4EVNA

Crystal structure of fab cr6261 (somatic heavy chain with germline-reverted light chain)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
221
Chain Sequence
QVQLVESGAEVKKPGSSVKVSCKASGGPFRSYAISWVRQAPGQGPEWMGGIIPIFGTTKYAPKFQGRVTITADDFAGTVYMELSSLRSEDTAMYYCAKHMGYQVRETMDVWGKGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab Heavy Chain
publication title Structural and genetic basis for development of broadly neutralizing influenza antibodies.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 221
sequence length 221
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2012-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4evnA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4evnA01
5LCVH 1FNAA 3TVMB 3AVEA 3FO9B 3O8XA 1PG7X 4MAYD 3UTPE 2X4UB 4S1QL 2V9QA 4EI5A 1DEEB 1MIML 3O6KL 4EUPA 2P44B 3EOTH 1NMBL 1MQKL 5CUSH 3QFDB 4N0YL 3FT2B 2XN9B 1KCSH 2DQJL 3KPRE 2BY0A 3B4NA 1XF4B 3DXAB 3O4OB 5HI5C 5LGKA 4TUJB 2VLKE 1G9NH 1FGVH 1QEWA 3VFRA 3GJFK 4P9ML 4R7NB 1GZPA 4HMCA 1T0NA 5CEXA 2OMNA 3M17B 4U31A 4NC1C 3VDAA 5ESAB 1KV3A 1CXEA 3MACH 4QRRB 1YECH 4Z7OE 3PNWB 4PLKC 5ENWB 5E70A 2XTJE 4HKZB 2BNRA 3MRIB 3QI9A 3KJ4B 4NNXA 2VC2H 2VE6B 3NFSL 4LFHD 2X4TA 4MQ7A 3WNLA 3HZYA 4PJEE 2CMRH 2P7TB 4M48H 4G43A 2A6JB 3P9LB 5HVHB 2JJVA 3BH9A 3FRUA 3ZE2E 2DI8A 4J4PA 4Z0BL 1KTKE 2YPLD 4DGVH 1AQDA 1RFDH 2WBWB 3NBNA 3AB0C 4BK5A 2KBGA 4V1DE 4Z7QE 1MCBA 1CXIA 1OCWL 2VDQL 1HZHH 1KB9K 5C71A 4Y4KD 4BH8B 4DWHA 1FN4A 1A1OB 3H0TB 4HCRL 4JR9L 3U6RB 4LIQH 3UTPD 4KRPD 4H26B 4ZTOL 1PZUB 3QFJA 4ODUA 2YBRA 4QO1A 5F6IB 5ITBL 2VB5A 1MJ8L 4EVNB 2VH5H 3PWJB 4P9HC 3CX5K 5E6ID 3DJ9A 4HUXB 3TBSB 1MFEL 3RDTC 5J12B 2WSKA 4HWZB 5E2VH 4P5KA 3NPSC 2QEJA 5EUOA 5I30H 3P0YL 2VLKD 3L3HB 3GM8A 3VXUA 3WDIA 4I48B 2QLVB 5EOTB 1WF5A 3OB0K 2CKBH 4Y2DB 2FD6H 4GBXD 2X7LB 4KDTC 5LGHH 5IMLA 5JXAL 4LRNH 3UC0L 2XTJD 4P57A 1P6FA 2OI9B 2X70B 3OAUH 3MODH 1EXUB 2X89D 4P2RA 5ACZA 3PE9A 5C86A 4O2FB 3V52H 5LXGH 4YPGA 3ARBC 5CMAB 4XBGB 4K94C 4ZQKA 1UJTA 1FNGA 4L29A 2C3GA 4LSQL 5EWIH 3H9SB 3CSPA 3EO9L 4DN3L 2CXKA 5F97E 2AJSL 4XB8A 3GKZA 4JE4B 3TV3L 4JDVB 1FLRL 1GHFH 3BEVB 5KVMC 1QKZH 4UV7L 1YMME 5GHWH 2X4OA 2D31A 5D7JD 3TPUB 2XY1A 1DLHA 5IB3A 3EFFA 1ZLVH 3BJLA 5KSVB 4M5YH 1ZHKB 2L7JA 4V1DD 5IB4A 1FPTH 1UEYA 3TBVB 5CJ8A 4XCYA 3K2UL 4N90D 3VFUB 4Y5YC 3JUZA 4F7MB 1C5DB 2G2RA 2CK2A 1MH5B 4NO3B 5A2FA 3SGDI 4NO2A 4XGZA 5CILH 1R3JA 3QHFL 3TIDB 1DZBA 4QRSB 1WBZB 3FOMB 3GFUA 3BWAB 1TJHH 4UNUA 5F9WC 4JO3H 4KI5E 3B2UD 2YD5A 1UXSB 3OHXB 3CFDB 1KENH 5GGSB 3ULVL 2YPKB 4Q6IA 4LASH 3MXVL 4NZUL 5C0EA 2R1XA 4Y8AA 4LF3B 4WFEE 5FGSA 1II4E 2ID5A 4XAKD 5ETUA 5HGBB 2W9LA 4L9LA 3VXOB 1KPVB 1EHXA 4OIIH 5BZDB 4QRTA 3CZJA 4LLWB 3ZDXF 4XTRD 1MPAL 3V0WH 4MXVE 2ERJC 5EBGA 3P9MB 1BBDH 3PL6D 3QDMA 3QDGB 4QKXB 2OM5A 2LTQC 1A6AB 4JFHE 3BP4A 4CMHB 3TCLB 4QRPB 5D72H 4OZ4A 3RY5A 3ARTA 1QACA 4HBCL 3RNQB 3B9KD 3T65A 4HXAH 4ZPTA 4GRWE 5HBBA 2P8MA 1K6QL 1YMMD 2BK8A 2FX8L 2IBGA 4XCNB 1TQCC 3CVHA 5JXEC 4IRZH 3QEHB 4X6BA 3W39B 2O61A 4M7LL 4LSRH 2GFBB 1YJDC 1MWAL 2AJ3A 3DOSA 5B38A 2FIKB 3VJ6A 1KLGA 2H9GB 1OAUL 4O9HL 4EN3D 5ID1B 1FO0H 2CLVB 4NT6A 3GK8L 1DQJA 1UWGH 4LVEA 2UWEE 1J86A 4GT7A 3V4VH 4KQ4L 4JZJC 3CFEA 1U58A 4F58H 1YNKL 1I8KB 3GB7B 3LCYA 1L0YA 1F4YL 1S7QB 1Z2KA 4UQ2B 2A6IB 4QYOB 3IAGC 1ZANH 5IGXL 1BIIA 1TPXC 2UUDK 3UJJL 4JFOA 4MNHA 4WFED 4DFIA 5FCUL 3WHXA 5I73B 1MFCH 1F5WA 2EEAA 1CGYA 2QHRL 4XZUA 4GW1A 5F96H 3ARFC 2HFEA 1KIPB 3OXSA 3CC5A 1N2RB 1E0OB 3QI9C 1CR9L 4PV9B 1HK6A 1BFOB 2R29H 4JFHD 3GUTB 1OQOA 1MCQA 1I7UA 1ZKAA 5LQBH 1YEKH 2IC2A 2FSEB 1EH9A 3IDGB 4R97B 4WDIA 1CXKA 4NZTH 2B2XL 2IMNA 1K8DA 5SWSE 5EO9A 1N6QH 3HUJE 3O41B 4X7SH 5LGJB 2NW2A 3ZE0E 1AIFB 1XR8B 4J4PC 3VG0L 1AXTH 1WSST 5D7KE 1DQQB 3ZTJG 4QRQA 4KROD 4OF5A 4UDUB 4MGXA 3GIVA 4M7LT 2MPAL 1CBVL 4TVSa 3KYNA 2Q8BH 1TCRA 1J1XH 4Y4FB 3GJEB 1OAXH 4NQXA 5D4QA 5K93A 4LSUL 3HE6A 1DQTA 5J11C 1VGKA 1G7HA 2YEZB 3VFVB 1X6NA 5TDNA 5AZEL 3SDYL 4R0LB 4JFFB 2HJKB 1N3NA 3FFCD 3MV01 1I1FA 3MRBA 4M1GH 5I17B 2XWTA 4E5XB 2DF3A 4JRXD 3MREA 1ZLWK 1BFSA 2R1WB 3LQAL 4LLAA 4LCUA 1ZS8B 4Q9BA 5E9DD 4X6FA 4S1QH 3HRZA 3TYGH 1GC1C 4U6XB 4WHCA 3MRHB 1CFSB 1T3FA 3VWJD 1MNUH 4CJ0A 4X7EC 3S35L 2EEDA 2JJSA 2YD9A 4GG6E 3OKKB 2IPKA 4N0YH 2EDOA 5MERB 3ZKMD 2DQJH 1RZIB 4XB7A 3WE6B 5KTEL 1X6LA 2GY5A 2P5ED 3N1PC 4AZ8A 4GKZA 4LCWA 5EOCJ 5D7IA 5LWYL 4JB9L 5JOEA 1OTSC 1S7VB 4PGDB 4P9MH 2HVKA 5D1XA 1HDMA 2R2HB 3KXFA 4HIEB 3FB6B 4D9QE 4HJ0C 1TLKA 3A6OA 5KOVC 5IK3B 4PB9L 3K81A 5EOCL 1FVCA 3WKML 2OK0H 2EDRA 4ZUUB 1B2WL 1R3LB 2AKRA 2OXHA 4R2GB 3NFSH 3RL1A 3JWDH 1S7SA 1C8PA 5D7KD 5KN5A 1NMCC 4X6DF 1MHEA 2IBZY 1RJLA 3UTQA 1WBYB 3HZKB 5CGTA 1G6RL 1MCDA 2JCCB 4NZRL 3UROR 3FMGL 5K9KA 3QNZA 1IZJA 2I60L 1FNHA 1IAIM 1OCWH 3EYFB 3SJVE 1K3ZA 2GTWA 1VB9A 3H6JA 1PX4A 2QTEA 2D7OA 5B39A 2EE3A 5IQ7H 2EXWC 4MJ5A 1AR2A 2CIKB 2NXZB 4HUKB 2R69L 4HCRH 