA 2OAZA 1AQIA 2BM9A 5HIKA 3AXSA 2BZGA 5K0EA 2O03A 2HEOA 5DWQA 2C7PA 4XSXF 2IH4A 3ELWA 1NW3A 2QRVA 3FPGA 5DX0A 2B25A 2NXJA 4MWZA 1J2XA 4PYLA 1NHAA 3ELYA 3A27A 3QPTA 4ENKA 3QOXA 1YW8A 5EQJB 2Z5UA 1P2FA 2RKHA 5E8GA 2ZBPA 3V7SA 2LKPA 2F5EA 3I5UA 4RGUA 5EC8A 2KIFA 1WRJA 4AZWA 2PI0A 4C07A 2C7QA 5F1RA 4RAZA 4UV9A 1R58A 4O3MA 5HLHA 5T6BA 4PDKA 4M7RA 2O6GE 3J81Z 4EVIA 3WTUC 1JR4A 1WS6A 3O31A 4BQAA 3NJRA 3L7WA 4EMSA 2Q41A 4EJTA 4Q47A 4LD5A 1MHTA 3TKYA 2HTSA 4WXHA 1B4AA 4XUCA 5FD5A 3C6MA 3DXYA 3M1EA 3R0JA 3LHDA 4YUXA 3I59B 1RI4A 4OIRF 4EJWA 5K5OA 2PX8A 3FUXA 3TPZA 5FB2A 3EYYA 2DAOA 4CTJA 2GA1A 1YS7A 3LAJA 1U5TA 1KU2A 4H0EA 2P40A 3NRVA 2STWA 2RVCA 2P6TA 4KIBA 2GQQA 2HZTA 3VFZA 1I1SA 1SD6A 2ZWAA 4BP1A 4PZJA 2CGPA 3ID6C 3SM3A 3ZPLA 2VP3A 3K0BA 3Q9SA 4QVKA 5FWAA 3F22A 2HGCA 2MA3A 1BOOA 2Q0OA 3IHTA 3GFLA 3ELUA 4QDJA 3G3ZA 3F21A 2NNNA 1IN7A 2PJDA 3K0LA 2EA2A 3KQQA 5L3BA 3KCCA 1FJXA 2EX4A 5FUBA 4ESBA 5LRRA 2P6SA 1HW1A 1OMIA 5H6QA 3RKXA 2ZBKA 1ZREA 4U7DA 3IRRA 3HOTA 3P2EA 1FSEA 4CKEA 4YG2F 5DD8A 4HOBA 3VYWA 5BQTA 2A5YB 1TQMA 4UXNA 3HVJA 3HNRA 5D5WB 3OU2A 5LR6A 3WTSC 1X1AA 1ON1A 4F84A 2BR5A 3OZRA 2DULA 4HV6A 2KIUA 2VT2A 4PCQA 2NNYA 4KIGA 4MQ9F 5BPIA 1G8AA 5KQRA 5CYVA 1REPC 2VE9A 4ER7A 1J59A 2XAJA 4LLNA 1QAOA 5EPEA 1XDSA 5FHRA 1IXRC 3MZHA 4M74A 1H0MA 2V74B 3P9NA 2I62A 1I5ZA 1T39A 2EJTA 1G38A 5LHHA 3CCFA 1QBJA 5FADA 2YSRA 2EJUA 4HF1A 2EFOA 1EJ0A 1K79A 5EZQA 1R8XA 2OB2A 1AOYA 5GOZA 3CUOA 2FNPA 1ZHFA 4HLXA 3P97A 1IXCA 1VLMA 1TNSA 2AOTA 3C3YA 2L4AA 10MHA 3B3GA 3GRRA 2FRXA 2VDUE 2DTRA 3KQOA 3O4FA 4E2ZA 1BIBA 2ZZMA 4JXJA 1X1DA 3JAMK 3G2OA 5C0OE 1I1GA 2HNKA 5E1ZB 4AZSA 5EMJA 4DQ2A 2Y1XA 1WXXA 2GB4A 2IPXA 2JT1A 1T98A 5G02A 2IDKA 2L02A 3RIRA 3IKTA 1O9GA 2FBKA 2AN3A 2YTZA 4DF3A 1EIZA 4HQMA 5HZMA 4M9SA 2IT0A 3QOPA 2HQNA 5DTQA 7MHTA 2JH9A 5ILUA 3DMGA 3WU1B 3B89A 4BLWA 3F6OA 2EFJA 4AWXB 3IC7A 3NTVA 5K5RA 4KRGA 4IHSA 2F2EA 4KVZA 1TW2A 4Y13A 3GGDA 3FRHA 5FA5A 5HS9A 1TPYA 3E6CC 4P7KA 1QNTA 3MEXA 2IW5A 2A07F 2F5FA 4KN7X 3NW9A 4RTKA 3LKZA 1RIOH 5IKMA 4QPNA 2PXXA 1PJZA 1NT2A 5HIJA 3BZBA 3FF5A 1YLFA 3LDGA 2ZLBA 3COAC 1VE3A 1U5TC 5KVAA 2A68F 3DR5A 1L9KA 1FBQA 5IT3A 5J6XA 1D2CA 2YVLA 4DM3A 3SR4A 3LCVB 5KS2A 2CYYA 3GEZA 4P58A 3BDDA 1W5SA 1IY9A 3LAPA 2VDVE 1ZGAA 4M6YA 2ZZKA 5ICGA 3P9CA 1O3TA 2XAFA 3L09A 5CCBA 3EEOA 3E97A 1D8KA 4PGHA 2Z33A 5JFRA 4BHCA 2PSSA 3WE3A 4D0PA 2ZVJA 3C0KA 3ME5A 4LFUA 4YFXF 3FPHA 3BGDA 3FXQA 3EMDA 3KR9A 2VT3A 2CG4A 3E5QA 3UJBA 5CM2Z 1VBFA 2XV4S 4HGYA 4AVPA 4F7ZA 3WGIA 2P3OA 3KQVA 4FGZA 3RW9A 3K1MA 2IVMA 3E5UA 3FM3A 3FMRA 5E1WA 1YQAA 4OQDA 1JSZA 1FYLA 1R00A 1KP9A 4M72A 3W6KB 3HSEA 1G4DA 2EB7A 2J5PA 2YPRA 2AZTA 2EV0A 5LBQA 2D45A 3P2IA 4GYGA 3BT7A 2P35A 5HILA 4R1HA 1WZNA 5LGTA 2PMHA 4FT2A 2DI3A 3G2PA 1XCBA 1HW2A 3GVAA 3MFKA 3IWZA 3TMAA 1HKTA 3ZN1A 3LDFA 1YS6A 1SKMA 4GO1A 3U1DA 4ZYDA 5H02A 4HX4A 3UJ8A 4KNYA 4CGZA 1WSUA 1F3LA 1SG9A 3BP8A 1R36A 2P3LA 1V3FA 5FWDA 3NMUF 2KW5A 3FTDA 4ISCA 5EMMA 3HRMA 3WTVC 4ETSA 2L3DA 2NRAC 4WF2A 4WXDA 2P41A 2BBYA 1PUEE 4AIHA 2GAUA 2CKDA 3OE4A 4QQKA 1S3JA 2QY6A 2PV0A 2HYFA 3D5LA 2XUBA 3Q87B 1VTNC 3LA3A 3HA7A 3KP2A 1LJ9A 3RYPA 1O3QA 4GBED 1DPRA 1FBSA 2DFIA 2WV0A 2W84A 1NBHA 2PWYA 4E32A 3ELDA 1QQIA 3R6TA 2Q8KA 1YFHA 2OYRA 2XAQA 3RYRA 3BWGA 3KLNA 3VC1A 6PAXA 1Y8CA 2E5WA 1F4KA 2IGTA 3AY0A 1SQFA 3V8KA 4G8XA 3HCFA 5KVRA 2OBFA 3TO6A 2MD5A 1U5TB 4KT5C 1GVJA 4OX9Y 1BI3A 5HLIA 4E70A 3T8RA 4AZVA 1OKRA 3FXRA 1CGPA 2BGCA 3QP6A 1G6NA 4IRHA 5HFJA 5HOQA 2ZIEA 4BAYA 2ZBQA 5CVJA 4P7FA 2ZCJA 1Z05A 3KHKA 3CJTA 5A2QK 3FX3A 3A26A 5EMKA 1NKVA 1G3TA 2FK8A 3GZ5A 2R6ZA 1QAQA 4RX1A 2QZ8A 3KLOA 2YXDA 3ER8A 3BGIA 2HR1A 2G70A 5LHIA 4WCGA 1HSTA 1MKMA 2WTEA 5ERGB 2OQRA 3BWCA 2OU2A 3ZMZA 1YIOA 2FSWA 1LB2A 1JG4A 1BI1A 4GF5A 1WQ2A 2OXTA 2AS0A 4LK1F 2XROA 1KQ9A 2Z6UA 4PYOA 3PQJA 4EM2A 4EKGA 2BM8A 1JQ3A 3DLIA 4IKPA 1RI2A 4A6DA 4AX8A 2PBFA 4EQZA 1QANA 2MC3A 3D2LA 3RI4A 2NS0A 4AIKA 3GUDA 1XVAA 2V9VA 3HCCA 3BOQA 4LLGF 1VPTA 4R05A 2CMGA 5FLXZ 4PCAA 4YMHA 2KRFA 2ZIGA 4PCLA 4DKJA 1BHJA 4IWNA 2PQ8A 2VXZA 4I01A 3REOA 4LG0B 2JZYA 5CD1A 4QDKA 1XN7A 2ZNYA 3GU3A 3T8TA 3HVIA 5DYMA 1ORIA 2IJLA 4YFKF 2K4JA 2GXGA 4MNUA 4YUVA 1EH7A 3GJYA 3GWZA 4PYIA 2G7HA 2OA4A 3C1DA 1P92A 5LRSA 1EQAA 3GRYA 1PP7U 2PMUA 2IBTA 1M0EA 2CWEA 3R0AA 3V8JA 3VODA 4UNOA 2HMYB 4Q4ZF 3FXUA 3V7CA 5ERIA 1SD4A 4Y2HA 2FMLA 1XXLA 3KP5A 1UIRA 3PS9A 4RYLA 3DMFA 3NDJA 4HDVA 3GF2A 2RN7A 4YUWA 2ADMA 2O05A 2CQKA 2JHPA 3ISPA 3F72A 4G7OF 2A6EF 3O6BB 3HTSB 2DLLA 2O0LA 1SAXA 4MTDA 2OY0A 2IH2A 1UHMA 5E9WA 2PJPA 3G73A 2RNJA 5LLQA 3BGVA 4RWZA 4DZRA 1XDZA 3KFWX 1LEAA 4HX8A 1B9NA 3MQ0A 4QLCU 5LGNA 3K6RA 4LMYA 4ENJA 2H11A 2D2WA 2N47A 2PLWA 1NE2A 3X0DA 1LDJA 3HUGA 3I64A 1XCJA 