1BREA 3RGVB 4Q6IC 4X0KA 4ZTOH 1RURH 2X4SB 4MJIB 5F89A 1J8KA 1QRND 5ITBH 1ZVHA 1MJ8H 2Z92B 4L9LC 5ICXB 3GMOA 1U9KA 3HR6A 4YBQC 1TJIL 1MFEH 4YXKL 2GAZB 4GLRI 4PJGE 1BEYL 4YO0A 4MHHI 5D8JH 3P0YH 3S97C 2B5IB 3RX7A 4XHQA 3UZVB 1I8MB 2EYSA 1S7UB 2V5RA 5A2IH 3TJEL 3ZKND 4LNVA 1JPFA 5DJZB 5IBTL 3MRJA 5IHUL 4QLRA 4HIIA 1N8ZB 3JV6A 4KKBD 5B8CB 5JXAH 5EC1B 2K9UA 3UC0H 3RPIA 1YN6A 1IAIL 1FNLA 4AIXA 1EAPB 3PWUA 4RMWA 4IJ3B 3DVGA 4XP4L 2IPUG 3L1OH 1B0RB 3VRJB 4U7KA 2GITA 5D5MA 4WFGE 4HX1A 5E4IA 1T5WB 1QA9B 3TM6A 2LU3A 4BQ6A 4FA8A 5J9PA 4DN3H 2AJSH 1HIML 4WWKD 3I6GA 3TV3H 4YHKL 1FLRH 5I1GL 3C08H 2QQQA 4UV7H 4OLVL 4XVUC 4XMLH 5LJYH 1CU4L 3BPOB 4O02L 1FH5L 3EAKA 4ZSOA 3SJVD 4QNPE 1CXHA 2G9HB 4RDQF 5F1IB 3U0WL 3K2UH 1G7PB 1QFWM 4MAYB 3EOYG 2ATPB 1VEOA 5I8EA 3QH3B 1PAMA 5TGBA 4WO4D 4MMXC 2E6JA 2QSTA 2DLIA 2D9QB 3BGFC 4U6YB 2CK0L 3GIZL 4LHUB 1CG9B 2R0LL 3HMXH 1JTTA 5FFLA 5IMKB 4LAJH 2Z9TA 4Q9CA 1RK1A 2FJFB 5FB8A 1PKQE 3OKOA 2DM7A 3BKYL 1AJ7L 1HHHB 2PXYB 3WS3A 1B9ZA 4U3XA 5D2LF 1VGEL 2CLRA 4Z7VB 4C83A 4AT6B 1JNJA 4HT1H 1BJ8A 3MXVH 4NZUH 2V2XB 2B1HL 3VMOA 2FHCA 5C6TL 2YRZA 5AAMA 1WC7B 3HZVB 2WINA 3JV4B 4LHUG 5E4EC 4C59B 3QXTA 4F9LC 1QOKA 5DURD 1WVZA 4WEMB 5DJ0A 4FXLA 1U36A 2AJVL 2C9AA 2BVEA 7FABL 3P4NB 1QSVA 3ARGB 3KLAA 1MPAH 1A6ZB 4J8RA 4BJLA 4OLWL 4ZNEA 4NYLB 2IAMC 2YZ1A 3MLWL 1SEBB 5GZNC 1I7ZB 4FFYL 1KNOB 1QFWL 4L4VE 3MV7E 1A0QH 1VFOA 2IH1A 3L9RA 4HBCH 5MHSD 4AL8H 5DJ8A 5E6ZA 3UTTE 3D3VD 2VRAA 3RUGF 2DQCL 3W2DH 4LARL 4KKCD 3EO1A 2FX8H 1DANU 2JF1A 3HE6C 4L8BB 5I18L 3CXHJ 1YEJH 5I1LA 1BVZA 4PV8A 1MWAH 3VD7A 1U3HD 3F8UB 3QUML 2SEBA 3R8QA 3FONB 1OGTB 1JJUA 5DVLA 3VU2A 2BY2A 1OAUH 1RIVL 4NP4H 4FS0A 2VISA 1DDHB 1NKOA 4PJAA 3GK8H 3VFMB 1JHLL 4ZAKD 4QOKE 5FYJE 4CN1A 4MYWB 1QRKA 5IFJB 3VRLF 4MNQD 4MDJB 1CDHA 5C0GA 4KQ4H 3AUVA 3KJ6L 5B4MD 1YNKH 2XZQL 2VLJD 4JO1L 1F4YH 5KVFH 1I3RA 1A6UL 3D85A 4D0CA 2ZCLL 3SDAD 2PO6D 5HHNB 3NH7H 4X6CA 5IGXH 5K9QI 4RBPH 1GGCL 5FYKL 4GBXB 5FCUH 4JGUA 4XNUH 1WFOA 2JB5H 1MRFL 1MY7A 2VJXA 1NJ9B 5CBAB 4L3CA 1U2CA 2QHRH 1T5XA 6FABL 3BGMA 4L8SB 3NZHH 3O45A 5DSCA 4NBXB 5T5FL 3RI5F 3P11H 5ILTL 5BRZE 1ZA3B 2EKSB 2NCMA 1FCCA 1I7RA 1L6ZA 4ZS7L 4ONHA 3QIUA 2AK4A 5ALCL 1Q9OA 5D7LE 1CFTA 5BOPA 5DC4B 1PZ5B 2P5WE 3VGGA 4WY7H 3S7GA 5T1MB 1F58H 5FM8A 5D7JB 4NPYA 1RSFA 3LDBB 1ZSDA 1AKJD 5CGYC 3VG0H 1R5VA 1S78D 4Z7UF 1NFDE 5DRWA 2Q6WA 4QXGL 2BVQA 4LCCB 4KFZC 5HI5D 1B0WA 1NBYA 1A6PA 1AP2A 2AVGA 3BKJL 2AABL 3EFDL 3P4LA 3B2VL 3FQUB 3BP7A 4LSUH 3MCLL 5JA9A 3RKDC 5GGRY 5AUMA 4P46A 1ZT1A 3MNWA 2HRPL 4KDVA 4PLKD 4TNVF 4NNYA 1INEL 5AZEH 3CFKA 4JPVL 1FZOB 5C0BE 3G5XA 3C5SB 3H7BB 5IWLA 4G6JL 4KI1A 3RWCA 1U8OA 3ZHLA 4RGNC 4ODBD 3LQAH 2H32H 4RQQA 3PWLB 5INDA 5C6WH 4AG4L 8CGTA 2V5TA 2F58L 3DI2B 3X13A 1MI5A 4OCSL 3HI1B 3KYAA 3GJFB 5T1KA 3U79A 3DX6B 1YYMH 3ULVC 2MCG1 2BHZA 4Y19A 1YPZF 1EHAA 4IMKA 1X5IA 4XP9L 2OSLA 4H5SB 5KTEH 2F54A 3H8NA 1HKFA 5BRZD 2EDJA 1BD2A 3KPSA 1T04A 3B6SB 1BZ7B 1F4AA 1M05A 1CCZA 3VRIA 3P9WB 4JB9H 3FRPG 5LWYH 4JCLA 4CVXB 4ONGL 2ZPKL 4EOWL 5I8OL 1NMAL 4IHOB 4CVUA 1S9VB 3B9KB 4KHTL 5D7LD 4DK6A 4HIXL 4XWGL 5I15L 3SE9L 1H3VA 5I1EL 1LEIB 5E99L 4WI4A 1XGPA 5FUZL 1Q72L 3S36X 4OLUL 1YNTB 4K71C 4U1NA 3AAZA 5EOCH 3IVKA 2VAAA 3T8XB 4E0RB 4HSQA 1HNFA 4OFVA 5C0JB 2V7NB 1B2WH 3SDXF 3RDTD 1JNHB 1AY1H 1JHTB 3DARA 3GMMA 1MFBL 4UI2A 1T7XA 2YD1A 1RIHL 2W0FB 4N8VA 1Q0YL 4EN3B 2X4NB 1VADA 1DBBH 4OKDA 3RAJL 1VENA 4ZUSA 3HLAA 3TA3D 3EYSL 1G6RH 3BOVA 5INCB 3VGBA 1AGDB 3O6FA 3ARXA 2HN7B 4NZRH 3OGCB 3EYVB 3UPRB 3FMGH 4S2SA 5HGHA 5EOQL 4JHWH 3OKMA 3O0RL 3F5WA 5C0BD 2ZOLB 1FJ1B 4D0BA 4DKFH 2ED9A 1BVKA 2VDNL 4PJDB 4AEFA 5ANMB 4GAFB 5A16A 1OAQL 4K8RH 1AO7A 2R69H 3ROLB 1X5XA 1TTGA 3NCFB 3X12A 1FLTX 1PSKL 1H3XA 2DYPB 4XC3H 1IGJA 4CN4A 2XIDA 3L3IB 3RWEB 4P2CG 3CCHB 5HGAA 1J8HB 3OX8B 5C9JA 4L3AA 5ESVB 1QD0A 5I76A 3HS0A 4Z7OF 1OL0A 1M7IA 1TJIH 4YXKH 2XWBB 4PRAB 1BEYH 4ZOEA 1LO5A 5GRVK 2D4DA 1FORL 1U8IA 3C6LC 4IOSD 2HT3D 3P0GB 2J88L 1J87A 3ES6B 4PJEF 2BVPA 4FABL 2BCKA 2RQ8A 5HVGB 3TJEH 5T1LA 3BI9X 3MJ9H 4ORGB 5BV7H 2HLAB 2VL5A 2YD3A 2J4WH 1NAMA 3ZE2F 2VZ1A 3VXRA 2ITDB 1V8HA 3KPNA 1WJ3A 1IAIH 3K80A 5EO0B 5CAYB 1ETZB 3EYOA 3V2AR 1P9MA 4XP4H 4KROB 4Z7QF 3BJ91 4YGVA 2AK1H 25C8L 5F70A 4JFEE 1IKFL 1AD9B 4HXBL 2MMXA 32C2B 4YQXL 2GI7A 1F6LL 1FYHB 1HIMH 3HKFA 2Z93B 3OJVC 4YHKH 3TIEA 5I1GH 4R4BB 4MD0A 3RIAK 4OLVH 1LE5A 4MJ4A 4RIRA 3ARQA 5I1CH 3U2SB 1XIWA 3MYJB 1KCRL 4O02H 1FH5H 2CLZA 3FFCB 1ZGLB 5IW1A 3I02A 3J7HA 3U4BL 2NW3A 4JRXB 4O51B 4R4NC 2BVUA 3U0WH 1MCLA 2EYRA 2EDNA 1A4KA 4TUKL 3PGDA 5C0DB 3O11A 5E9DB 1SYSA 4PJHE 5FO8B 4QHUA 5CIPH 3QUMA 4UAOB 1RUQL 1ZHLA 3VWJB 3GIZH 1GGTA 3WN5B 4Y5VB 4UIMB 2J6EL 4LEOB 4PBWD 1J18A 2ADGB 2P5EB 3PV6B 3S4SA 1VGEH 3QNXA 4GJTB 4WJ5A 4U1GC 1OSZA 5T3ZL 4LBEB 4MLIA 4N9GB 1FL6A 2PW2A 1DE4B 4X8JA 2B1HH 3BUTA 4CVZB 1JUFA 5C6TH 5EU4B 2NTFA 3QIUC 2ZUVA 3O8XD 4ODTH 1QQDA 4MCYB 3F12A 1VESA 2C3VA 4Z6AT 2AJVH 2R39A 3SBWA 3W9EA 3QFJE 2J8UB 4OD1L 4EI5D 1RI8A 4EEEA 4G6AC 3QG6B 1V3JA 4G9FE 4OLWH 5BS0A 3MXWL 5DTFB 5C07E 3MLWH 2YPVL 4FFYH 5FYLE 1QFWH 5L2KA 4WGWB 1IC7L 4FXGA 1F3RB 4O4YH 2F8XC 2UZYB 4OZGA 4BSWA 3RA7L 3LKNA 1DQML 2DWEB 5KS9A 3MOQA 4JLRB 2Q76A 4LARH 5A3IC 4BK4A 4Q9QL 4HG4J 1A1MB 2R2BA 4WGVB 4OI8A 3I9GH 3MLUL 3KPOA 4P46C 4XPBL 4JANA 1A2YB 3WIFB 5I18H 3G9VA 2QJDA 4LKXA 1MQ8A 4P4RB 1LQSR 3L3GB 4X4ZA 1AGBA 4KI5F 1D9KB 4ISVB 3PXJA 4P2QE 3MV8B 1X5ZA 5IWLC 3ALXA 1RIVH 1XF2B 3STBA 2R1YB 1J0YA 1QRNB 3L3KB 3KYMA 3WO4C 4KUCF 4WHYG 4E41B 1HHIB 4I0KA 4L3EE 1BWWA 3FT4A 4Z7NE 1SJHA 3E6FB 1M7DB 1H5BA 3QA3A 5MENA 3PGFH 2F53A 2PN5A 4TVPE 5HYJE 4J4PD 2PUQT 4IMKC 1NGPL 1D5XB 2XZQH 5FECA 3GSVB 4MXVF 4PBVC 1YMHA 4NRZB 5GZOC 1A6UH 4FQLL 4WI5A 1NFKA 3RWIA 4KH2A 4MD4A 1GGCH 4FTVE 1V05A 1A22B 4TRPL 1CT8B 2DWDB 5D6CA 5JPNA 2L0DA 2MQ3A 1RZJH 4GRWF 4H8WH 5DQJB 5I75C 1CDIA 3QFJD 5L2JB 2VR9A 1YNLL 1AXSB 1G9ML 3OKLA 4GW4A 1WITA 5ILTH 3T0EB 1EUUA 5C07D 1JYNA 3W5MA 4XP5L 5FYLD 4EDXB 1FNEB 3L7FA 4CU6A 3REWA 2QR0B 1JWSA 5CBEB 3JSSA 4DUVA 4OD2B 3SKUD 4CMMA 2ADJA 1SM3H 3UTSA 5DEZA 1C12A 5FM5M 4XNZC 1QVOB 3MLZL 3IYLW 1CE6A 3IJYB 4H0IA 4YFDB 4MS8C 4XNQB 3O6FC 2H3NA 4DGIH 4NFCA 3O6LL 3GSUA 1HILA 3IXAB 2RGSA 4QXGH 2IANB 4DCQA 3Q3GA 2YA2A 4L5FL 2RFXB 4P2QD 3MOBL 4DZ8A 4P2RD 2WUCL 1LE9B 3G9AB 1J0KA 5DC9B 5ABDE 3BKJH 5IKCB 2AABH 5FEBA 3EFDH 3QXUA 1NGXA 3O2DA 5KW9H 3LN5A 3MCLH 3FFDB 3BIKB 1N64L 1T1XB 4HJ0D 2HRPH 1TTUA 1S7WA 1INEH 4TVPD 5HYJD 4QEGA 4JPVH 5FO7B 3C60C 3VG9B 2HFFB 2FEDC 3BXNA 3NCBB 4X6EA 4G6JH 2FO1A 4X7FC 3W9DA 3NIDE 4AG4H 4KAQH 2F58H 3BWUC 4CRPA 2ARJA 1QR4A 4XP6L 4OCSH 1CQKA 2PYFA 5TE7L 2CDEA 5D2NE 4Q97A 3VFOB 1P7QD 2VLMD 4WNQA 1NLBH 1Y6MR 4YAQB 3DX7B 5JHDE 5DGRA 1S7TA 4HS3A 1FL5B 4UUJA 4JFDA 4XP9H 3ZE0F 2C1OA 3C5ZD 5SWZA 5FOJA 4K7PL 1NKRA 4NRXB 4OLXL 5F7HA 1P9MC 1G7MB 4YFLF 4GQ9L 2ZPKH 4BYHA 1NMAH 1CFQA 4OZIB 4XRCB 1A7OL 5EZOL 2N4IA 4KHTH 1ZHNB 4LL9A 3D3VB 5I66B 1BPVA 2JIXA 5I15H 2EDDA 3UTZB 3SE9H 5JW3L 1JPGB 5E99H 2A0LD 2EC9U 2FX9L 1Q72H 1FNFA 2X9WA 3UZQA 4PGCB 3WFDL 4OF7A 4JY6A 1H0DB 4YBQD 1K4CA 1MFBH 1FFPA 3JTTA 1Q9KB 4DEPB 3U7WH 4M9OA 5T3XL 1R24B 5BW7A 4WI9A 4Y88A 2D9CA 5EULV 5T1DH 3OKYA 1HXYA 3PJSB 5HGGS 2DTMH 5I2IA 3OR6A 2C3WA 4MNQB 3RZWA 1MCFA 3F62A 1HYRC 5F7KC 3LV3B 5LAXA 2GCYB 2QSCH 1P4BL 1UB5A 4PUBL 3JTSB 1R3IL 3LPGA 3KLSA 4GG6F 2VLJB 3O0RH 4WI7A 2IQAB 1H15B 4I3SL 3MRCB 2VXSL 4WI8A 1LILA 1FFQA 2VDNH 3FO2A 3IFLL 1OAQH 3BZFA 4NN6B 4UDTB 4N0FB 3VFPB 4HDIB 3S37X 2MSPA 3N9GH 2I07B 4P5TC 5IMOB 1ZEAL 5JHDD 2HTKC 3E3QC 1HSBB 3CLFL 4KJYA 4CUCA 1YY9C 3LEXA 3SBWC 3DV6A 4ZOCA 1A9EB 5DC0A 3KYKL 5BVJA 1B0GB 4CW1B 4ACPA 3Q6FA 4ZO6A 2BSED 1FORH 4JM2C 2J88H 4E42B 2H41A 3PABB 3IJSA 1QHPA 4P3CL 1QNZL 1U8MB 1BAFH 4FABH 3DGCR 2FL5B 1CDYA 1EZVY 1F3JB 3O4LE 4KMLB 4OCNC 5C09A 3QRGL 5E1HB 3PDGA 3ULUE 3MLPA 2APWA 2MHAA 3WCYA 2DQFA 2VABB 1O0VA 5DVKA 3X3FL 4XPFL 4YDKL 3OV6A 4YEEA 3RTQA 3F7VB 3V6OA 1ZGLP 1NFIA 4FQHA 5FXCH 25C8H 2PF6A 3CH1A 2VXUL 4B7LA 1CN4A 4YQXH 1UB6B 1F3DH 3CFJB 2HJLA 3KPPB 4Z76B 4ZXBA 4ZTPH 3MJ8A 5JNYA 4LCYA 4KC3B 1KCRH 1KIUA 1NBZB 2EXYD 1LGVA 3GMLB 5HDBE 5IM7B 4D3CH 3HC0A 1H5BC 3LRGA 3FB8A 2R0ZL 3GGWB 2HT4D 1EFXB 4PJGF 1C16A 3NN8B 3BT2H 3EJYC 4MVBC 4AJ0A 2DQIL 1I1YB 1RUQH 1BQSA 5EFIB 4PJFB 4AH2B 3RVTC 3D87B 3UPCA 3F7YA 2J6EH 2QHLA 3PWVB 1XGRB 5GGRB 5GRYA 3U1SH 1YEDA 2HVJA 1UWEL 3AB0B 1FNSL 1TJGL 1QFPA 4EI6B 5FGBA 5T3ZH 1Y0LA 1FYTE 3CDYA 3RWGB 4YH6A 1Y18A 3SE3C 1P1ZA 1VPOL 3P4OB 1JF6A 2B4CC 4BH7B 3D48R 2IALA 1M71A 1YUHA 3QPXL 1FRGL 4NUGL 1IGTB 1VFBA 1ADQH 4WTXA 1I1AA 4GRLA 1C5CH 3GSRA 1QBAA 1OVZA 2M26A 4OD1H 2OL3A 3D9AH 4GKOA 3RDTB 1VA9A 1UQSA 2EEBA 4GO6B 4R9HA 1IM3A 5F3HB 3TYFA 2BC4A 3NPSB 4M6OL 3BISA 3MNVB 5KSAD 4K3JL 3QR2A 5IESL 2YPVH 4QNPF 5A2LH 3AS0A 4K3GA 4NHUB 4GXUM 5ADOL 3MRMB 1IE5A 3QHZL 4LCWD 4M1CC 3RA7H 1DQMH 3HNVH 2ZUXA 3FT3A 5D1XD 5BJTB 4C56E 2VWEC 4Q9QH 3KXFD 5D1QD 3LKPB 1K4DA 4O00A 1XT5A 2W59A 1VCAA 2ZUYA 3FO0L 1XH3B 4AM0A 1G1YA 1KXQE 4XCCH 4XPBH 5F9DC 5FGRA 2YHGA 4NSKB 3IJHB 1K85A 3WD5L 5JDSA 3QUZC 5DHVA 3ARBB 2CUIA 2YXFA 1IAKB 5EH1A 1HI6A 2BNQA 4G8IB 3QZWA 3PWNA 4UT6H 1SJVA 3AGVA 3FO1B 4QTIL 5HVWA 3CDFA 3NA4A 2R56L 1JGEB 3AXLB 2YUVA 5K9OB 4LLDA 1ACZA 1KJ2A 35C8L 4J2XA 1I8IB 4Q2ZB 1XCQA 1C08B 1JWUB 4PJCE 2V9RA 1FYTD 4NJ9L 3WDHA 4FQLH 2RHEA 1WEJH 2YWZA 3WJLA 4Y5YB 1JZ6A 3QIBD 4WU5B 4JPIB 4UMGA 2JJUA 5E8PA 1YQ2A 2VLLA 3NCJL 1X5FA 1T0MA 3CIQA 1YNLH 3NIFE 5F9WB 1D5MB 3OR7A 3I6LD 3TBYB 4OF8A 5DJXB 1T7WA 4OCRL 2C3XA 4PRHB 3O9WA 1U8NB 2GJZA 1A4JA 4RGND 3C5JB 5BW7C 5DFTA 5I8CA 2X1QA 4NOFA 3NCCB 3QDJE 2XRAL 4GFTB 3BRGC 4ODXB 4FQQA 1QSZA 2RJMA 2YRLA 3A0OA 3OQ3B 3IU3B 3MYZA 3MLZH 2X4PA 4LP4A 2ERJB 5JMOC 1VACB 3O6LH 2C3HA 3RWFA 3T2NH 2LTQB 2K7PA 3BPNC 4LGSB 4L5FH 4TULL 2ZCHL 5IHBA 1Q9WA 4JFYA 2WUCH 2AW2A 1J1PL 4OSUH 1FC2D 4ZUWA 2XV6B 1MJJB 