1FT9A 5K0JA 2YQZA 4MHGA 1RUOA 2ACJA 1IW7F 3C3WA 5KK1A 2K02A 3PT9A 4WWCA 5EIWA 3QRFF 4RB2C 1XMAA 2Y75A 2RQPA 4KFCA 3SQNA 1U6GA 1D3YA 4YV1A 4C08A 2JSCA 3LX6A 4OMYA 1R1TA 3HSFA 3MWMA 3EQLF 4FT4A 3SXYA 4M9ZA 1J5YA 2FBHA 3E5XA 2CWWA 9MHTA 5FFXA 4UOEA 3IRQA 3FPJA 4RVGA 4A5MA 3F6VA 2P5LC 2LF8A 5HIIA 5K0BA 1Z6RA 2MH9A 3WODF 4M71A 2PVCA 3OPNA 1ZH5A 1YW7A 5EEHA 5BMZA 2P3QA 3L00A 4AZTA 4GCVA 2FQ3A 1SMYF 4RSRA 1MJ9A 2ORED 4EJVA 1K6OA 1DPUA 2GIVA 5LQJA 4O5VA 1D2HA 1FX7A 4G6DA 4V0RA 3BPXA 1P1BA 2UZKA 4WXCA 2P5VA 3M8FA 4E31A 4BLVA 3G8AA 2NXEA 5FQNA 5TRDA 3TKAA 5DCFA 1ZYRF 1K7AA 1L3BA 2AR0A 5DSXA 1R74A 4EKIA 3FWEA 5LQRA 2OZUA 4MQ4A 1TBXA 4NQWA 3A4TA 3NVKI 1JG2A 1MJAA 1P39A 5LQAA 2ESHA 3O7WA 4GOND 4ZZLA 3ERED 3F8NA 2YR2A 2E1NA 3DV8A 4YV0A 2K86A 5L3EA 2EV6A 3WTYC 2IA1A 2P7HA 3CBGA 1TW3A 3N97A 3GFJA 1IZ1A 4YIIA 4FS8A 4ER5A 1ZARA 1WWXA 5E1DA 3EYIA 2VBWA 2A61A 5DT2A 4F86A 4GEKA 3FZGA 4E30A 2RV8A 2UYCA 1AQJA 2B78A 4FP9A 2HKXA 3FPEA 3M9AA 2Z6QA 3WGGA 1YZ3A 4WVLA 2A3SA 1XSVA 3V8VA 1GXQA 1JXSA 1SVUA 2QVOA 5E8IA 3GRZA 2V1DA 4KMFA 2XVCA 4FX0A 1Q0TA 2DQRA 2XYVA 3LL7A 1IRGA 3FUUA 3DFGA 1IN5A 3ECOA 3HHGA 3J80K 3UFBA 2EJRA 3PB3A 3GRUA 1B6AA 5CVRA 1QYRA 1S29A 4ER6A 5JR3A 1EH6A 1OYIA 3HSRA 3FUTA 1IRFA 4IV0A 3E7PA 2K27A 2VE8A 3KPYA 5BW5A 1ULYA 2JHAA 2OBPA 2K4BA 3LFKA 2FHPA 4R8SA 2EK5A 3HCAA 1TQPA 1R18A 5CCXA 4A12A 1KPIA 1SQGA 4Q48A 1AF7A 2OQGA 3CJQA 3VSEA 1FLIA 5E1XA 3LECA 2H00A 2PX5A 3FM5A 3HEMA 2BR3A 2ZBRA 3G8BA 3IEIA 1BI2A 2PXCA 1TNTA 2P7IA 4LG1A 3P9KA 2E7XA 4OIQF 1PRYA 2GA9A 3HM2A 4PNEA 2PT6A 1HW5A 5CVVA 5E18F 1NBIA 4BHPA 4CXMA 4L18B 1RNLA 5BW4A 1HQCA 5HOOA 1CF7A 3SGLA 4CWAA 2VZ9A 2KJCA 5EHGA 1XGSA 1EV7A 3QU3A 2CSOA 3DKWA 1JG3A 5GP1A 3FTEA 4U7BA 4CTKA 3G2QA 2QYOA 4OBWA 4KUMA 5D6EA 4QQNA 4BY9E 3WU0A 4NECA 4FT8A 5BOXA 3THRA 5CVIA 1B59A 4IJAA 5D5VB 4OOIA 2JHCA 1P4WA 4RTRA 5D1NA 4UHTA 2AVDA 1XCLA 1O54A 1B42A 2X4HA 3CO7C 3M33A 3FMQA 1MJBA 3ECHA 4DNCA 3WTWC 3NWEA 2YX7A 2CO5A 4ENMA 1GXPA 3VC2A 4XLPF 4ESJA 1USSA 3B73A 3BROA 5IT9Z 2H6BA 4M9XA 1BC8C 3BJAA 3UBTA 5H6RA 4RTQA 2QQAA 1XD7A 1KQ8A 3L8DA 5U4XA 3IHUA 3OE5A 3JWJA 3F8FA 1P1CA 2WC2A 5L3CA 1R1VA 3PQKA 4YFNF 3HTXA 4L9NA 4LGWA 1LQ1A 1RZ4A 5K0NA 5IT9K 4ENNA 2XVAA 2ELHA 4X41A 4Z2YA 2O3FA 1EH8A 3I4PA 3E23A 3R4KA 3KQYA 3KQPA 2KJBA 2NAZA 1VP3A 4HC4A 4CICA 5ILVA 4WX9A 2PGXA 4LLLA 3OU6A 3CKKA 5FTWA 4EQQA 1TQIA 3TR6A 4RTMA 5L3FA 5LHGA 4CHUA 2DK5A 1KHHA 4I0AA 2OO3A 3WTZA 1MZBA 3GW2A 2VBXA 3B7PA 4EGYA 2EFWA 3G5LA 5LGUA 2BR4A 3ORHA 4NB5A 3TGNA 3EMBA 4ER3A 2Z6AA 2XBMA 4KDPA 3CUQB 4FSDA 2OD5A 2XRNA 2NXCA 1ZG5A 1ZAOA 5F6FA 4G7HF 3TRKA 5K0CA 4MIKA 4GUAA 3R6SA 4XUDA 4L7VA 5EIFA 3LCCA 5FGMA 3N4MA 2QE6A 3FPFA 4QTUB 1ON2A 3FUVA 5KQSA 4TV7A 2B2CA 2ZSUA 3CJRA 4RTPA 3R9XB 5L3DA 5FFZA 5JHUA 2ADUA 4MEYF 5LEKA 3DXXA 4L5IA 2LD4A 3BKWA 3EDPA 4A0XA 3LQQA 3MAGA 4JK1X 2ZW9A 3B5IA 5EOVA 4K6MA 5DXAA 3LBYA 1GHCA 2VC1A 5K0LA 2A6HF 2YU3A 3EUHA 5FO5A 3QV2A 4EM0B 4XBFA 1ORHA 5BS6A 3SX0A 4EGZA 3DOUA 1I4WA 3EVAA 2WK1A 5D8KB 4GXOA 1INLA 1XGNA 2P7CB 1E2XA 5GWXA 5DD4A 1VIDA 2FXAA 3MZYA 1BBYA 5HDGA 2M87A 4LWPA 1FY7A 3ZP5A 4QVGA 3KR2A 2AVNA 1L1EA 2G7UA 4EV0A 1S7OA 1RJDA 3T5XA 4DMGA 1MDMB 2VBZA 2UWMA 2F5DA 3ROUA 1Z91A 1SFXA 4M6XA 3TM5A 1IN6A 4KA4A 2HS5A 4I98B 3HVHA 2PX2A 1JE8A 4HG2A 3G5TA 4KW7A 4C04A 2YX4A 3QPHA 1Y0UA 2HKOA 3R24A 2Z9OA 4IF4A 3GIWA 3FYDA 2QQ9A 4OINF 2IA2A 1HBXG 1YYVA 4P7GA 4PIMA 4OA5A 5DM1A 4BP3A 5DRTA 4N9IA 4FX4A 4U7PB 3DTNA 3H92A 3RJPA 5T64A 5C9ZA 3EGVA 1KIAA 2BYVE 1IAWA 4YV2A 1BC7C 2ZFWA 5DTRA 4EJOA 1R1UA 4G9YA 1JSXA 1EJ6A 5EHIA 4AIJA 3V97A 1KYZA 3KQSA 4M37A 5K8VA 2IH5A 4U0WA 5K0FA 3ZQ7A 4BYYA 2ZTHA 4ATNA 5DSTA 3P8ZA 3TO9A 1W7PB 4RGSA 5JI6A 2AN5A 3OU7A 1T43A 2P1DA 2Y1WA 1DDNA 1C0WA 1MD0A 1UB9A 3HYIA 2XAGA 1Z3CA 1M6EX 3LA7A 3WG9A 3GNLA 1FYMA 4E33A 1X1BA 1WKMA 4ASNA 1RI5A 3BWBA 3CUQC 3JSOA 4GC5A 4GC9A 3TO7A 2W85A 3PTAA 3AAFA 2P4WA 2WWYA 3KZZA 3EVBA 1KR5A 1RJEA 3E05A 4FZVA 5E8JA 4A0ZA 4N9HA 4MEXF 3WSTA 1DP7P 3DLCA 1VL5A 3CGGA 4MQVA 4BXUA 1RJGA 3SZTA 1B1BA 3ZN0A 1G60A 3DUWA 5HDNA 1UFKA 5CIYA 1SFEA 2FPOA 4HSGA 3P2KA 2O06A 3SSNA 3PFIA 2NYXA 5FULA 2B0LA 5CUQA 2K4MA 4PIPA 5E8RA 3JTGA 1N7IA 3JTHA 3WE2A 5FCDA 2GS9A 3IV6A 5CJ9A 2OPBA 1FP2A 1F38A 1XCVA 3KP7A 3O3KA 3UA4A 3HHHA 4L9JA 4FSXA 5FA8A 3HRSA 1EG2A 1I9GA 2M8EA 4GOMD 3BJ6A 3M6UA 1HMYA 2E7WA 1YUBA 1D5VA 2ETHA 5FLXK 4PYNA 2GA2A 1YG2A 5CVUA 1G6Q1 3EVGA 3W6JB 4UV8A 3CC8A 2O61A 2JG3A 3SMQA 3S68A 3SVZA 3KP6A 2IBSA 2FOKA 4RV9A 4GYIA 2BEOA 3C3PA 3CTAA 4I0BA 2HQRA 1T2KA 3HP7A 5MHTA 2D1HA 1W4MA 4P9FA 3KPWA 1NW6A 3LPMA 4DA4A 4KN4X 4RTOA 4ZYGA 4RTLA 1NV8A 4ESFA 1OYWA 5K03A 3BXOA 3RKWA 2ZWVA 2OZ6A 2FYTA 1FYKA 2FCAA 2XHKA 1YTYA 1FWZA 1G3WA 5AIPA 1FBNA 2C6YA 