4ZUTA 4JFZL 3SKOA 3LRSA 4HGWB 3CZFA 1N64H 5IVZB 3GMPA 5E94A 4PRIE 1AC0A 4X4YB 1TQCB 2V5YA 4XBEH 4M03A 4UNVA 1DUZA 2ICEB 3KLHC 2C1PA 2VAJA 1HWHB 1E4JA 2VDML 1X5HA 3G6JE 1TZIB 2E6PA 2ZWLT 4FQJL 2LE9A 3OZ9L 2ZUTA 1JF5A 5HDLA 3G5ZB 2NNAA 2VTFA 4XBPA 2BY1A 4EUPB 1KCVL 4OCYL 4HLZG 5GGUA 5C0FA 4BZ2L 4F8TA 5KG9A 3RWJA 3L6FA 4JZJB 3VFGL 1JNLL 2VUYA 3WV0A 1BM3L 4LEXL 5GSRA 3W11C 1HXMB 3AM8C 1NFDF 4GQ9H 3RTQC 3C9NA 3V6OC 1I9JL 3RHWK 1HEZA 5EZOH 1ES0A 1IAOA 1TPXB 5C0RH 1QEWB 3VFRB 3LZFL 4OIBA 2ZP0T 5DD6A 3MRNA 3QDJD 5JW3H 3O3EA 4X6CE 3MCG1 4YHML 1KELL 2FX9H 1CD9B 4JRYA 2LFGA 3ARFB 3HPJA 3WFDH 4ZXBC 4LSVH 1M4KA 4YNYB 4U1KA 2BNRB 2N56A 3QI9B 5HYFA 5T3XH 4NNXB 4WTZA 4PRPA 5D93C 4WUUE 2X4TB 4MQ7B 5HD8C 1EHLL 3HZYB 3R0MA 4BFGA 2KZ1B 4KK8C 1KF9B 5F8RC 4TYUA 2O5XH 2Q3AA 4GKSB 1PLGL 1A6TB 4TNWF 4EQ3A 1HKLL 2XKUA 3E8UL 2B0SL 3ME0A 2ZUWA 3BH9B 4HV8A 3FRUB 4G8FA 1P4BH 4NQDE 4PUBH 4U1SB 2E9IA 3N85L 3TBTB 2ADFL 2VSCA 2YUZA 3FN9A 4PJBB 1AQDB 2YUWA 4XPHL 2VXSH 2FO4A 1ZE3C 3QDAA 3IFLH 4J23A 5D2LA 4KRNA 3G6AA 1NCDL 5DT1L 2LABA 1JYWA 3CMOL 2WZPD 3QUXA 2CR6A 3ZTJH 1ZEAH 4ODUB 4M6NL 2YBRB 3TNMA 5J11B 3CLFH 4GRLC 4PG2A 2X1XR 3DX9A 2EDLA 2A9NH 4ELME 1BX2A 3GSNA 3KYKH 4JJ5A 4M9PA 5HI4D 2UV3A 4P5KB 1CLYL 5CSZA 4R4ND 4M4PA 5EUOB 4K7PX 3WS6A 3VWKC 1EX0A 3VA6A 1G9MC 4P3CH 2H8PA 1QNZH 3VXUB 1HCVA 3D85D 2R8SL 3V4PL 3QO0A 5J3HC 3ZDYE 4NHCL 3QRGH 3T1FB 2GKIA 4NQCE 3PP4L 1JYVA 4X5LA 1E6OL 5IMLB 3H9ZA 2MNUA 1WUNT 1JTOA 3RUGA 3WYRA 4MXQD 4XPFH 2AQ1A 3E6HA 4NQEE 1IEAA 2JJWA 4OGYL 3LKOA 4ZD3L 2OTUA 5AG9A 4Z78A 4U1HA 4PGEA 1KCUL 2VNCA 2V2TB 5ACZB 1YY8A 2VXUH 4AENA 1T80A 2CD0A 3GBMH 1TIUA 4YPGB 4ZQKB 3BKCL 3PHQA 1FNGB 4L29B 5GGVH 3QIUD 1OP9A 1T0PB 5C9KA 5JHLL 3EKCA 1UADC 3RX5A 3WFBL 5C0IA 4G5ZH 4JVWA 2X4OB 5IVXE 2D31B 5F21B 5IB3B 4X98A 3EFFB 4ETYA 2R0ZH 4G6AD 4RRPA 2PYEE 3P77A 5K9JL 1F45A 1KXTB 1NCCL 5IB4B 1NMCB 2E27L 5C3TA 3DVIA 1RZ8A 4XCYB 3LH2L 4KRLB 1S9KC 2DQIH 4XWOD 3JWOC 1ORQA 1SJEA 3WJLC 5JORA 5C2BL 2IADA 2KPNA 4PB0H 5JLZB 2G2RB 1UWEH 1FNSH 1TJGH 5DWUL 4NO2B 4XGZB 1R3JB 1KB9J 4EXKA 1NQBA 1JZ8A 3RBGA 1MCNA 4UNTA 4FN0A 1VPOH 3QJHB 4RAHA 4Q6IB 5C0EB 1MFAL 1L7TL 2Y07L 2FHBA 1FRGH 2CO6B 4NUGH 4APQD 2AJUL 1U42A 4X9FA 3H9HA 1MI5D 5ETUB 3BE1L 2L7UA 3CX5J 4L9LB 4P48A 2P8PA 5EZIH 5E2WH 5DGQA 4LDLB 5CSGA 2EDKA 4OQTL 4QRTB 4IRJA 3A67L 4M6OH 3GM0A 1I75A 1I9RL 5IG7B 4TSBL 2FWOA 3QDMB 1BGXL 2GJ6E 4X4ME 2F54D 1JGLL 3T09A 4TUOA 3OXRB 4MAUL 3BP4B 4JREC 5L8JB 4Z7UA 3FN3A 3KPSD 3TO4A 5ADOH 4ZPVA 3C8DA 3QHZH 2ZCKL 1W0WA 4OZ4B 1PBYA 3ZHKA 4PJHF 1LO3H 5EZJA 3T65B 1NCTA 3LN9A 4ZPTB 4IS6B 3FO0H 2P8MB 5EPMB 2X40A 4JN2A 3IFOA 2YOCA 2PYED 2EH8L 3CVHB 4LQFH 3WD5H 3PXHA 4X6BB 2O61B 1TENA 4LU5L 2AJ3B 1ZGLM 5B38B 1GYAA 1KLGB 2OTPA 2YS4A 4QTIH 4EIZC 5C08E 1KCLA 5GGTL 3EHBC 1WWAX 1G9EA 4MQTB 4NT6B 1S7XA 4GW5A 1MCIA 35C8H 3MLRL 1IGFL 4TTDC 4JVPA 4MS8D 5J6GB 4JKPL 1YPZA 2DKMA 2CR3A 3L3JA 4X5WA 1IQWH 3CFEB 1U58B 1X5LA 5EG6C 5B38G 1AH1A 2BHUA 1JPTL 3BGFB 2DQEL 1BIIB 1AO7D 4JFOB 4MNHB 1QZ1A 3WHXB 3K4AA 4P23A 1ZVSA 2LQRA 3NCJH 1AGEB 3NABL 2YZ8A 2QQLL 4GW1B 3IXTA 1T4KA 2HFEB 2HMID 4CAGA 1NGYA 4XP1L 5I6XC 3OXSB 4DKEL 3CC5B 2GJ6D 2YPLA 2ZUUA 4XNXL 3SDXA 4HIHA 1WZMA 4TSCL 1I7UB 5E4EB 1U3JA 1BZ9A 1AI1H 3THML 4Y4KA 3SDCC 2R9HC 5HHXH 5T1LD 5J06A 1OAYL 1A3LL 1K8DB 4MA1C 5EO9B 4Z7NF 5KZCD 3VI4E 5DMJB 3OAZK 2HWZH 3BYTA 4J3XA 5CJOH 5EU5A 3VW3L 3BN3B 2IAMB 4CNIA 1YN7A 1X44A 4TULH 2ZCHH 3KWWA 1N6VA 1IM9A 4J3VA 5E6IA 2BXZA 1J1PH 3GIVB 3IFNH 3KPRA 1Z5LA 2GHWB 5DRZA 4JFZH 4YDJA 2KZWA 3KYNB 3UBXI 4WHDA 3F65A 1X4ZA 2VLKA 1B90A 3MV9E 7CGTA 1TCRB 4BZ1L 4NQXB 4PRDA 3HE6B 3QUXC 1EIBA 3QUKB 1ZT7A 3QSKB 5DK0A 1VGKB 3HNSL 4G8EA 1G7HB 2GSIA 2OZ4L 1B3JA 4PG2C 5TDNB 1MRCL 5KANI 3BDYL 4LGPB 1KN2H 1XIWD 2BNUA 3QQ3B 5DJDA 1N3NB 4NQSA 1I1FB 3MRBB 2AGJL 2NY1D 2IFFH 4BM7A 2XWTB 3BP6A 2VDMH 4ODWA 1V3LA 2XA8H 2F9BT 5E8DL 3OKEA 3WS6C 5D9SB 3FB5A 4LCUB 1AE6H 2A6DA 4X6FB 2I9LA 3HRZB 4PJEA 1CLCA 2ESVE 5CKAA 1T3FB 4OCYH 4B50A 3K1DA 1XF5A 4G7VL 2X6MA 4BZ2H 4QHMA 4R6UA 3VFGH 1NC4A 1A5FL 2IPKB 1BM3H 4LEXH 3T4YA 4G9DA 4P3DB 1F90L 1MHCA 4JFQB 2XWJA 3RY6C 3SCMC 4S11A 3WIHL 4BQCA 2ZUQC 4GKZB 4JKLA 1OP3K 3CPLA 1HINL 1I9JH 2Y06L 4LCWB 5D7IB 3MTRA 3LN4A 4V1DA 2BX5A 2NLJA 1HDMB 4NKDA 3BMWA 3KXFB 2DIBA 1T2XA 1TNMA 2C4FU 1Q38A 2HTKD 5H94A 1QSFE 1YY9D 2HFGH 1NEZG 1T7VA 2HKHH 2GQHA 1FVCB 1SYVA 3NMEA 1S9WA 4LOUC 1TNNA 1HHJA 2AKRB 3RL1B 3IU4L 1S7SB 4F57L 3RVUD 3UMTA 2QSVA 4OBSA 5BMFH 5BS0D 5KN5B 3NIDF 5L2KD 4BSVA 1DSFL 1RJLB 3IDXH 2O93L 4KMTL 2GY7B 1PLGH 1U8HB 4NKMA 2KL6A 3MV9D 4URTB 2B0SH 1NDMA 1TETH 4HGMA 3D0LB 3KS0J 4LIQE 1WFNA 5ICYA 3N85H 2ADFH 4ZDHA 3STLB 4G8GE 4XPHH 5K9KB 1QR1A 3QNZB 3CLEL 2EIEA 3WFCL 5F9OL 5CKGA 2Y36L 2R4SL 2JK5A 2V2WA 2GTWB 3KPMA 5B39B 3ZT5A 3F7PC 4MJ5B 5DT1H 5GRJL 3PL6A 2ZSVA 4U0QB 3CMOH 4X0KB 3SGJA 5HYEA 4BA8A 3VXMB 1KYOK 5TH2A 5JUEH 4R26L 4M6NH 3WFHA 5F89B 4C57C 2I26N 4YHLH 1HHKA 4Z77B 1CICC 3GMOB 1P5VA 4M62L 2GJJA 4IRJC 2BRQA 5MEND 1FHGA 5B39G 3HC3L 1CLYH 4YO0B 1YMMA 3WIIH 4DAGH 3HG1E 4RGNB 1E4XH 1OQXA 4QWWD 3QB7C 2B20A 3DRQA 4HS8L 1M6OA 5FA4A 4RWYH 2R8SH 3TO4C 4GSDL 5JW5B 2FH8A 3PP3H 3M8OL 4K55A 4XCFH 2EYSB 1LO0L 1JZ7A 2CH8A 5DUPL 1E6OH 1JPFB 2X1WL 3MRJB 4WCYL 2OP4L 4HIIB 4TN9A 3JV6B 3TT1H 4YHNB 4PY7A 4Q7DA 2WAHA 3RPIB 4HH8A 4BSJA 5AZ2H 2RCSH 3UZEA 43CAA 1FZKA 1KCUH 4DOHE 3FAXA 3MJ7A 3PWUB 3TO2A 4CVWA 3LHPL 1MJUL 5BCAA 5F7FA 5A2KH 2OJEA 2GITB 5D5MB 4NWUH 4M93C 3Q1SH 4Y5XA 4PJXE 4NKOA 2AXFB 4HIJA 3EYUL 3I6GB 4K71B 3WFBH 2DBLL 4PJ9A 3GJFH 4X5XA 3UTSD 5FKPA 4A6YA 4HC1A 4G8GD 2ZJSL 4BQ9A 1U8PA 3DVNA 4XMKL 5K9JH 1NCCH 5CHNB 4ZSOB 1QPPA 1ULVA 2E27H 3NCMA 1TVHA 5D70L 1YEIL 3NFPA 4HZLA 4MZ2A 3LH2H 4KJPC 5I8EB 2HKFL 3ILPA 5DQDH 5TGBB 4JY5H 4M1CD 2AV7A 1RPQA 5C2BH 1KLFA 3ULUF 1LO2H 2NY3C 3RNKA 1TVDA 5FGCE 3UDWA 4HEME 1NUDA 1RK1B 5FB8B 3AU1B 3NZ8A 3LMJH 4GXUN 3WS3B 1SBBA 1BQHG 2C7UA 5L7XL 5IHLB 2CLRB 4C83B 1YC8A 3HG1D 5E5MA 4BELD 1J0JA 3G04A 3MGOA 3IS0X 4RMUA 1MFAH 1L7TH 5IEHA 12E8L 2GYSA 3SO3C 5D7IF 2WINB 1BFTA 3BE1H 4CBPA 4LK4A 5ACLA 3FQRA 4Y4KC 5DJ0B 4OQTH 3U4EA 4KRPC 1KTLA 3DYMA 5HDBF 1E6JL 1I9RH 1L9NA 4Y2OA 4TSBH 4JFDD 2UWEA 3C6LB 4HPOL 1JGLH 4MAUH 1AGFB 4ETQA 5CGMA 1TZHA 2ZCKH 4EBQL 5E6IC 3L9RB 3S3SA 5DJ8B 4XMPH 4HWNA 4ERSL 4WW1A 4KY1H 4YC2C 3EO1B 5T33L 5EO1A 1OB1A 4OZHE 4F9PA 3O3BA 4UU9A 4MQXC 3OB0H 2EH8H 3U0PA 4YIQA 4N0UA 1T1YA 3KR3L 5I1LB 4PV8B 4LU5H 1JE6A 1PDKA 2XTJC 2SEBB 2AJZA 3B5TA 2W9EH 3MLVL 4F2MA 5GGTH 2XKSA 5HHOE 3N1GC 5BXFA 4QCIB 1FSKC 5DJYA 4PJAB 4ZFOA 3ALPA 3DUSA 1BBJA 1DLFL 3WO3B 2C5DC 1E4KA 1IGFH 4M61A 1UENA 2Q1EA 3SKNA 4JKPH 5C0GB 2J1KA 5DRXA 5SWSA 4K3DL 2EO1A 2Q3ZA 3HUJA 4W4NA 2IFGA 4GAGL 4HPYH 1ODAA 4HUMB 1I3RB 1V7NL 3D85B 4NO5B 4UB0L 4D0CB 2E9JA 5C70A 3DV4B 4LVOC 5C1MB 3MV11 2BOCA 4NM8L 4AEIL 4Y1AE 3BUYA 4FZ8L 3C09C 3G5YA 1NC2A 3P40A 4JM4L 4ALAL 4LLMB 2H26A 1OAZL 5D71L 3PQYE 5AYUH 3NABH 1OLLA 3FCTB 1NUGA 2QQLH 3ZE1E 1T5XB 2G60L 4JQVA 3BGMB 4U1GB 3O45B 5DSCB 4PP2A 2Q8AL 2HP4A 4XNXH 3KLHD 4TSCH 5FDWA 1L0QA 1I7RB 2J5LC 3WIHA 2ORBL 3QIUB 2VDOL 2AK4B 4RAUA 4U1JA 5IJVA 2D7QA 1CFTB 3B2UC 4DVRL 1OAYH 1A3LH 1E27A 3K2MC 4F7TA 1ZSDB 1DBML 5J6HA 3MA9L 4UTAH 5L9DH 1R5VB 1YEHL 3FQXB 5DRWB 2Q6WB 4PJCF 4GG6A 3O3AA 2BVYA 2BVQB 3RTQD 4D2NA 3SOBH 1NBYB 1WZLA 4S1RL 4J12A 2FYYA 5I0DA 1BVLB 1AP2B 3CD4A 4HK0B 3PL6C 3WUWG 3MOAL 4DFHA 2WQ8A 3SGJC 3D2UA 3BP7B 5FF6B 1PG7L 5AUMB 3U9UA 4P46B 3WJJA 1ZT1B 4QHKJ 2OZ4H 4ZXBD 3MNWB 4NNYB 1SY6H 1MRCH 1G6RB 3BDYH 1JIBA 3NIFF 3CFKB 2X1PA 2QKIB 4P9HL 2ADIA 3UJTH 1R6VA 3G5XB 2AGJH 3RWCB 4XXDA 1U8OB 3SE8L 2NY5H 5HD8D 4YHYC 4RQQB 1ZAGA 4HWUA 5IFHL 3WO4B 4KK8D 4Y1AD 3D69A 3TH2T 3X13B 1MI5B 1GL4B 4MD5B 3QULB 5KVGH 5T1KB 2QBWA 1LMKA 1J10A 4G7VH 1JGUL 1MCKA 4Y19B 3KNBB 5I74C 3P0VL 1A7QL 4WWKA 1A5FH 1LNUA 3K8MA 1F90H 4M3KB 2OSLB 2F54B 1BD2B 3KPSB 3W0WE 1HINH 1T04B 1L4IA 1M05B 4DN4H 3VRIB 3EDJA 3SJVA 3QQ4B 2VXTH 5FK9A 4LLUA 3NGBC 4TUJA 4QXTA 4KI5C 4Y5XC 3WFEL 3CDGA 2FBJL 1XF1A 1CWVA 5I75B 1QLEH 4WO4A 4PJ5E 3TF7C 4PJ9C 1I1AD 4GRLD 3AAZB 4PS4L 3IVKB 2VAAB 3GNML 1IC4L 5I16A 3L5IA 3GMMB 1MFNA 3IU4H 2FATH 3K7UA 1AGCA 2DLTA 4JHAL 3L5WA 3G6JF 4N8VB 3WHE0 4PJGA 1DSFH 1RZ7L 2VE6A 5IBUG 2VL4A 5EN2B 3L5XL 4NNPL 4HUNB 2QL1A 2ITCA 5C7XH 5GGSY 4XNZB 2P7TA 3AY4A 3IETA 1G7IA 3UDWC 3O6FB 3RPKA 4LVHC 3TN0D 2B8OT 4S2SB 5HGHB 3CLEH 2AJYL 3OKMB 5EBWA 5F9OH 3F5WB 3AMLA 4D0BB 5KVEL 4N8VG 1BVKB 2XZCL 4N5EC 1ZOXA 3KS0H 5GRJH 5A16B 4HAGA 3SGEH 1AO7B 3VFNB 4D9LH 1A9BA 1LDPL 3X12B 2A9MH 3R4DA 1IGJB 1CDJA 4X6CF 1S9XA 5HGAB 4BZYA 4CGTA 1H9VA 1KIQA 3MGTA 5I76B 1RULL 3HS0B 2DLFH 4M62H 4J1UA 1M7IB 1G7JA 3HC3H 5C0AE 5F71A 1LO5B 1UZ8A 4KK6D 2ZZUT 5FYJU 1U8IB 2A6KA 2VITB 4ZFGL 4HS8H 4HWZA 2BVPB 1XAUA 4NUJA 5DZLA 2BCKB 4I77L 4KTEL 3M8OH 4TOYH 3OL2A 5DR5L 5TJWK 3L3HA 5T1LB 5DUPH 1ZLWH 2KKQA 5KZCB 1DQLL 1NAMB 2X10A 4ZG1A 2F19L 2V7HA 5CEZE 1Q0XH 2X9YA 5C8JA 3VXRB 1NBVL 4ZAKA 4F9PC 3DSFL 3EYOB 1HHGA 2OS7A 3LHPH 5DRNA 1PKQA 4GMSL 2XQYG 1W8NA 2MFNA 2OR7A 4YGVB 4RWHA 3U82B 1EXUA 2EDHA 3O9WD 5E2UL 5CJBA 2MQCA 1JGDA 3EYUH 4JVUA 5B3NA 4UT9L 5CMAA 2DBLH 2DI7A 2WBJA 3TIEB 4PYHA 4MD0B 3H9SA 3VXTA 3GZKA 4L8DA 2VMFA 1LE5B 4JRYE 5JW4R 2ZJSH 3T0DA 2CLZB 4XMKH 4ELMF 1W8OA 3I02B 1RQ5A 2N7AA 5F9JA 2NW3B 2WLZA 3BVNA 2EYRB 1A4KB 3PGDB 5KJRL 2CRIA 5I1AB 5DFWH 1MIEL 3O11B 4ZFZA 3S8WA 2HKFH 1WZ1L 4PRPE 4M6AA 1SYSB 5F3BA 3TBVA 4QHUB 3QUMB 1EO8L 4IDJL 5CJXA 4L4VA 4NCC2 4HUUA 3ZDYF 1JZ2A 4D0DA 3FTGB 3KDMA 4MDIA 3MV7A 2AJXL 3UTTA 4ZUVA 4WHTA 4X83A 5GS2H 2YD7A 5L7XH 3S4SB 1OARL 3QNXB 4WJ5B 4JQVC 1OSZB 5JA8B 3MRDA 2ICWA 5L6YL 2QV2A 1FL6B 2PW2B 4X8JB 4R8WL 3FOMA 4NO0A 3O6ML 3RP1A 1JUFB 1IKNA 12E8H 1WLHA 4FQXD 2NTFB 3PWPE 4U0RC 4XPTL 2IG2L 1WWBX 4P5TB 1QQDB 1RZGA 3X14A 4YHZL 3F12B 4F7EB 2Y7QA 2UZIL 4YDIL 1KBGL 4I4WA 3W9EB 5CEZD 3PUCA 3VXSE 5HGBA 