2MLGA 1R8YA 2YUIA 2E1CA 3TFWA 4X60A 4B8XA 2OZVA 3EGEA 1I27A 2I6GA 4QTTB 4LG0A 2W25A 3V7RA 4R79A 1T0FA 1A04A 2XKPA 2QBYB 3MGGA 1H9GA 5ICCA 1X3UA 3F8MA 4HTFA 3PX2A 3I9FA 2BV6A 4PYMA 3R60A 2OB1A 1RJFA 1Z1DA 1NW7A 3DP7A 1TLHB 3T0YA 3TOBA 1BI0A 4U88A 3GCZA 3PFHA 5E1OA 5FHQA 4CO8A 3K69A 1S8NA 3SFZA 1U78A 1IN4A 3ZMTA 1UFMA 5P8WA 3GLXA 3ULQB 1T6SA 1R23A 2UXXA 3KP4A 2W24A 3RPUA 1UHWA 1ONVA 4MHTA 2M30A 3FHZA 3QOWA 4H0NA 3L9FA 4QPPA 2AS5F 3Q5FA 2WA1A 1G8SA 3KPUA 5IH3A 3IWFA 5DM2A 4PINA 4RVHA 4CDGA 2EG5A 5F2OA 1ZRFA 2ESRA 5J8FA 2EFQA 2IPQX 2PFBA 3TQSA 4HA8A 3H3UA 1DUSA 1ZGJA 5DX1A 5E9QA 8MHTA 1W7PA 2EFPA 4HRAA 1D8JA 2O57A 2V7EA 4PWYA 2Z3YA 2BH2A 2QM3A 2YXEA 4ON0A 4IRIA 5DCMA 2HDCA 3BWYA 5HS8A 3TLJA 1ZN2A 4RB1A 3UJCA 3LWFA 2ZMEA 4L0ZB 4ZYHA 2M1BA 2QLZA 2RGVA 2UYQA 5TJJA 1DL5A 3F8CA 4UVCA 3G88A 1YW9A 2QRVB 4M38A 1K78A 4XCXA 2QBYA 2ONZA 3AWIA 2KIMA 2ZJ2A 1BIAA 4HF0A 3ANXA 1O3RA 5DX8A 4FHTA 1ZLJA 1BKYA 5C1IA 3I71A 2M45A 3EGIA 2UYOA 2R7FA 2H1RA 2O07A 3EPPA 2DBBA 4IHTA 4RGRA 2F8LA 2ZULA 3M6WA 3TDZC 2GLUA 3PFGA 2XYQA 1KU3A 3PX3A 5HDKA 3THSA 2NP6A 1F5TA 3K9TA 2A14A 3F4KA 3T7TA 2NYUA 1WG8A 3C6KA 3NEUA 4LB6B 5LQNA 5LEJA 3J7AO 3JWHA 2CW0F 3Q7EA 2P5KA 3EETA 2LNBA 2P7VB 2IA0A 3IL2A 4GOLD 3UWPA 2BE5F 3VEPA 2AOWA 1O7LA 5HS7A 5DXJA 3KE2A 2J5OA 1X19A 5JUWA 3P9IA 2ZNZA 2G9WA 1R22A 1USTA 3HTUA 1QPMA 4XSZF 1IN8A 3EVFA 4P7JA 1KU7A 1BOAA 1J9IA 3LDUA 4U0YA 2ESNA 2FMYA 4I7HA 3MERA 1DUXC 1J0RA 2NP7A 1HKSA 3JWIA 2VC0A 2AOUA 1X1CA 1KQ0A 3HIFA 4XUEA 3HRUA 5K5QA 1KXZA 2GWRA 3WTXC 3GDHA 3I0TA 1P6RA 4RB3C 2COMA 4C03A 5K0GA 3RDIA 4BH9A 3GFIA 1MDMA 4E2YA 3T7RA 3F23A 4CYDA 3TOSA 1Q0SA 4XLNF 1SD5A 4E2WA 3KKZA 5LQUA 5A2QZ 2MLKA 2P8TA 4EJUA 3HA5A 2HFHA 3E6DA 4U7TB 2PEXA 3OOPA 4KMUX 5D4RA 1FP1D 4HBLA 2DU9A 1N7JA 1JTFA 3EVZA 2L54A 2HTEA 3GX4X 2GAFA 3J80Z 3CLOA 3R61A 4QWQA 4E2XA 2JH8A 3K1NA 2CMHA 2XIGA 2HV9A 4M36A 4IV8A 1RI7A 3KQMA 1IXKA 1YF3A 4S04A 4RS8A 1NW5A 4HZFA 3NVMB 2V1XA 5GM1A 4RVDA 2PXAA 2XASA 2VN2A 2W57A 4OMZA 3KZYA 2FE3A 1ZLKA 2HTJA 2NNWB 1U2WA 2PBIA 4NHJA 4JBAA 3F8BA 3FTFA 2IRFG 2G72A 4MGRA 1HSJA 2PLYA 1QAMA 2HYGD 1XTPA 3OV8A 4UUVA 5DDGA 4L0YB 3DXZA 3J81K 4KWCA 5BP7A 2Q2EA 3K2ZA 3MAJA 1FPQA 4RAYA 4EM1A 3ML6A 1G3YA 1JG1A 3JWGA 4PYKA 1ODDA 3G2MA 3T0IA 1XJ5A 2VS1A 5EGSA 1KPGA 1FOKA 1S7AA 4ZTBA 4FR0A 1V4RA 4A0YA 1CF7B 3LSTA 3DXJF 4HYEA 2PKWA 3MHTA 1QO0D 1IM8A 1VQ1A 4RVFA 1L3CA 2O0YA 2JPCA 2L01A 2M5WA 2P8JA 3KPJA 1ZKDA 2YX1A 5D5XB 1E17A 1Z6TA 2IDJA 4PYQA 4KIFA 1P4AA 3JW4A 4R6XA 1HNNA 4P9UA 3IYLW 1G3SA 3M4XA 2PY6A 5DLYA 1SFUA 4RTJA 5DEQA 1FC3A 2LDUA 1IF1A 3CVOA 3JAMZ 4CXFA 4HAMA 4DCMA 3GO5A 4U0VA 2QENA 3QP5A 4UVBA 1BC5A 4BHBA 2V6CA 1P91A 1DCTA 2H94A 2JRTA 2XAHA 3FTCA 3BUSA 2QUFA 2XYRA 3DEUA 5E2AA 2HWVA 1SUSA 4Q5SF 4C05A 2H09A 2QWWA 4RGXA 4Y30A 2ZZNA 1W7PD 3KQWA 5D5UB 2VOPA 3M7GA 1WI9A 3L2CA 1Z7UA 2B9EA 3OZTA 4GOOD 3B3FA 4PGGA 5EKXA 1YFJA 1YB2A 5GINE 5EKUA 3KU1A 3EEYA 2ZIFA 5M5BA 3CJNA 4HX7A 3OFKA 2ZO4A 1IXSB 2A69F 3HCEA 4F85A 3QAHA 5FD6A 1YZHA 3FUWA 1I1NA 2ZKZA 4IRGA 3KEQA 3UZUA 4O6JA 3M70A 3S2WA 3ABUA 5DCMB 1TTYA 1O7FA 3OZSA 2GPYA 2PX4A 2PN6A 2ISZA 3P7NA 5AIQA 2IP2A 3MCZA 5FQOA 2H6CA 3PLAE 3H2BA 4CKCA 3DQVC 3QU6A 1RI3A 3T1BA 4A6EA 3HOSA 1B9MA 5E17F 1J75A 2R7DA 1BN5A 3U9GA 1FNNA 2VONA 1R5GA 2FA5A 3HVKA 5E9JA 3MQ2A 4IPAA 1O3SA 2RDPA 1KA8A 3GO4A 5D4SA 3BKXA 3SXJA 5BPDA 5GIOE 3GFMA 3LGAA 2VOOA 4HV5A 3KP3A 4ZH4F 3RTRA 4BNCA 4EK9A 3HCBA 4KDRA 4MTLA 4C4AA 1HKQA 3JSPA 5CVEA 3UJ7A 1JTEA 1VP9A 3LA2A 2FEZA 4IVNA 3DF8A 2AOVA 5E1MA 2XGXA 4XRFA 3D0SA 3KPVA 3EVDA 3PVCA 1T38A 2EV5A 1PDNC 1O9HA 1AWCA 4RTSA 5B1SA 3ERCA 1ZG3A 4M73A 3AXTA 5DV5A 1SUIA 2PT9A 4HQEA 2DQLA 3DH0A 2C7RA 3OFJA 3VB2A 2K7LA 3KR1A 3F3XA 2ERCA 4PYJA 1JGSA 3CO6C 1XGMA 3MTIA 4YUZA 4V0QA 5K01A 4LK0F 1N2XA 3I58A 2EFNA 2FU4A 1BJAA
chains in the Genus database with same CATH superfamily
4R8RA 1G55A 3ND6A 3PYLA 1IQPA 3FDZB 4JNKA 2LF7A 3LKDA 1VE6A 4W9MC 1Z67A 1FMCA 3L1JA 1M6VB 1N75A 4TLBA 4PJNA 3R5TA 2JHFA 3QTLA 2LVBA 4A6PA 3ZHUA 3D59A 3L0OA 1KYWA 3AIKA 4UEOA 3W5JA 5DM0A 3UT6A 5LMCA 2PJRA 1K75A 4CDNA 4JROA 5CVDA 2IW3A 2QD4A 3JQEA 1KJYA 2I33A 3I54A 2G1PA 4XB2A 4OAZA 2Q27A 4MAMA 2HA5A 4UEKA 4MTCA 4WRRA 1RACA 3GLFA 3RIEA 1RYMA 1QV9A 4L16A 3CVXA 4HFRA 4FETA 3CNOA 1ZJ5A 4B0OA 2BKUA 2OTJI 3DLAA 2HTFA 4BLUA 3X43A 3AR6A 2FUG2 1QH0A 2XGOA 2C5FA 2YV1A 5HCUA 3K4PA 3U6BA 4CFZA 4ALLA 3PNSA 4EA6A 1F5NA 1OXBB 1MO2A 1Q21A 1QWSA 2QLLA 1Y8QB 3PC3A 4FD3A 4R3UC 3C3KA 1R0CA 1QCYA 3OTHA 4B45A 2DY1A 4B09A 2QN2A 2VJIA 3JQFC 3FRIA 2B30A 4AJHA 2GHIA 2GHTA 2DPDA 2FLKA 5EGNA 3QHQA 3TD2A 5AHOA 4U63A 1NXOA 3CMEI 1XXHB 3HBLA 2FEPA 2OZLA 3R20A 4F72A 3KWFA 1L3LA 1C1DA 2BL4A 1OFCX 4BAZA 2YWHA 3DZFA 2Q5FA 3W5VA 