4TTDD 5IVXF 3VXOA 4G7YL 4HKXA 4QOKA 3BP5A 2LVCA 5BS0B 3T08A 4YEFA 4JM2B 3RI5K 2XXCB 4OTXL 5L2KB 1OLZA 4FXGB 3FHAA 4MJ2A 4NWTH 4OZGB 4JJHA 4BSWB 4R96A 1NSNL 5T5NF 3GI9L 3LKNB 4QRPA 5KS9B 4ERSH 3LAFA 2Q76B 2W0KA 5GGVY 1OY3B 3NIGE 1FE8H 4JRYD 5ALBL 1U8LB 4JPKL 4MA7L 3WJJC 3KPOB 4JANB 3KR3H 1JPSH 3AREA 4LKXB 1AGBB 4KKBC 5FYLL 5SV4A 4PRPD 2LAGB 4K9EL 5BRZA 5HYIA 4OCWL 3MLVH 5DZOA 3KYMB 3IDNA 5FUOL 4F3FA 2XT1B 2Z4QA 2VDKL 2R9HD 1GC1L 3FT4B 5D7LA 4ODVL 2OX5A 1SJHB 5ID1A 2ED8A 1H5BB 2CLVA 3QA3B 5MENB 2F53B 2P5WA 3V0VA 4PJIE 4TNVK 3LY6A 4K3DH 4WWKC 4YDVA 5FECB 4U49A 4GAGH 1YMHB 1Z9OA 3V7MA 1SEQL 1V7NH 4UB0H 3RWIB 5IFAL 1XF3B 3WMSA 1U2HA 4MD4B 4NM8H 1NFDA 5IROC 3GB7A 3H2WA 4FG6D 3NCEB 2VYRE 2I24N 3PF2A 4QYOA 4JM4H 1IT9L 2C26A 5D6CB 1J1OL 5H2BA 5I1HL 4HWEL 1U3YA 1OAZH 3HI6L 4O2CB 5D71H 5JPNB 3QUXD 3QO1A 2NTSP 5CD5D 4WO4C 3TA3A 2HH0L 4TVPL 3OKLB 4GW4B 4U6TA 1DN0A 1EVTC 1C1EH 2VQ1A 2AI0L 1NEUA 1RZKC 3HC4H 3NTCL 2XNAA 3L7FB 1KUMA 3I50H 2GSGB 3ZKQD 5C0BA 1PQZA 2VDOH 3DMMA 4CMMB 1UCBL 1JWMA 2WWMD 4DVRH 2ADJB 3UTSB 1C12B 1MF2H 1ND0A 5DD3L 4Z18A 1KN4L 1KXVC 3LKRA 2YRPA 1CE6B 3MA9H 3AY4C 2IBBA 3UP1A 3BPCA 2CKNA 2H3NB 5FV1L 1MCWW 1UH4A 1X3DA 2ZNXA 1WCBA 4L4TE 3Q3GB 4DCQB 5E8OA 4DZ8B 1INQA 4YHIA 1YDPA 3RL2B 1FBIH 1DBAL 1IGCH 3QWRA 3L95A 3MRFA 1NGXB 3CFBA 3LN5B 2DKUA 1PG7H 1HE7A 4LSSL 3F6IA 1UVQA 1S7WB 3QUZB 4P9HH 2BXYA 5GPRA 2VUOA 1CGSH 3BXNB 4KKCC 5FO9A 2HG5A 5FUCE 1MCSA 3OKNA 4M7KL 3SE8H 3W9DB 4I2XE 4JG1H 5IFHH 5EBMA 4F7PB 2ARJB 1FFOA 4QHNA 1E4XI 1B6UA 2PYFB 3CSYA 1ZLSL 2CDEB 4N0RA 2D0FA 4XX1G 4H25A 3V4UH 3MJ6A 3VI3E 1JGUH 1U3HC 2YC1A 3P0VH 1A7QH 5FM5O 1MCPH 1S7TB 4HS3B 3VI4F 4L8CA 4NRYA 4UUJB 4JFDB 4LMQI 5I1DA 2D2OA 5GS3A 2C1OB 5SWZB 1Q94A 1W0YT 5E5RB 4ZAKC 4W6WB 3OKKA 4OZFH 3CVHL 3WE6A 1CFQB 4DW2L 5JPMA 5EU6E 2YMXL 4X4XB 3DBXA 4K94H 4U1MA 5B4MC 3WFEH 1BECA 2JIXB 3CGTA 1LEGA 3SDAC 3R06B 2PO6C 3NOIA 1OP5K 2WBJC 4PS4H 1S3KL 4ZOBA 3GNMH 1QO3A 4GRMA 2B1AH 4JY6B 2VZVA 1IC4H 1A7PH 1K4CB 1S5HA 3MBXH 5I19L 1FFPB 3JTTB 2W1NA 4HK3J 4JHAH 4NC2B 2ED7A 3L5XH 1KEML 4JFXA 1ZTXL 4W81A 3J8F7 5CJXC 4GAJH 5LAXB 2WK2A 1KB5A 3F7RA 4XNMA 1UB5B 2XA3A 2AJYH 3BPNB 4NGHL 3MUGA 2P48B 1VERA 2XZCH 3FO2B 2QQKL 5AD0A 3BZFB 2E5EA 5BVPL 1MREL 2E8YA 5H37H 1S78C 1IKNC 3A6BL 4LCIH 1P2CA 5LBSL 4JFEA 5DS8A 1N59A 4KJYB 1RULH 1WCQA 4H1LA 3GI8L 5DMKA 3LEXB 3DV6B 3VDCA 5BVJB 2VLRE 3Q6FB 2FGWH 5FM4A 1VFUA 4ZFGH 4AEEA 3FJTA 4KJPD 2BFVL 4KTEH 1MSPA 5DR5H 4X9GA 3WXWL 4N8PA 4JQXA 5C09B 1DQLH 2MHAB 2NY3D 4PJHA 1U8KA 4DTGL 2DQFB 4U6VL 2F19H 1LEKA 4P23D 3BKML 3DI3B 1NBVH 3DSFH 1WAAE 4HF5L 3MFFA 4DQOL 3RTQB 4MMZC 4HLZH 3AREC 4FQHB 4HS6A 1YJDH 4FQ2H 2Y5EA 1U95A 4MX7A 2B7DT 3O2VL 1B0RA 2APFA 4Z7WE 1P53A 4FP8L 4K8RD 4UT9H 2HJLB 1C5BH 4RZCA 1MHHA 1QFUL 5ICZA 4QHLA 4ZXBB 5JNYB 3MJ8B 4WVRA 4LCYB 5DFVC 4EUPH 3HC0B 2H1PH 3FB8B 4KGJA 5D93B 1C16B 1MIEH 4G9FA 1DJSA 1WZ1H 3K8LA 1IM9D 4K2UL 4UILL 5C07A 1EO8H 4IDJH 3KPRD 1XCTA 3F7YB 2WM0A 3CK0H 1GSMA 3PIQA 3LIZL 4S1SH 2HVJB 2J8HA 2UY6A 2OR9H 1OARH 4MQXD 2FJFA 1EPFA 3TA3C 2VLRD 4OBRA 1Y0LB 5L6YH 4ENED 1KACB 2HLFD 1NCWL 4R8WH 5E7BA 3O6MH 5JOPE 1P1ZB 1OW0C 5C0CE 1NGWB 2IALB 1M71B 4LPCA 2A77H 4M7JL 2IG2H 4PJXF 4XPTH 1YUHB 5TDOA 2Y6SC 4P2QA 4YHZH 4U1LB 4NKQB 4POYA 5E1AA 1OGAE 1VFBB 3DMMC 4YDIH 1X4XA 4GRLB 1KBGH 3GSRB 3GBNL 2NY4C 3MPCA 4LDEB 1E4WL 1YYLL 1WK0A 3QEQE 4L3EA 1UQSB 4MLSA 4X9BA 5B3JE 1IM3B 4O58L 2NYYC 3TYFB 2BC4B 4NQTA 1T2JA 2WUBH 3PHOB 1NC4D 2CPCA 2GK0A 3VWKB 3QG7L 4OTXH 3ARGA 5HYJA 2OJZL 4QT5A 3GSQA 5H8DA 5E8NB 3ZT7A 1EGJA 1NSNH 5MEOA 4Y8DC 1CLOH 3HAEA 2AP2A 1X7QB 4OI7A 1D6VH 4YDLC 1OWRM 4FTVA 2HT3C 4P59L 2FNBA 3RU8H 4OGAC 4JPKH 4AM0B 1P7QA 2EE9A 3ZKXC 3B8SA 5KSBE 1NANH 1G0XA 2DQHL 2X4QA 3PGCA 4QTHB 3D25A 5JDSB 5DHVB 4L8BA 3GDBA 5FYLH 2F5AH 3MFGB 3C5ZA 1HI6B 2BNQB 1JMXA 3PWNB 2V6HA 4K9EH 5BQ7A 3JUYA 3RWDA 4P49A 5E0QA 2AXHA 2NY6C 2VDKH 1GC1H 3RX8A 1KT2A 4LLDB 2AXGA 4ODVH 1DTUA 5HHMB 1KFAH 1LWRA 3P2TA 1EVUA 1MCWM 1XCQB 1TZGL 3GO1L 5FCSH 4OM0H 2CUMA 2FECI 3OKDA 5IB1A 4KRMB 1B6DA 3FQTB 1UEMA 5IBLD 4F37F 1QSEE 5E24E 4NCDA 1IT9H 5I1HH 3HI6H 3L3OA 4M02A 5ESQA 3MR9A 4M5ZL 2VLLB 4R4FH 5F6HJ 5DA0B 2HH0H 4OZHF 1U8QA 4HGKC 3BH8B 3OR7B 1EAJA 4YX2L 3S3PA 2FCBA 2AI0H 3NTCH 4A2MA 1ZT4A 3GMNA 4EDWH 1A4JB 1XGTA 1HSAA 1CFVH 2ICES 1ZA3A 5DVOA 5I8CB 5FKAB 4X6DB 3VH8A 3N06B 3GMQA 2HYMA 4FQQB 1JRHH 3D39E 3SQOL 2DQTL 1KN4H 5D2NA 2X4PB 3IFPA 4JKKA 1FL3A 3O8XC 5JHDA 3RWFB 2NX5E 5E2TL 4JREB 5EIVA 1Q9WB 4JFYB 4YK4C 4EI5C 3EW3B 1PY9A 4ZUWB 1DBAH 4UOJA 1YA5A 3GSXB 2OQJA 4RMQA 3DRTA 4ZUTB 1DUYA 4DJMA 3LRSB 2FLRT 4KI5D 3SGEI 3HB3C 4LSSH 3TNNA 3X11B 3CZFB 1EEQA 3GMPB 4MNGE 2XI9A 5E94B 4HD9A 3GMRA 4PYGA 4PJ9D 2LU4A 4WI3A 1XMWA 5DQ9B 4KUCD 3W82A 5TE6L 3ARPA 3Q6GL 4JO4L 2GIYA 4M7KH 5I1IL 2C1PB 4N0UE 4XVTL 1K5NA 3ET9F 3MRQA 5D96C 4RFEA 3VD3A 1F8TL 3C5SA 4U2ZA 4HFUL 1RJYA 1W72L 2DKSA 2FZ3B 4NKIL 4NC0B 1I85A 3FRPA 2NNAB 4XBPB 4JQXC 2Q86A 4HWBA 5GGUB 5C0FB 1VFAA 1JP5A 3DX6A 4N1CA 4OFIA 3L6FB 1INDL 2EC8A 5GSRB 2F5BL 3S36L 5IEKA 5ISZE 3CVHH 4N5ED 3C9NB 4H5SA 1HEZB 2YMXH 1ES0B 1IAOB 3O2WH 4ZOAA 5EORL 3N50A 3B6SA 5DD6B 3MRNB 1X4YA 2R2EA 5GRWA 3CVIL 3PG2A 3O3EB 3SEPA 4IHOA 4JZNA 4M6ML 5D7SH 5E2JA 1QBLH 4XX1E 3JV0A 4L4JA 1V5JA 1S3KH 3HPJB 4XH2A 3QPQC 1LEIA 4LVNC 4B5EA 4U1KB 2DLEA 5TPWL 3BD5A 2CJUL 1U6AH 5I6XB 1U3ZA 1Z3GH 2Y25A 4FFZL 3MBEA 1MJ7H 5GGQL 5HHVH 5C0JA 1GVIA 1T1WB 1ZA6A 3QQNA 1XGYL 1IILE 3UXFA 3SDCB 1KEMH 4IOFC 1ZTXH 4XXCA 1SBSL 3GKWH 4MA1B 3JZ7A 2H2SD 3V6FB 4K9EC 4HV8B 3O4LA 5JZ7D 4G8FB 3ZDZE 4Q0XL 3QIWA 4WI2A 2COQA 1LP9E 4OFYA 4R90L 4NGHH 3W81A 1AGDA 2FO4B 4MWFA 4PP1D 3L3DA 3EYVA 5L0QC 1MIMH 3O6KH 3SDDA 2QQKH 4RDQG 1NMBH 1MQKH 5D2LB 5BVPH 5KSAA 3EOAA 1AR1C 1BQLL 3DUUA 3ROLA 3QUXB 1I7TB 4GMTL 5EU3A 5ID0A 3TNMB 2Z0BA 2ARWA 3BIAX 3HZMA 3UCRA 1FVDB 3DX9B 4JZOA 3RWEA 3S5LB 1BX2B 1UKSA 3GSNB 3VXQB 1PEZA 5D1QA 4JJ5B 1U91A 3LEYL 2NY0D 3MJGX 5CSZB 1JN6A 4LLYB 5SWSD 2XKNB 4HJGA 2H8PB 1IVLA 4KXZI 4WFHE 5DD5L 1FGNL 4PJ7E 3WXWH 3QO0B 4DTGH 1NC2D 4U6VH 3S5LG 2J12B 1XGQB 3BKMH 1I3VA 3WLWC 3RUGB 1IEBA 4BKLA 3E6HB 4HF5H 1IEAB 3LKOB 2OTUB 3SCMB 3LB6D 2ZUQB 3OGOE 4Z78B 4U1HB 4PGEB 3RIFF 4WU7A 2UVFA 1EBPA 1YY8B 4AENB 4Z0BH 1FV1A 3O2VH 3OPZL 2L4OA 1HOCA 3PHQB 5BZWA 1FYTA 3C5ZC 2XN9E 4FP8H 4FFWC 3N0PB 1T03L 5IJKA 4JDTL 4U3HA 2Y72A 1QFUH 3DXAE 4OCXL 2VDQH 2PTUA 3QIBA 4AYFA 2NPLX 3T2QA 1P4LB 5C0IB 4JR9H 4AIZA 2D3VA 3I3BA 5DA4A 4X98B 3P77B 3ZMRA 2A0LC 3UYOD 2CO7B 1GZQA 4OCLC 4QRRE 4KKAC 5T3ZE 1RZ8B 2YKLL 3OB8A 3BRFA 3ZZ1A 1T6WA 3BSZL 1UM5L 1ORQB 1SJEB 3EBAA 3S9DB 5JORB 3DGGA 4XCEA 2H6PA 2IADB 5J1AA 4Z95L 3LIZH 3D2UD 1QBML 5TF0A 4C56A 3DTXA 2Z31A 4LEOA 5D6DA 1KJ3L 4D9QD 1NCWH 5E00B 3U36A 1K8IA 2G75A 1I1CA 5DJAA 4M7JH 3RZCD 4WFHD 4LBEA 4HH9A 1KPUA 1X5GA 3GBLA 3H9HB 5J1SC 2P8PB 3LKSB 1CICB 3GBNH 4W4OA 2FB4L 4LSQH 4OFKA 4IRJB 4O58H 5D2NC 3EO9H 4NDMB 1SY6A 4LSPL 1DANT 1WICA 5CP3A 2FWOB 3BD4A 5DO2C 3VE0A 4LNRA 3QG6A 4Z7UB 3TO4B 5DTFA 4PG9A 4PJCA 5EZLA 3BDXA 4WV1A 5LKNA 3CMGA 5JO5A 5EZJB 1RVFL 3VGHA 4P59H 1A1NA 3K74B 3ZT6A 4RX4A 5DK2A 1LHZA 4JN2B 3T1WA 2DQHH 3WNMA 1QHOA 5L8KB 2X41A 4M93B 1A2YA 4S1DC 5J1TC 4G80A 3R1GL 3QHFH 1GOFA 5DI8A 2ZG3A 3T3ME 1S7XB 4GW5B 5F9AC 3ULVH 4QHKI 5IHZA 3QDJA 1MLCA 4F7CA 4E41A 1HQRA 2DI9A 4K3HA 3H9SE 3QXAA 1TZGH 1YPZB 4PTUA 3GO1H 1NAML 3LD8C 3L3JB 4X5WB 1M7DA 3U9PL 5SX5K 4YUEL 3FOLA 4EJ1C 2P24A 3IGAA 2EXYC 5CWSA 2CDFB 3LEVL 1UYWL 3QHTC 3BZEA 4DK3A 2HT4C 2DMBA 4RFOL 2X2YA 2NY3B 5LG1A 3IDIA 3VFTA 2PCPA 1W72A 1ZVSB 4M5ZH 4CDHA 2W38A 1CT8A 4WFGD 3NIGF 3SGDH 1FP5A 3IXTB 1T4KB 5GQBA 4YX2H 3QUYA 1NGYB 4PRIA 5A43C 1AXSA 3H3KA 2AQ2A 2YPLB 1K6QH 4X9IA 2XTLA 3MBEC 3SDXB 4HIHB 4U3CA 5GSVA 4LFHG 3SO3B 4EDXA 5CJQL 1FNEA 1BZ9B 2AAVA 4KZEL 3VMPA 3G6JA 2RR3A 5DXWA 4M7LH 4Y4KB 5SX4I 2I5YL 3SQOH 2DQTH 5EDXA 4KRPB 4X99A 5HYSB 4O9HH 3QIWC 4PJIF 3ULUC 4Y2DD 4CNIB 5E2TH 1YN7B 2DQDL 1REIA 3HE7A 2FBOJ 3KWWB 3TJHD 4GG8A 1IM9B 1K3IA 5E6IB 3SPVA 4QRUA 3SDDC 5J57B 4JFPA 2JJSC 3KPRB 1Z5LB 1FIGL 2HJFA 4L9DA 5DRZB 1N4XL 4YDJB 2V5SA 4JDZA 1SVZA 5KSAC 3QDGE 1SQ2N 4HK3N 4YC2B 2VLKB 4X7CC 1VKXA 4TNWK 1G7LA 3LQZA 4PRDB 4P2OA 4QRPE 3VD5A 3RWHA 5HYSG 1ZT7B 2WBJD 5DK0B 4G8EB 4UBDC 3H9SD 5EC2A 3LKQA 2GSIB 3UJJH 4AQ1B 3MRRA 3BIKA 3GRWL 3Q6GH 5D1XC 4JO4H 4NQSB 5D1QC 3VMNA 3MX0A 2XTJB 4YZFE 4XVTH 1FG2B 3BP6B 4RMRA 4ODWB 1F8TH 1BQUA 3BPLC 3OKEB 5EBLB 4ZYKA 4NKIH 1FSKB 2A6DB 3BO8A 4WUUA 1CR9H 2I9LB 4PJEB 3Q5OA 1BOYA 3DIFB 4L4VD 1GOHA 3VDBA 1XF5B 4QHMB 4D8PA 2NZ9D 3MV7D 1RK0A 1HH6A 1NC4B 3ULSB 2EDFA 4J3OC 4I0PA 3T4YB 3UTTD 3S36H 1MHCB 3EOTL 2XWJB 1FL5A 2B2XH 3MRPA 4NQDA 5IOPA 4I18A 1OTTD 1D5BA 1Z9MA 2RB8A 4LVOB 5TFSL 5EORH 1EV2E 2W9DL 3LN4B 1KCSL 5T3XE 3C09B 4V1DB 1G7MA 3CVIH 4NO0D 2NLJB 4MA8L 4WENB 4NKDB 4M6MH 4CL7A 4LKCB 1ZHNA 1G9NL 4O5LL 1FGVL 3MROA 2MPAH 1Z6JT 3QIBC 5H94B 1CBVH 5TPWH 1SYVB 3R8BB 1S9WB 2YSSB 1WZKA 4FFZH 1HHJB 5GGQH 1YECL 4I5BA 2X44D 3FZUD 4QOKD 5FYJD 2J5LB 4ELMA 5B21A 1EEUA 1XGYH 3ZSTA 1Q9KA 2N1KA 4BSVB 3SDYH 1QLFA 4HKJA 3QDGD 5EU7E 4NKMB 3BX7C 1D5IL 1NDMB 2IBZX 4F33A 4QRPD 3PJSA 4APQA 1VHPA 5ICYB 4NQCA 2VQUA 3S37L 4ZDHB 4R90H 4OGZA 1QR1B 3GSWA 2AEPL 4R7DB 3LV3A 2XICA 2GCYA 4LP5A 2V2WB 2ICCA 3B3IB 2Z31C 3S35H 3DECA 3KPMB 3ARED 4NQEA 5D6DC 4KK5C 2G5BA 3PL6B 2B4CL 4H0HB 4NN7C 1BQLH 4RMSA 5TH2B 4S0TD 3WFHB 2P47B 4QXUL 4LIQL 3I3DA 3V0AC 5DFVD 1HHKB 2EDWA 3WKNA 4W4OC 3TH4T 4X7TA 4MJ6A 1A7BA 2P5WD 4MZ3A 1YMMB 2IQ9L 5IVXA 4HUWB 4YHYB 2H2PC 2ZSWA 3DRQB 1A3QA 4PB9H 2PYEA 3WKMH 2CUHA 2KQNA 3OF6D 1M6OB 5FA4B 3EDDA 3V6ZA 5DD5H 3LRHA 2XPGA 4JFFE 2WP3T 4KQ3L 3DURB 1FC1A 4WV1C 5I74B 1CGWA 4KPHL 4MB3A 3U7YL 2PR4L 3TZVA 1F3JA 2CIIA 3O2DL 4PY7B 3RVWD 2CKBL 43CAB 1FZKB 9CGTA 3I3EA 3P3YA 4I3RL 4ORZC 3TO2B 1M1SA 4LRNL 2P42B 1HCFX 2GT9A 2XG5A 2OJEB 1NANI 3S34L 3IDJA 3OAUL 4H0GA 3MODL 3NGBB 4Y5XB 2I60H 