1V54H 4EHFA 3T7IA 2ZIVB 1U4NA 4MUJA 1U7XA 5K4HA 1NSTA 4QUHA 4JN6B 2O8XA 1IZZA 4MV3A 1HNZB 2HNAA 4HDUA 3V4ZA 3IR5A 4KJZA 4AYBN 1N8NA 1UPXA 2ZJ6A 4G94A 5DWDA 5BNFA 1RAIA 2PA0A 1UMBA 2QUKA 3C85A 2VYVD 1K08A 1Y42X 1XJWA 3QIVA 1QUEA 5H3HA 1K5PA 2QTFA 2B5WA 2DQSA 4TQUS 1KIMA 1O4XA 2YL2A 4IKOA 5JCOA 4MV4A 2QR3A 3W2GA 3E3VA 2YJTD 2QTCA 1NG7A 1SK9A 3JYPA 1ZUHA 5JARA 2GXBA 1OXVA 3GEDA 1HGXA 4AD9A 2AFHB 1DCFA 3QQAA 2PUWA 3E8SA 4OUDB 4I02A 1R6BX 2C03A 3DV0B 4URVR 4XWOA 2RG7A 2NVOA 1JFVA 3N8GA 3R3VA 4KXLA 5J2UB 4C22A 5K7ZA 2WT9A 2ZSIB 1SC4A 4MRSA 5I8ZA 4BWFB 3UGTA 4RDCA 5IAGA 4G0UA 3KG2A 4Z51A 3HCRA 1TEXA 3EZLA 4N6OA 3SF8A 2I3DA 1OXXK 3T0GA 1MX3A 4V2IA 2ZFUA 3QVSA 1P17A 3DEHA 2F5CA 3KKQA 4MEBA 3B6EA 4H7DA 4V03A 3MLAA 2DQYA 4R8HA 3PXAA 1PBTA 3TQHA 4NF2A 3WVNA 3TM4A 4M86A 1KTIA 1G20E 1GNSA 2W22A 4J90A 2MH2A 4P7BA 5K9ZA 3S2GA 3AEQB 1HDCA 3MBKA 3I59A 4NH0A 5ICFA 3FNEA 5ILSA 2XT6A 5FR2A 5I7UA 1EUYA 3BQMB 4YT4A 4RDXA 2FNAA 3QLTA 3DYVA 2X41A 3NNNA 4JKOA 3R41A 1IVNA 2NNLD 3KEYA 5ADHA 3OOHA 4UJ3A 2NGRA 2YJNA 3KP1A 2ISYA 2LNDA 4K9RA 4HX2A 2WKRA 2R3SA 1RHMA 1U94A 2Q49A 2YJ6A 1OGJA 3DMHA 4PSUA 2XR1A 1M1YE 4YK7A 2MCFA 1AQUA 1XZEA 4PIVA 5HCIA 1KPHA 2N1MA 3QPAA 1EFVB 2LY1A 3H86A 4B1RA 2C2MA 4OATA 4JI4B 2VQHA 3I6YA 1CE8A 2CL5A 1IPFA 4EHLA 2CNWD 4JQFA 1JMKC 4E3WA 4LRSB 5GTDA 5IPAA 2VZ8A 3S3MA 3M6XA 4G5OA 4HH4A 3T7AA 1GPAA 4XLFA 2GZRA 2IRWA 2FPPA 3O94A 2P9ZA 4I5FA 1RRMA 3SN6A 4EL5A 5MF6A 3D8UA 4PONA 4L9TA 1Z17A 1G66A 4HNQA 2YXLA 4E7HA 4A0SA 2R751 1YHZA 1G8HA 1RKTA 1R16A 1RC0A 2ZUUA 4X1OA 1T0FC 4JNCA 4A5NA 1E3OC 2IYNA 4LX0A 5HKLA 1D2RA 3WNCA 2V3VA 1OLXB 1VL6A 2D3TA 4P4TA 3QNWA 2C92A 4LZZA 4Y9DA 3QKUA 3VKWA 4CODB 1D4ZA 3OHMA 4AQDA 5AM3A 4BFYA 3E3OA 3WMEA 3RFTA 1MQSA 3LSYA 2MG4A 3BPVA 2OD2A 3TBKA 1WWKA 5IJWA 2LSOA 4MITA 3PEWA 3E6BA 4TZKA 2AO9A 4IICA 4UHJA 3I9MA 3VOEA 1Z7GA 2NXNA 3AV0B 4OXNA 5AOAA 4EB0A 3L5OA 4XTCS 2ZXJA 4KTVE 3ZJUA 2GLOA 3GGOA 2WNSA 3PXCX 3E0QA 3FFBA 2PYZA 1R9TJ 1KEZA 2YHIB 3GVCA 3U81A 4B9AA 1IIRA 1F9NA 2A7XA 5DTMA 5FPSA 3ZMUA 2JCBA 2TDXA 2XXJA 4PJLA 1DAMA 1J70A 4Z5XA 4NPCA 2Q0QA 2D2EA 3RRJA 1N7GA 1E98A 2H2WA 3M6VA 1I3KA 5DUIA 1P9LA 2AD1A 2GEUA 1E96A 1YFZA 2YC4C 4PZAA 5KWIA 2QM8A 3DPTA 1F8UA 2QX8A 3LCRA 1OR7A 4IS3A 4XB6B 2I65A 3F7OA 1N2IA 3E9DA 4L9SA 3H5NA 3O2PE 3RK0A 4UEWA 5LQKA 3NEYA 4H17A 1UJ2A 2Y1GA 4JI5B 2FFHA 3T34A 1RXIA 3V4SA 2DPUA 5KOHB 4HI0E 4YUYA 4AY3A 2W37A 3BXZA 1ODSA 2ICWG 1QTRA 4BXFA 3F2IA 3NTRA 2X0LA 4FKZA 4QYXA 4XGIA 5TQ2B 1LK7A 3WMWA 1OC4A 3UAZA 3QBVA 4Q3KA 2GZ3A 1GILA 1PW5A 5JJ5A 1H1DA 1ULAA 1W94A 2CJWA 3RPQA 3FG9A 3FSEA 4C06A 1XB4A 3R5FA 5K7SA 2ZMEB 2XAUA 3H99A 3HYNA 4R2XA 3WWEA 2F1HA 1NMXA 4E6KG 3FPBA 1GPYA 1NJ5A 3TNDA 1UXJA 5THXA 3FMSA 2C7OA 1UWVA 5FP0A 1FSHA 1IWPB 1U0NA 3K70D 5FUQA 5I7WA 4F12A 4PZ0A 1YJQA 1GTSA 1TTPB 1N32B 4NJEA 1OYYA 4M60A 2WBLC 5ALHA 4CMCA 1KI8A 3NDIA 4ZTFA 4Y1GA 4CT5A 1WHUA 3BJOA 4NBSA 3VC3A 2BKVA 4X1EA 1X92A 1ATIA 3GRVA 5J8CA 2QTMA 3T41A 1KI6A 3V1MA 4EI9A 5AJTA 4LJRA 1CNMA 3DM9B 3E9MA 3KAQA 2DHCA 4Y33A 1F1BA 3KR0A 1EUZA 3PPWA 4YC7A 2PL1A 1JVSA 5D3ZA 4TTRA 1Y8ZA 5AK5A 4J29A 2ZQ5A 4MKIA 5IXJA 1W7AA 4TVOA 1G21A 2B3TA 3G7UA 4WD3A 5KHLB 7MDHA 2EWNA 3H3ZA 3MW8A 2FRDA 1PIWA 4WOKA 2ZCVA 4J1SA 3FZVA 1SAYA 1YS4A 4OO3A 3ND5A 4XYBA 4OGWA 1XZKA 4DSUA 3BCSA 5BV1A 1T5DX 1XO1A 1AX9A 1GTVA 2QJWA 4COKA 2WQ7A 1U2ZA 2MBFA 2BMEA 2NTNA 3OZAA 4GLBA 4C2BA 3G2BA 1E6CA 3W2IA 1ESZA 1GQ2A 1LVKA 3ESWB 1EK0A 3FBTA 4FLEA 2O2YA 4IP0A 4IXMA 4OHOA 3SNKA 5MN6A 3ZV3A 1RT9A 2D0PB 2ZBUA 4NZMA 3DPLC 5JCOC 4C1BA 4OQLA 3D1VA 1GRRA 3N5CA 4WLUA 4TPKA 1FP4B 4N40A 4J3JA 4HSEA 1BXGB 4AN4A 3C7JA 4J1NA 5JLXA 1T0JB 5CH3A 4LOLA 2OLKA 3O92A 1TWFJ 3IAS6 4RKYA 3VHLB 3WB9A 1SFOJ 1S01A 1N8SA 4OI4A 2A6PA 4EFLA 1ZRCA 2GMWA 3UWDA 4LOHA 5A5DA 1GNTA 3PENA 4HPJB 4K9OA 3UJAA 4DHWA 3JVEA 5F2NA 1IQ0A 3K09A 4B4UA 2IYRA 3AG5A 1OR8A 2E1RA 3MD9A 3OIGA 3AR3A 4HTFB 2WWVD 4G3XA 3S70A 4CMEA 3M4JA 2Q3LA 4M9RA 2Y48A 4JELA 1P0QA 4GE3A 3WIEA 2XUKA 3UUFA 2UU9B 1Q1HA 2ZYRA 1JH9A 3ZMDA 4JLPA 5B37A 4GS5A 3WLJA 2WTUA 5J1RA 1UKYA 4KVAA 3YASA 4ZZDA 2Y2UA 2ZYSA 4YRSA 2Z1MA 1QHSA 3R0QA 1TA4A 4PLYA 3P0FA 3EVEA 2IFTA 4FOSA 4YJHA 3ZZNA 4YLYA 3O2NA 5HEKA 4CZZA 4DYHA 4IWXA 1GADO 1BHO1 1P33A 2QLMA 3BCUA 1L1FA 3WICA 4CG3A 4A2UA 1K92A 2OE2A 3DULA 3I61A 2PH5A 2ISQA 2HR3A 1XXHE 1AV6A 3R7BA 3TW8A 5L3QB 2IEYA 4P92A 1L4MA 3MC1A 1QNFA 1TT5A 4TWBA 3L0BA 1SMTA 5C81A 2R1VA 4KHPB 3GLTA 5K2OA 1GV5A 1FYXA 3PWZA 2GR9A 1QQ5A 4W8OA 1KZGB 1Y3CE 2C99A 3LNTA 3AF1A 3JVUA 5K6AA 3MJTA 3O8HA 2VOEA 3QSGA 3VSKA 4PSVA 3KKEA 3TI9A 4DLRA 5HIKA 1XD2A 5HNFA 3BAFA 3DMPA 5FBLB 3OCXA 2HEOA 1ICIA 1LLFA 5DWQA 4DMKA 2FE4A 4YMVA 4R8LA 5J4KA 3JRCA 2C8KA 3VPHA 4YYEA 7AT1A 3SQDA 5A0FA 4KVZA 2QRVA 1QQ6A 4KMMA 4WNAB 3A4YA 4J07A 1JN0A 3ZLJA 3L7MA 4LDPA 4MGEA 3A9TA 2NXJA 4MWZA 1R6RA 3DT9A 3X1DA 3WP0A 1X1TA 2QRHA 3FM9A 2QRNA 3Q0IA 4PYLA 1TCCA 4YCSA 4ZKDA 1QU2A 3CWZA 3T1OA 1XQYA 4BB9A 1L2TA 1T33A 1G2PA 3EDQA 4QOHA 1WD7A 3GD5A 4DMCA 1P2FA 1U80A 3ZE0B 2PKCA 4B75A 3OM0A 5JI2E 1CZHA 3F1KA 4F4FA 2ZJ8A 4BNTA 1PK9A 3W6ZA 2JFHA 4Q1BA 3KXKA 4M1KA 5AK3A 2AQHA 2NVYJ 2EFEB 1KMCA 1SOWA 3TMKA 3GHHA 3ND7A 2CNNA 2XA9A 1R58A 1QHEA 3N28A 4EY3A 4QUJA 3HFJA 4P4LA 1VJDA 3ZWOA 5HLHA 1G18A 2IHZA 2UUPA 1DQRA 1HETA 1E3QA 4PDKA 1R6VA 1S3SA 4OREX 2VJAA 1Y8RB 2O6GE 2DVMA 2ZR9A 4G5HA 3J81Z 3TOCA 1H2XA 3Q3CA 4YVFA 5BNTA 5EHQA 1TE2A 2Q41A 4DE5A 2XUGA 1Q7TA 3JRXA 4EJTA 4L6CA 4Q47A 4JLAA 1C9NA 3TKYA 3P9ZA 3GQBA 2D5VA 3C24A 2OPTA 4HAWA 4IMJB 4CVNA 1XCMA 1I14A 2VLIA 5AW7A 1HYBA 2PSHA 2D1SA 3IDOA 5KJFA 3Q15C 1PKEA 2QVXX 2GK7A 3C6MA 3M1EA 3R0JA 2BH9A 5FO0A 4YUXA 1FVXA 1PJBA 1LI4A 1RI4A 2P11A 3M6LA 4GH5A 4P82A 4AZ3B 4OV6B 4MQFA 4IFTA 2PX8A 4MWSA 1KK2A 3GJ3A 4X20B 5AMXA 5DM70 3QU4A 5LA6F 4KITB 4CTJA 1F2DA 4PRKA 1XFAA 2J6BA 1P0FA 2FXIA 4FDMA 4DMFA 5CXSA 2OC9A 6PFKA 4E7ZA 4W9RA 5C44J 5B3KA 1KU2A 5K1ZA 3PUIA 2STWA 2JK1A 1Z2AA 1WMEA 1X13A 3K4CA 3VPCA 4NXNB 2Q5EA 3KOYA 1TKCA 3D1NI 4KIBA 4X93A 3K6GA 2GQQA 1E3WA 2JBWA 3A2NA 3UKDA 5D3KA 4A2QA 3CDLA 1DELA 1X9GA 4GZ3A 4TKVB 2V59A 4L4RA 4WNIA 2P4QA 1NSFA 4HUTA 1N77A 3VFZA 2RDMA 3PIRA 3CC7I 1I1SA 1ZN7A 3KDPA 4NMMA 1OA1A 3FMIA 4TRMA 3AG4H 1AGPA 1ZNWA 4BP1A 4KPFC 2W70A 2WF6A 2VTEA 1A5AB 3EZNA 4CQNA 1Q1GA 3ID6C 3VR4A 3BFKA 3K0BA 4CUGA 2HOTA 2A0KA 4UPDA 5G0VA 1LDNA 4CMKA 2BHLA 2HT1A 2AUTA 1QQ7A 3DKRA 3G3EA 2PT7A 3LP6A 3F22A 3C4VA 3EWNA 1AUQA 2NADA 4R1OA 1BOOA 2Q0OA 1U7HA 1W5FA 3IHTA 3ITKA 4I5IA 1GU1A 3H8SA 3M1AA 4WOBA 4D6YA 5AW3A 2K85A 4V0ME 3MCAA 3AF6A 3H5OA 1URPA 1ZFNA 2C96A 1QCCA 2FMKA 4H2DA 5JS8A 4LJ5A 3GT4A 3EAQA 4X1YB 3ZJ4A 1ULHA 4JOQA 1AMOA 3I37X 3MJHA 4OQNA 1ABBA 5KWSA 5JJIA 3KCCA 1U9IC 4GBMA 3OIPA 4BO8A 2IPLA 4ZOCA 4B1FA 3G6EI 2XOKA 4TV9B 2ZSBA 5LRRA 1PNQA 3MG9A 3VSAA 3DMTC 2I6TA 2PGDA 1YHNA 4WA7A 5D51S 4E5MA 5H6QA 4U7DA 2R5ZB 3PNBA 4CKEA 5AW1A 3UKGA 3MF4A 1H2RS 2XCUA 1S2MA 3B1WA 3UQYS 3F96A 6NULA 3N74A 1II0A 1EX9A 4XRSG 5BVHA 4U2BA 5BQTA 2W6OA 4L5BA 5CJJA 4XIGS 1Z07A 5KI6A 4CM4B 5B7NA 3THXB 2GXUA 4I5GA 4UXNA 3S40A 3SDBA 2V8BA 3LSRA 4AF6A 4DC9A 2DHEA 4NABA 5D5WB 4CL2A 2FGKA 4FFWA 3HGGA 3M3HA 1ZXLA 1NURA 1X1AA 3LSHA 2V6GA 2YRXA 3UHPA 2J09A 3OWTA 1E9VA 1XTRA 2VT2A 2XIQA 4L73A 4KIGA 1BFUA 2WP0A 3TVYA 3V42A 4X3OA 2QAGA 9GPBA 4AC9A 5JNVA 2Q4DA 4JSYA 2VE9A 3QE3A 4YRAA 1PJ4A 4QHYA 3I1JA 2FMTA 1EFTA 3UT5B 5CLHA 4UHEA 3MHPA 1W5AA 5CKTA 5EPEA 4HQRA 1PV1A 2H1LA 4Y9UA 3KUUA 1UJBA 1IXRC 2XQJA 3I9V6 4I0WB 4U6SA 1E1DA 2ZCUA 5CFPA 2ZCJA 2P6NA 1TM4E 3TQOA 1WW2A 2P9EA 3P9NA 3F8WA 1IULA 1T39A 4LZOA 1S3IA 3DAOA 5MGBA 3G5MA 2JIBA 5CX1B 3MOGA 1EXNA 3ZQFA 3ENZA 4XLZA 5LB2A 3FZNA 2ZYUX 3O5AA 1FRQA 2D8MA 3NVDA 3TZEA 3LSKA 1XJ0A 1QBJA 3CS3A 2IA5A 4FCYA 2JGNA 2ZI3A 2EJUA 1L4BA 3I12A 4G0MA 3QWHA 5FADA 1LTHR 5F73A 5ARBA 2EFOA 1GAWA 1N2CA 5IBCA 3CLUC 4YP6A 1CRWG 4TMTA 1FYEA 4YJ2A 1FSFA 2BT4A 3RVPA 1RYEA 4YXWA 3UB4A 4C2MJ 5CB6A 3D5QA 4IDDA 3CUOA 2ZT5A 1A4UA 4X1KB 4HLXA 5JZ9A 4S1NA 1TF2A 3UAYA 1BXRA 2L4AA 1BX0A 2BHSA 5FFFA 2PR7A 2PUTA 3OLCX 2YN2A 1NOJA 2FRXA 3AC0A 3W2HA 2JRMA 2HPIA 1I2AA 1CDOA 1KHTA 2ZS9A 1UJ6A 4MS4A 4DCOA 5CXXA 1S8AA 3ZX4A 4YQEA 1ARZA 3TLEA 3WNZA 5EIEA 2YIJA 1ADCA 4ALNA 3PQ6A 1NBMD 1Z08A 2ISCA 2VF4X 1BH2A 1I1GA 2EG9A 2YWXA 4PCUA 4D4IA 5K45A 2F9FA 3LA6A 3M4OJ 1E3TA 5EMJA 3UV6A 3HM5A 3B7WA 5HA5A 4DQ2A 1X15A 1U81A 4IDNA 4N82A 1BTOA 3T1YB 2HIAA 4C3JJ 4KNWA 4ND7A 1XWIA 5CDFE 4B87A 3FNIA 5KPJA 3EGDB 3FDYA 1BD4A 5LDDC 5I6DA 2JAUA 3ROMA 2P0YA 1UFQA 4HDAA 4YRDA 4KYTA 1ECPA 2HDWA 1FJ2A 1FFXB 2PLNA 2BMJA 1N6RA 2QPOA 4YRGA 1H69A 2I4MA 1T2DA 3BRWD 3P2YA 4GX2A 4KL8S 2NTYC 4AY2A 4NR0A 4X5OA 5HZMA 5KWVA 3LJKA 4ZOAA 3SOZA 2ES4A 3C3JA 3DWIA 3GRPA 4GPIB 7MHTA 4PZ9A 5ILUA 1XQXA 2PMEA 4XNFA 2PMDA 3DMGA 4GPD1 1YIAA 4I08A 5CMLA 3E1SA 3PC8C 1NF2A 2EFJA 2ODEA 1Q0ZA 2RG1A 5K5RA 2LFBA 1OT3A 1M2HA 3BIJA 3O7MA 4KRGA 4YO7A 1DWQA 1T25A 3ETJA 2GEJA 2GKOA 3FRHA 3GGDA 3I04A 3L1UA 3OQ1A 1YE8A 4BP8A 3KOOA 3OQOA 3E6CC 2IEZA 1VQ6I 2DOKA 5TLSA 1WVRA 3AI1A 2HJWA 3DV9A 5IABA 2DFNA 2A07F 2XDAA 5BNWA 4KN7X 4J0JA 4LY6A 1XPOA 3NW9A 1GFSA 3MT8A 5ILQA 2HA0A 1ZOLA 5BQXA 4RL4A 2WJWA 2IPAB 2CKMA 5FKOA 3OF3A 3OQIA 5B1DA 4L0MA 2Y30A 3MMSA 1E1RD 3IJ5A 1RPAA 4LHYA 2PXXA 3KZIC 4LV5B 4UZFA 2I1QA 4D7NA 4ZJZA 5DBFA 3PC4A 2AJBA 3HKDA 2V58A 3OBBA 4K05A 1DTWB 4K9NA 1F48A 2X2OA 4FONA 4MINA 2A0XA 3P45A 3NWPA 3ZQCA 2A68F 3I4NJ 4IIGA 2XT9A 1H0RA 1PZHA 1VBMA 2FWPA 1FBQA 1SKQA 2MOKA 3WQSB 1SAUA 2VO1A 4B3IA 3OY2A 1A69A 4WN9B 3RSSA 2PJRB 2YVLA 3DEWA 2H29A 4LRQA 4B3CA 4DM3A 2QMOA 4FYWA 3R74A 3GEZA 1U1IA 4LTDA 4P58A 2G40A 3LAPA 2I4RA 3QMPA 2F7SA 3ZCXA 2KSQA 2KMUA 4L75A 2QL5A 3F71A 2GYWA 2PGAA 1YR9A 2YY6A 4M3NA 4RJLA 1TQ8A 3DWFA 3E97A 1BD3A 1FTGA 4HVTA 4G24A 4LSGA 3T7JA 4IZZA 1UQUA 1ZHHA 3TIFA 4D0PA 2BUBA 3MS2A 3NTOA 3OM1A 2PKQO 4M0LA 4Q6BA 4WJKB 3ME5A 4Y6RA 5AHXA 3X1MA 1IG0A 1AQ6A 1E89A 3N8NA 5A4IS 4RAOA 1O8CA 2Q2QA 3UXMA 3GJRA 3TPCA 4JEMA 4DMMA 1JU4A 4ZV7A 3FXQA 3CRW1 3EMDA 3OYNA 3ZIAD 4I81A 1U0JA 4Q9DA 1E9DA 1WVIA 2J0QA 3CEAA 4ISBA 5F51A 2JANA 1IHDA 1VBFA 2XV4S 1VCOA 3PM1A 1GO2A 1Y3HA 3R3YA 4HGYA 4XQ0A 1L5VA 4F7ZA 2QVYX 1QH9A 5D6OA 2G1JA 2ZIWB 3ZVMA 3K6JA 1TEZA 3KWMA 1AHIA 2YYZA 1V9LA 3K30A 3RW9A 1ECLA 1P8AA 1TVMA 5E1WA 1QYCA 2I71A 2Y27A 2KDOA 3C41J 4J6FA 4NOJA 3H84A 1A35A 1IK6A 1WHSB 1FUUA 2VJPA 3ETDA 1LLUA 3OECA 4OQDA 5EWJB 5CB8A 4O0MA 2VTDA 3HRHA 5KYKA 2PH7A 4Y2QA 3ESAA 4O4IF 2ZSEA 1RM4A 1ULTA 1XKQA 4Q1EA 3W6KB 1VLHA 3CT4A 1SKAA 5JG7A 3HSEA 3G9TA 9ABPA 2VRCD 1CUDA 1EXDA 4OP2A 2VAXA 3CQZJ 1UADA 1K83J 2YPRA 3BFPA 1C30A 3JZAA 1AK2A 4A3JJ 1NQAO 5LBQA 1IATA 5DZSA 5BUSA 2D45A 1ACIA 2C1XA 3CA8A 4QOEA 3BT7A 3FXKA 2OHHA 3VAYA 2QYSA 4QBIA 5EJ2A 1BDIA 3PFKA 2RIRA 4LE0A 4WAUA 5LGTA 2PWBA 2FF5A 2VOJA 3DBRA 4IJ5A 2WOOA 4Q4JA 1ONBA 3WNBA 4B79A 3LGXA 3G71I 3QXSA 4MCIA 4RSGA 3AETB 3ONDA 3WZLA 2DI3A 4EH1A 4M3DA 2IGBA 3G2PA 3NEAA 4JAVC 4ESEA 3MFKA 2CE2X 1J0CA 1WZIA 5T4HA 4CLRA 4YCNA 4ABYA 4MWCA 1SXPA 1M72A 4GMHA 4RK0A 4C0WA 2JJ2D 4Z4FA 1ZC4A 4EM6A 1HKTA 3ZN1A 4B44A 2ASVA 4JVMA 3STWA 3HKDB 1P2UA 4C3UA 3SEZA 2I91A 3FA2A 3JARA 4ZO9A 4KQXA 2C97A 1S0UA 2BW3B 1V4NA 3DFFA 3PHBE 1XQ1A 3O47A 3NTLA 5BT9A 3U1DA 1D8AA 4ZYZA 3NBUA 4R5HA 1C3EA 1J21A 3LBNA 1CIJA 2J6IA 4EG6A 1AO0A 1WCMJ 3EIUA 1F3LA 1QTIA 3CGWA 4ALKA 5HWSA 4Z6YA 4KACA 1ZYUA 3BQZA 4DSAA 2BEWA 1QKKA 3A1CA 4WSOA 4AN0A 2KW5A 1CXZA 2C29D 3D8HA 3FTDA 2A3RA 4ISCA 1XDBA 3ZY6A 5B7GA 2JA1A 4EAAA 2JN6A 3HRMA 3E7LA 3WTVC 3ZD9A 1GAXA 2L3DA 4EEXA 4BFSA 5KNBD 2PAAA 3CMMA 1E5LA 2AC7A 3FGPA 4KE6A 1BU8A 3P96A 4XR4A 1XVUA 1AGRA 2I8AA 2QT0A 3JQ8B 3PC7A 4RZQA 1QIHA 3EC1A 1U3GA 2GCOA 1WPXA 3ISTA 1UBEA 4IINA 1DLJA 1MNQA 4DQKA 1TK9A 4G9EA 5JSZB 2WV1A 1ZUNA 2QY6A 1E69A 3GA5A 4RK1A 1IOWA 4TS9A 1MA3A 4NAHA 4DLAA 3ANLA 2L0XA 1AB5A 1WRBA 3QODA 1VG8A 1JF8A 1PGNA 1WP9A 2J5KA 3AM4A 4Q9NA 3RO7A 4DIFA 1PFWA 1VTNC 4E03A 4N3CA 5JEEA 4DV1B 1GN8A 4L0CA 2FEKA 3QQ5A 2AL7A 2CVHA 5ECGC 1LJ9A 3EF3A 1O3QA 2VR1A 3QKRA 3RYFA 1FFCA 3HN6A 3TLYA 1PZFA 1DPRA 1OAOC 4HB4A 4CM9A 1E66A 2AKAB 1HZJA 2GCEA 1IGNA 2JAQA 3ECCA 3BIOA 3FOWA 1UELB 3MXTA 3N59A 4JI6B 2LKDA 3U44B 3ORFA 2DN0A 1IZYA 1AY0A 1A5ZA 1NBHA 2ETXA 2PWYA 3LO8A 2JLSA 1WH5A 4L8GA 4F3NA 2I2DA 1TIBA 2CNBA 2VUSA 2Z2ZA 4OGFA 4NENA 3RYIB 4UOZA 1YFHA 1TQHA 1JS1X 1WSAA 1CVRA 3RYRA 1COZA 1Y4ZA 2ET6A 1XTUA 2Z58A 3EXAA 3DCFA 1Z75A 5AH0A 4CCSA 5K3EA 4OHYA 4DDTA 1ODFA 3HXQA 3KC2A 1HDEA 3IJPA 4Z9BA 4QICA 1SQFA 2PS1A 3BEOA 2P5TB 1JGGA 4A4DA 1SXJC 3HCFA 3PZRA 2OBFA 5EZYB 4NJMB 4QFCA 3QU9A 5IG2A 2ZDGA 1IWBB 3NOQA 4IDCA 3VO2A 4QA9A 4BMZA 4DBRA 2QF7A 3IFSA 1ORKA 2OCCH 4HR7A 5HLIA 4R9VA 4WWHA 2F1RA 5F2EA 1OU0A 4AZVA 4DBZA 2O8FB 4CV2A 5BXQC 1Z77A 2R62A 3SBDA 2XCRB 3VPSA 4BX8A 5EVCA 2XDVA 2P9GA 3UENA 3EFOA 3GMSA 3F7MA 2O2EA 1EDEA 2VDWB 3KOMA 4F1KA 4B3RB 3KAJA 3WZMA 5CVJA 2X7XA 4FOPA 1VECA 2PZ8A 1WBDA 1I1HA 3OX2A 4PC6A 1SELA 3FX3A 1JKRC 2DMPA 1XTZA 1HQYE 1NKVA 1G3TA 2MGQA 2VUMJ 1E1QD 1ORDA 3GZ5A 1O94D 1FRVA 1R9GA 1VE1A 2J3MA 2R6ZA 3FVRA 1H8EA 3MGBA 3NYIA 4RX1A 4TV9F 3OWXA 4EMUA 2PR2A 3PFYA 3NP9A 5EIBD 1PJ8A 2ZJ3A 5C8YA 4M0EA 3R7WB 1XKLA 4POAA 5LHIA 2YASA 3L8FA 1GUUA 4FMDB 4HD8A 4F3KA 1YB6A 3THWB 4I3HA 2OQRA 1R8SA 3BWCA 3FZQA 4MCAA 2FSWA 5AJXA 2E21A 4XSVA 1LB2A 2E71A 1BI1A 1HK7A 1QGOA 3L0YA 4GF5A 3CZAA 4WY2A 3IESA 4BU0A 2R7RA 5JY1A 3ZQHA 5HK8A 4JI0B 4TYMA 1NY6A 1ZQ1A 4MW1A 1QVAA 3ZWVA 2BFDA 3MOSA 1Z13A 2EWMA 1N25A 3EQ9A 2BVLA 3R3XA 3VUEA 2ZM6B 2D1FA 4LK1F 2IYXA 2J45A 2OV1A 5EY5B 1KQ9A 3ZNNA 4CMIA 5IVKA 2AZXA 3QV1A 4K3UA 5L6LB 4PX5A 1CR2A 1J25A 4A2PA 2ZJZA 1EDBA 3AJRA 3LIIA 5C2JB 4K88A 4HBZA 2CVOA 2EERA 2QUAA 1N5RA 3DLIA 3IAXA 1PL7A 1F3OA 1VC2A 2J7PD 1B1AA 4XOIA 4I1YA 4OIMA 1RI2A 3BMNB 4EB3A 1HZZA 2QDXA 2QZPA 1F36A 1UJMA 1ZP6A 1L5QA 2LW7A 4KQJA 4UTOA 4AIKA 2QLFA 3WP1B 3MMNA 1KQGA 2P6RA 5A03A 4HQ0A 3FCEA 5FJIA 2V9VA 1ZM3A 3AV3A 2HUPA 1KQPA 4LBVA 4R16A 3ONFA 3HDDA 3QBJA 5LXTA 1VPTA 3N87A 4P93A 5FLXZ 1HR0B 5JNWA 1KQ3A 1GDHA 4DA8A 4RA9B 1VL8A 3PVSA 5A62A 5IS2A 3GP3A 2B21A 1FL9A 2Z83A 4QXQA 3WA7A 2J85A 3BMCA 3ZS9A 4PCLA 5DCUA 2PV7A 3PKJA 4ZI2A 4TYWA 4X91A 2L7ZA 1VQMI 4CCAA 1ZGGA 3A4VA 1KF0A 4FINA 1TD9A 4I01A 4LY3A 3K7AJ 1OH8A 5A6VA 4O2RA 1LX6A 1O95D 1C7QA 2X1MA 2XD4A 5CD1A 1QVUA 3LNQA 4QDKA 1DJNA 1YZNA 4JT9A 5HXAA 3FMPB 5K8CA 5JPDA 1JDNA 2WUFA 2E87A 1XZCA 2X86A 1GKLA 3T8TA 2J31A 2G9VA 2VSXA 5DBGA 1YI8A 3G2HA 3WLRA 4DSTA 4ZTJA 2Y1LA 3HU1A 3V6LA 1C29B 5CNJA 3NC4A 1G5IA 4EPXA 3N07A 1BN7A 3GLFB 2GD2A 3TZCA 1QXSA 1SVMA 2LCIA 2FX3A 4F9TA 3REQB 3E35A 4A3MJ 1HOTA 5CNIA 4MNUA 3V46A 4YUVA 2LR0A 5DT9A 3GJYA 1TYZA 1E59A 3NWJA 4TMVA 4FASD 4Y9TA 3IX7A 3TFQA 3UQZA 5LZ2A 3KQHA 3DZGA 2JVJA 2OTCA 4ZVQA 1EQAA 1P92A 3F5QA 3HUUA 2VJNA 4MIMA 2A5FA 2AHOA 4PHGA 1SFRA 3GRYA 1NKTA 2AW3A 2WOJA 3IJEB 2VASA 1TF7A 5FROA 2IBTA 2PRSA 2A57A 3S5JA 4QRDA 2DJ5A 3A28A 3AEUB 2K9LA 3PRKE 2N1BA 2WAQA 3IRVA 2B7EA 4UNOA 1AT1A 1SZJG 3CLRD 4NZNA 5SY4A 4KE9A 3N53A 3V7CA 1JI8A 2CCJA 4WLOA 5LU9A 3ZVKA 2CS3A 3HU3A 3HJFA 1CYEA 3DPUA 1R6TA 1K8QA 1XXLA 3H9QA 1UIRA 4P86A 4UHKA 4RYLA 1T9DA 2VNAA 1ND5A 4HEJA 4TQGA 1Z2OX 2CBZA 3FI9A 5GP9A 1IIBA 3GF2A 1RP7A 2GHRA 3F6EX 3CPSA 4IVQA 4YUWA 3MIZA 4JP0A 1VQPI 2D1TA 4WZBE 2OOSA 2VCHA 4MH0R 1PNRA 1I3QJ 3G79A 3FPLA 3MGKA 2ODNA 3F72A 3OOEA 5AXDA 1NG1A 1Z21A 2A6EF 2E2JJ 3PUFA 4NUBA 1N0IA 4LVUA 3HTSB 2DLLA 3VSLA 1V5IA 2J3LA 2O0LA 3K8ZA 3QXHA 1MV5A 4XWAA 4Y6PA 3K10A 4ZT2A 3N8HA 3OTWA 5AVQA 2IH2A 1U8BA 3IOEA 2DA6A 4H7PA 4U8GA 2LGJA 1OXUA 2IT1A 5FOVA 1K1EA 1X3WB 3GG9A 3DWLE 4MYCA 5ILOA 5AICA 3IEVA 3GJQA 1ZQ3P 1ITZA 2IU3A 1XTJA 2XMDA 1CS0B 4Z0NA 1IBKB 1SCAA 3MGCA 4LMYA 4LKOA 4AB1A 3ZWDA 3ZY3A 2ZUWA 2D2WA 2G5PA 1A5JA 4HQOA 2N47A 2A35A 3RQ4A 1W1UA 1DCKA 1NE2A 1Q11A 2EWWA 1LFPA 4FUQA 1RM0A 1LDJA 4K28A 3DMDA 4TSFA 4DR5B 2OP1A 3NV7A 1RUOA 1VXRA 4IZ6A 4OHVA 1RPZA 3VVCA 2H06A 4LEIA 3S2FA 5KK1A 1JXAA 5B3SH 2HSZA 4ZYYA 1PQUA 1L5MA 3E0JB 1HDYA 1CRZA 5CT4A 4DWOA 3GCGA 3QRFF 3B1YA 3PWSA 4FZ3A 4RB2C 1YJBA 3FH0A 1SQ0A 3IMEA 5ESRA 3OO1A 3ZU2A 1MNMC 2BMVA 1XMAA 2Y75A 1RQNA 3W6OA 2PVPA 3NGLA 2RQPA 3MSCA 3C7DB 3UFXB 4D96A 1LDBA 1N1EA 5HBGA 3W3ZB 4Z7QB 3MHTA 4X24A 5KYXB 1THZA 3GAAA 1Q0HA 3QF4A 4LDRA 1BDBA 2GARA 2HJRA 2QN9A 4NU6A 1W36C 3WJ7A 1HLGA 1UDRA 4J2HA 4A3GJ 3GFBA 2HKIA 4HN4B 5CP8A 2VQLA 4AXXA 4MARA 2XKJE 1J39A 2G7MC 4XDZA 2ST1A 2Q5JA 5DTDA 5THQA 3H19A 2Q1WA 1UIMA 4HUJA 2ZU6A 3IRQA 2HRCA 2XE7A 2WM9B 3K0KA 1AKEA 1C0PA 4KSBA 2W7NA 4A5MA 4EOGA 4Y6QA 4FD2A 5IJXA 4NFHA 3IPRA 2EFHB 4IQ0A 1GGJA 2CYAA 4FDLA 3PE3A 5A5VA 5K99A 1K9SA 3PE4A 3OPNA 1TFUA 3SHQA 4ZO6A 3K2IA 4J4HA 4OXKA 3URMA 3HJGA 3IQWA 3ZHSA 5BMZA 2FOLA 3HGMA 3L7KA 1LU9A 2FQ3A 1SMYF 3V7FA 2DGDA 1MJ9A 1I7NA 1KEVA 1Q7RA 1CDEA 3FROA 1DJLA 5GJVC 3IE0A 2DMUA 4PVDA 5ESDA 4BQRA 4LYAA 3IVRA 3OHSX 3DM5A 3QVUA 5L8VA 2B3DA 4YT8A 2VQEB 2C4VA 4W8GA 4O5VA 2P65A 1A2KC 3D64A 4JEUA 5DDIP 3SEAA 3WL8A 4EGQA 5A4JA 4V0RA 5DNEA 4IDAA 4LK2A 2X9LA 4JU8A 3BPXA 3AHGA 3GNQA 1L8AA 4L5CA 5KYYB 2HU5A 1O77A 2P9HA 2BP7B 2C1ZA 2UZIR 3EUFA 4YT5A 5BQPA 4X66B 4JJ7A 2CCGA 4LIUA 4LF9B 3FSGA 5TRDA 1EUQA 2AR9A 3IIIA 3QWAA 4NE2A 2IKQA 4R8VA 5D3MB 1OD6A 4FB5A 5DCFA 5FHRA 1LXCA 1E8NA 1S2DA 2FSVC 4MRRA 1GGNA 1L3BA 4R2WA 5JI3E 3VZBA 1Q57A 2HOQA 3BC1A 4EHNA 4Z3KA 3DBIA 4EPTA 4PK4A 1TECE 4MS3A 1GZ3A 1DXHA 3A4TA 3DTVB 4C6TB 3QFSA 4IGFA 2XTZA 5KSYA 2D2VA 3OYAA 1LV8A 2BTQB 5C7IO 4ETIA 5JVDA 1U8UA 1D6NA 2FGJA 3RQIA 4FZ5A 4CKEB 3UC9A 4CEIB 4GOND 3F6PA 2OUMA 2DYRH 4ROTA 1GQSA 2L7FP 1JJ6C 1Y4DE 3QXJA 4U9HS 4UJ5A 2YR2A 1UL1X 4W97A 5FLMJ 3DV8A 2C84A 2PZGA 3NUGA 4W9NA 5KYUA 2K9SA 4JENA 1G6HA 4P08A 5CBPA 4ASUD 2K86A 3WLEA 4A93J 2FWBA 5J2UF 3PDIA 2HZDA 1P29A 1Z4IA 4CI0B 3CBGA 5B7PA 3EYWA 3Q8XB 1HG0A 5JBIA 3FFTA 4AZ3A 1XLTC 2F1KA 5D87A 5I7VA 3A2KA 1NNSA 1GZSA 2FZGA 4ER5A 1NG9A 5E1DA 3GP8A 4FCWA 1E20A 1I94B 4UU7A 2VBWA 1USUA 1V45E 3DBHA 3TLGA 3VU9B 4A1FA 4BCDA 4F86A 1ID8A 4GEKA 2Z1DA 1EEHA 1LPSA 4GI5A 4H08A 4O33A 4O2BB 2OO5A 4UARA 3ZCOA 4AC0A 1A9PA 2P4UA 2F1JA 3OTQA 1Z82A 4WLVA 3FPEA 4ACBA 1UBHS 1KJWA 2YBDA 2R6GA 4EYKA 1Q20A 2JGKA 2WJPA 3WGGA 3HQ4O 4MCHA 3MZ8A 1YZ3A 2CL0X 2GKGA 1YH3A 2CUFA 3RWBA 1I2ZA 3A06A 4HLNA 1YUMA 4PPFA 4X1IA 4UDXX 4WVLA 3RRXA 3EGXB 2JA7J 3JATB 4EVQA 2OXIA 2WLSA 2C4WA 3L2VA 1EE1A 1NYRA 1XSVA 2WM8A 4OWRB 2AHRA 3ANNA 3NTQA 4UHBA 1JXSA 3TUIC 1SVUA 3OICA 2KB0A 3RSNA 1NU6A 4KVFA 1X7YA 5E8IA 1XCGB 2GZSA 3WS7A 4AY6A 3NU1A 2V1DA 4KMFA 3C4JA 4JBNA 2P69A 5HKOA 1T95A 1G5PA 1XTQA 2IW1A 5A5EA 2A59A 3OYDA 3MKZA 1TB4A 1XA3A 3ENVA 3HDVA 5AHKA 3TECE 2XYVA 5LLTA 3EPLA 1IRGA 1DC3A 4LF6B 3O9VA 4MUEA 1IN5A 3IQZA 3LVRE 2FCRA 2Z2KA 2KBEA 3J80K 1ZW1A 3P4UA 1UPUA 2B36A 3IH2A 3FI0A 3OJWA 4FFDA 2D62A 1LUJB 4IZHA 3RBAA 2XDQA 1TUEA 2UZ3A 4YAOA 4QTXA 1QYRA 4H6WA 3U4DA 3VH1A 1DAFA 1XMXA 1OCOH 2DKNA 2WF9A 2O54A 3C5WP 2BSAA 2K27A 2I22A 1OAOA 2HZ7A 5BW5A 2GCNA 5TARA 1YQTA 3H4MA 3RSCA 4WOJA 4DARA 3HB5X 4JGBA 3L9WA 3OQBA 5BSKA 3ICQB 2K4BA 5J47A 3LFKA 5FKNA 1EB8A 3HA2A 4XL9A 2R47A 5COQA 1JXQA 4MPPA 5CTJA 8ADHA 3I9LA 1KE2A 2W71A 4KGVA 4G0YA 2MFZA 1IBLB 3ABOB 1SQGA 4LIPD 3SC4A 4QELA 4B48A 3VZCA 5LA6A 1RLJA 3CJQA 4D8TA 1FLIA 1EE2A 2VCEA 1BH6A 3LECA 4FS3A 4GOKA 1NVVR 2RHCA 2PX5A 5CU7A 4B6GA 4XCVA 4QQRA 3HEMA 3WHPA 3G1WA 2ZRPA 3U4IA 1GGKA 1JHMA 2ZBRA 1NUSA 3DCJA 5D2CA 2PXCA 2H3HA 2V5VA 3PEYA 1U6KA 1NP6A 2P7IA 5EE3A 2GYVA 1XK6A 4LRYA 3OL3A 2CZGA 1I8TA 1KFCB 1TOAA 2JJ1A 3B5JA 3GQVA 4NZYA 1C2TA 2GM4A 3AHJA 3L7CA 4TKUB 3UMJA 2JKYA 1N0VC 3ZU3A 2ZPAA 2HRRA 4L18B 1WKCA 4KUEA 4ARBA 1RNLA 3KJEA 5AD1A 3ZNPA 4RDIA 5HS6A 2QT1A 4P4SB 1HQCA 1DC6A 2V0CA 4YP5A 5H4GA 4MDEA 1S96A 3SGLA 1PZEA 2WIDA 2W42A 4GLFA 4CWAA 4LXYA 2KJCA 3DU5A 2O8VA 2Z2IA 5CLIA 4NCKA 3LUPA 1EBFA 1EFUA 1XGSA 1YR6A 5HUJA 3BTLA 2AH5A 4K6HA 4MPTA 1Z0FA 3PZBA 4YWJA 2CSOA 1EGAA 4MVJH 3ZHZA 2HMUA 3RK1A 1KAGA 5IFKA 3BQNB 2PMFA 2JQ7A 1C4KA 5AK6A 4H59A 3RC1A 2P2GA 1JG3A 4BO4A 1RZRA 2R0QC 3EY4A 1R4NA 4I2NA 1KYVA 1W59A 1LFBA 2O2IA 3TZKA 2GM9A 1OI4A 3UAOA 4FN4A 3VR1A 2YWRA 4C4TA 3C48A 1TC2A 2VHYA 4O4JA 4WJZA 2IIVA 5FBQB 4AY5A 3L8GA 1THTA 3WY9A 3EC7A 4PY2A 4A3SA 5DNVA 4D3SA 4BNWA 4GVPA 4YAEA 4KUMA 5BV2P 3VNBA 4IEFB 3L7JA 1D4FA 2QN7A 1D5YA 1X4OA 1YZFA 2B98A 1A0OA 2H57A 3H7IA 3WBFA 4YMLA 4AP5A 1ETXA 4IJAA 1G2HA 1XEWX 2IZ6A 3OTGA 4EVSA 4E6PA 1JIUA 1TGVA 1P4WA 3L18A 4IIDA 3IERA 5FPTA 1X1QA 2Y9MB 2JLZA 1WQ1R 1XMOB 2R4TA 1JUMA 3IP9A 5E3MA 3DFIA 3DT6A 4RIFA 3RUDA 3WDMA 1XZBA 4YRQA 1DBQA 5BSTA 4G25A 4OD0A 2E4YA 3ROPA 1E2EA 1FB5A 1XJQA 3ECHA 3AVOA 1VQLI 1Q83A 2QAIA 3KJGA 5TGZA 2NT3A 4KHZA 1Z5GA 4IFEA 1RTKA 1CZRA 4CYCB 1LJUA 1JQ5A 4JJZA 1U2PA 3HBFA 3W4IA 4EENA 3VPGA 1SEUA 4IO9F 5FFMA 1VZ0A 1NR5A 3B6IA 3DL7A 4N4AA 5DYGA 4IW3B 3CISA 2GO7A 5H3LA 3WL3A 3BJAA 3A6HA 1CFJA 3EFBA 4BZQA 4RTQA 4C7VA 1U0EA 4BVGA 4GRDA 5CLJA 4K81B 3DE1X 3IHUA 3HCPA 3K4QA 3F8FA 1OCCH 4CL8A 4UTRA 4FR2A 2A94A 2MYUA 1OKKD 1G6KA 4YJ3F 2BONA 2HI3A 5L3CA 2XSZD 3SYTA 1MJGM 2SKCA 2BDTA 3O8QA 1M2OB 3F6SA 2RH5A 3JYOA 4MRVA 3SE7A 3V8RA 2JZOA 4YS6A 5JCJA 3JYLA 3T61A 2DSTA 1LQ1A 1RZ4A 1NJ2A 2YHUA 1H2YA 2DTZA 4J01A 1AZLA 1GJRA 1ZMBA 3EF1A 3NANA 5H3CA 5IT9K 3COJA 2XVAA 3UUEA 3OUZA 4TMFA 1Z88A 1DIGA 4ENVA 2PUVA 1QG2A 4X41A 2Y4OA 2FU5C 4AIIA 5BMVF 1EH8A 4WZAE 3EUHC 1DKUA 4IHXA 1X1SA 1SCUB 3GGSA 2C95A 3OT5A 4NHOA 4Q9IA 3R4KA 1YVPA 3OZIA 4XORA 4FZJA 3T5MA 4CICA 4Q4HB 1FRZA 3FD8A 1A1VA 3ZW8A 4OIFA 4R7TA 1G17A 2AJDA 2H8KA 4LLLA 3B38A 5DK6A 2J3KA 3OPYI 5B57C 4BE7B 4PSDA 2OO3A 4CHUA 1J2RA 5JO9A 2QQEA 2H5LA 3BN3A 4P2GA 1PZGA 3B7PA 3L0IB 4ENQA 3OR1C 1VDZA 3HYRA 4O1IA 1RZRD 5DHUA 4M3GA 2OBYA 4EAQA 4HAOA 4HO1X 3STTA 4IHKA 5CCEA 5JS1A 1LPQA 3KD3A 3UCXA 4L02A 2BR4A 4NB5A 1GARA 4WXMA 3V4PB 5F7OA 1ITYA 1N8KA 1OROA 3BMOB 4CCNA 3I6MA 3JD4A 1N57A 2IYOA 3RJMA 3CUQB 2H2AA 1U9JA 2OD5A 1VJGA 2BFEA 1YB5A 2QJFA 2A0YA 2TYSB 2HCTA 3NDPA 1Y4SA 3X2EA 2HNBA 1N3LA 2C59A 3AT1A 4ME6A 3EPHA 1MOSA 1YMVA 1Y6QA 3ZCRA 5FGMA 1RJ9A 1QP4A 3N4MA 1KVRA 1TQDA 1TLLA 1W30A 3N7UA 4CT4B 3FPFA 2BY2A 2FSPA 3NHJA 3SIXA 4TV7A 2DR2A 3E70C 4RLFA 4H6PA 3DQZA 1YVRA 1Y3FE 3GLIA 1S3FA 1MORA 4A3LJ 1JPVA 3ESRA 4LRWA 3KAKA 4O4HF 3NR2A 5LEKA 3VZSA 3IQIX 5J59A 3TPFA 3TXYA 2LD4A 3WLAA 5I8WA 3WLOA 4DREA 2IYTA 3E9NA 3ROQA 4O59O 4NNJA 1HURA 4JXKA 4HAUA 3M8JA 2JC3A 4UEQA 2PZFA 3OMXA 4K6MA 4QLAA 4F91B 1RM3A 3USES 3WX0A 5JMTA 4QXMA 1UC8A 3O4VA 3LXRA 3DG9A 4FKBA 5DMHA 3DTIA 4Y0VA 5F76A 2VC1A 5K0LA 4AO8A 4M8SA 3R9IA 4AYXA 4BGVA 4C89A 1WY5A 5KEIA 3HL4A 1YGYA 2CNKA 4NCBA 2WAYA 2EFGA 3BK2A 3L3BA 1S5LC 2LOOA 1ORHA 3BREA 3D8NA 4WCDA 3BAZA 4EGZA 3TW0A 3L8HA 2XPCA 1I4WA 3RD5A 3EVAA 4LV6A 3RG8A 1ZR4A 2FMIA 3P0IA 1E3DA 3WBJA 3GMEA 3ZTWA 3ZWAA 1XGNA 4NXMB 3QEBZ 5TMPA 1U7PA 2R4QA 4A3KJ 3C3DA 1K66A 2VC2B 5DD4A 2P0EA 3EIXA 3W5HA 2VK1A 2FXAA 3WLLA 5CA1F 3MZYA 2YIMA 3CCRI 3VPAA 1RYZA 5KSZA 4C7OB 1IC6A 3E9YA 1KORA 4RVSA 4KR7A 5EJ8A 3ZP5A 2EKPA 3UHAA 4QVGA 1O0BA 3DE0X 3RUAA 2NO1A 2AVNA 1L1EA 1P1JA 2IOHA 1QP0A 3OT1A 3O1HB 1S7OA 3OC0A 4OLBA 3P0HA 4KR3A 3DS8A 2P6MA 4ZVPA 3A9SA 3RRMA 4UAGA 3X44A 3ROUA 3R2JA 3VDXA 3ZD6A 1ZVKA 1W44A 2VRBA 3AF0A 2UYYA 4NU8X 2XWSA 1DS6A 2AMLA 3KB2A 4TV8F 1IN6A 4KA4A 2WG0A 1TU0A 3TLAA 3IRUA 4O5OA 3WLKX 2HS5A 1LI5A 1PS8A 2GN0A 3E9RA 3HVHA 4IFIA 4CT0A 1J0AA 1GHTA 1U5BB 2HDDA 1L5HB 3MRSA 4C04A 4C5AA 3VH4A 4B47A 4D9NA 1VQOI 2Y2VA 1GV2A 4IOCF 2DA1A 4IF4A 1Q92A 3T52A 1VM6A 5ITZB 5J3JA 3P7MA 4F3TA 2WU3A 4G36A 5IM4A 2GM3A 2QQ9A 2CFRA 3KVVA 3TL2A 1WV1A 2IA2A 2JGMA 2L69A 2XUFA 3C5CA 3SK0A 3T9EA 3UAGA 2DQ4A 3ZWPA 3W9BA 5KDOA 2OCXA 4AG6A 5DM1A 3GTPJ 1WJGA 1ISJA 1VJRA 4Z49A 5AK4A 4XOUA 2FEAA 3HL2A 1V8BA 2BI7A 3COPA 4QEDA 1OILA 3O0DA 2AJLI 4TT3D 3IUNA 4I50A 5CAEB 3U17A 1OFGA 3KAPA 4CG1A 1XN1A 3ASVA 1H9BA 3FFXA 3CEMA 4J0KA 4D4HA 4B9EA 3OLZA 4D4LA 1X74A 2UVPB 4F5YA 3RJPA 4QO7A 1JA0A