3HN3A 4JDTH 4NKOB 1OF2B 2GW5A 4HIJB 5K33A 2Y6SD 4OCXH 4PD4K 1ZVYA 3DMMD 4PJ9B 15C8L 3CFJA 5FKPB 5I9QC 3WNNA 4A6YB 2NY4D 4PLJC 3BHBA 1U8PB 2NYYD 3DVNB 2BRRL 1QKZL 5FAAA 5IM7A 1TVHB 1OT1A 3NFPB 4HZLB 1HN1A 2E9WA 3T0AA 4M5YL 2YKLH 1EFXA 3NN8A 3DX8A 3ILPB 1FPTL 1WBXA 2GJ6A 4X4MA 3KLDA 3MZTA 1GOGA 4Z95H 3QWRD 3SGKA 1I1YA 4LVHB 2G5RA 2HT2D 4MB4A 1CDUA 4OGAD 3NZ8B 1OPGL 4LPWA 4GRWB 2C7UB 3ZO0A 3P30L 4Y4FD 1WAAF 5GGRA 5IBTH 5IHUH 2NXYC 1RJZA 3EGSA 2JCCE 3QUYC 5CILL 5E5MB 1KYOJ 3MGOB 2OCFD 1F3DJ 5IEHB 1UGNA 1TJHL 4OLEA 1T66C 2N7BA 1PD6A 2HAZA 4JFFD 4Z7WF 1KENL 4BH7A 2NY6D 3FQRB 3PV7A 2FB4H 2JJTA 5IB5A 2FR4A 5C08A 2LAAA 3U4EB 4RA0C 1F11A 1JRHI 2Q7YA 4LSPH 2Q20A 4MJIE 1D3CA 4GLRH 2UWEB 3E2HC 3HE7C 4Y89A 2F74B 5JMRA 4ETQB 3SKJL 1CU4H 3MNVA 3V0WL 2BSTA 1IFHL 1TZHB 3BGAA 4PJ8A 1AXIB 1TMCB 3K46A 5HI3D 5HI4C 4NHUA 4GAYA 4IOIA 5CLWA 3MRMA 5GS0C 4WW1B 5D72L 5DJ2A 5EO1B 5IQ9A 2YXMA 5HJ3A 1OB1B 4P2OC 3U48A 3O3BB 2XACC 4UU9B 1P5UA 3LKPA 2M8XA 1FFNA 4YIQB 2CK0H 1T1YB 4LLVA 4QGYA 1OSPL 1U93B 2R0LH 3BKYH 3R1GH 1AJ7H 4MXQC 2AJZB 2BP3A 1T21A 1K2DB 3ARBA 4LSRL 3ZYIA 4F2MB 5BXFB 4ZFOB 5DJYB 4JGMA 3VGDA 3DUSB 1BBJB 4FNLL 2Q87A 1F4XL 5J56B 4OIAA 4M61B 2DQUL 3SKNB 1FO0L 3ORJA 5K9OA 2VIRB 1NAMH 5B3JF 1OAKL 5DRXB 5SWSB 3U9PH 3HUJB 4OKVB 4I0PC 4YUEH 2VSDA 5CD3A 2MWCA 3GRWA 1C08A 1DFBL 1O7SA 7FABH 4I18C 2BVTA 3LEVH 1UYWH 4TQEL 4G6KL 5DJCB 4EIGB 5I1KL 2BOCB 3N1QC 1H8SA 4RFOH 3BUYB 3G5YB 4QF1A 5M94B 3HB3D 3V5KA 4WU5A 2H26B 3EDFA 4JFED 4JPIA 4XWOC 3MV9A 1XEDA 3AS2A 1MFCL 5KSBF 2DQCH 4PP2B 1MLBB 4PFEA 1PX3A 1ROWA 5FDWB 3CNKA 3D18B 4U0RB 3KPQA 4GH7B 4WEUD 5IJVB 4KZEH 2V17L 1BZQK 4U1JB 4PRHA 4Z7VE 1DBJL 5B22A 5A1AA 4G42B 3QUMH 1E27B 1YEKL 3EOBA 2A1WL 5DHXB 4FOMA 2ESVA 1A14L 4NZTL 4APQC 1GH7A 2DQDH 1JHLH 1N6QL 4X7SL 2QQNL 2IH3A 1GGUA 4GG6B 3O3AB 3ARDA 4N68A 5DUML 2JE8A 2FYYB 4YJZL 1FIGH 1N4XH 3KJ6H 4YBLC 5DDHA 4JO1H 3BW9A 2YN3A 2ZCLH 3O3DA 3QPQD 5FYKH 1J1XL 3BAEL 1JHKL 2ADIB 3TC9A 4NFDA 1MRFH 2IF7A 2OL3L 1QSFA 2P43B 4XXDB 5EA0L 2Y9RT 1I3GL 3MUY1 6FABH 5MI0C 1MHPL 3B9AA 3CU1A 4HHAA 4G9FD 3D69B 5T5FH 4M8QA 4IOFD 1TZIA 1CGTA 1PEWA 3T2OA 4U2YA 4ZS7H 5ALCH 3TZVC 4MQSB 5GRZA 2EC9T 4WWKB 3G5ZA 3TYGL 1LNUB 3V79C 1JF1A 2EIDA 4C4KO 1MNUL 4ZFFA 4LHUD 2A83B 3MO1B 3HR5A 1UWXH 3MA7A 5F7WC 4JZJA 5TFSH 1T22A 4G8GA 4PRNA 2W9DH 4IIQA 5IIEA 2PXYD 2UWEF 1HXMA 3SJVB 2IEPA 4MA8H 3U46A 5HYQA 1F2QA 5FK9B 1NAKL 4LLUB 3ETBF 1AR1D 4QXTB 4JN1L 4EQ2A 2DJUA 1ED3A 3CDGB 4O5LH 3C8KA 4ODSL 4RAVB 3OAYH 2Y4SA 4WO4B 2EH7L 3MZGB 3SN6N 1KJ2L 4I8DA 3ARFA 3B2VH 5I16B 4L3ED 4LDOB 3SE4A 4YNYA 2CKBA 1CGUA 2OK0L 1AGCB 3P4MA 1M7XA 3L5WB 3ARGD 4PJGB 2JB6A 3HG1A 2HMIC 3JWDL 1U0QA 2ITCB 1D5IH 3JWOL 1U92A 2EZ0C 2BHYA 1NL0L 4M43L 4LLQA 5KAQF 4GKSA 3IETB 1G7IB 1A6TA 3SGKC 2WWKO 3FL7A 2PETA 4FTVD 3S37H 3WLWD 3FQNA 3IDYC 3VXPB 2AEPH 5DURB 5EBWB 3P73A 5F7DA 4U1SA 3AC0A 3TBTA 4PJBA 3OAZH 2DD8L 3RY4A 5HGDA 3HUJF 1JYXA 3HNTL 5DEGA 3HCVA 2B4CH 5E56A 1A9BB 1JL8A 4FFWD 4F15C 5IQ7L 3SY0A 4N90E 1S9XB 5HHPA 4PJXA 4ONGH 4QXUH 4XT1C 1FAIL 4EOWH 5I8OH 3BFOA 1RURL 1KIQB 3MGTB 4HAFA 4LMQE 2JJTC 4J1UB 1UM4L 3LPFA 4HIXH 4XWGH 1G7JB 5I1EH 3KYOA 2IQ9H 4RCAA 1UZ8B 5FUZH 4WWID 4OLUH 2A6KB 4KKAD 4ZO9A 3BN9C 4NUJB 3PDOA 1XIWC 1Q8MA 2Q7NA 4KQ3H 5D8JL 5H35B 4B0MM 4PJ8C 1U3HB 2E7MA 4J3TA 4KPHH 2NY1C 4PBXA 1FVEA 3U7YH 1RIHH 2PR4H 1CD8A 2GEEA 4PREA 1Q0YH 3O2DH 3T1FA 2V7HB 3ZDZF 2W0LA 1H3TA 4XAKE 5C8JB 3RAJH 4ZAKB 1LP9F 3D6GA 5IMMA 3EYSH 1HHGB 4I3RH 5DRNB 1PKQB 3S34H 2J3SA 3TGXA 1MRDL 1Z0NA 2BJML 4HBQA 2V2TA 4DZBA 5EOQH 3R0NA 3L1OL 1JGDB 1OP3H 3MRLB 4B7IA 2AV1B 1I9EA 3SDAB 1JI1A 2PO6B 1HQ4A 2WBJB 4LPVA 15C8H 1EEZA 3VXTB 4L8DB 1WT5A 1PGRB 5CEZL 1PSKH 1XGUB 4JPWL 2BRRH 3C08L 4FZEL 5F9JB 2R0WL 5EUKA 3CX2A 3BVNB 4XMLL 5DO2D 3CH8A 5ADPL 2FJHA 2WMPA 4ZFZB 2XXMB 3HTLX 5F3BB 4P4KA 5F44A 4PJ7F 5CZXC 4L4VB 4HUUB 1CDCA 4D0DB 3KDMB 3RVUC 4MDIB 3MV7B 4OD3L 1ZLUH 2DS4A 4LHQB 4ELKA 1AFVL 1IRAY 3UTTB 1OPGH 4ZUVB 4WHTB 5JLZA 1ZV5A 5ELIA 3RVVD 3HMXL 3P30H 1KULA 1FO0A 4OZHA 3MRDB 1AKJB 2ICWB 4PRBA 4S1DD 1B4RA 3M1BA 4NO0B 3IS1X 5DHYA 4KUZL 3QJHA 4HT1L 2R15A 1RZGB 3X14B 4PJDE 3QQ9D 2Y7QB 5ANME 5DJ6B 1NCAL 5F6HI 1IKFH 4HXBH 5HHOA 4I4WB 1WWWX 3DETD 4OGXL 4X9HA 3QT2A 1G9NC 4HKXB 4QOKB 3BZ4A 3BP5B 3M45A 1J8HE 2BVOA 3KGRA 4BQBA 3NPZB 3SKJH 4BQ8A 1MVFA 1IFHH 4Z0XB 3STZB 1XZ0A 5IG7A 4OV5A 3ARDC 4R96B 3U4BH 3OXRA 43C9B 4TUKH 4OLZL 5IR1A 4K7FA 5D1ZA 4QWWC 1KIRA 3UX9B 1A0QL 4Y1AA 4AL8L 3NFNA 4LHJB 4IS6A 3W2DL 3PQYA 1OSPH 5EPMA 3AREB 4N9OB 4KV5E 1EJOL 4POUB 3GSNL 2VERN 3MBED 1DL7L 1YEJL 5BRZB 2A2QT 3IF1B 1N5AA 5DK3A 5C6PB 3IDNB 4U1IA 4F3FB 8FABA 1CD1A 4FNLH 2Z4QB 1F4XH 5GXBB 1PJ9A 3CUPA 4NP4L 5D7LB 2DQUH 4CU8A 1DVFA 1TFHA 2P5WB 3V0VB 3O4LD 1ITCA 1OAKH 3QIWD 3MUZ1 4V2CB 4YDVB 2AEIT 4YE4L 3ULUD 4OFYD 3C2AL 5J7CC 1DFBH 5JOFA 5J6GA 3NCYS 5I71C 1BJ1J 4TQEH 5I1KH 4G6KH 3SDDD 3FFCE 1NFDB 3U30C 3G6DL 4IIQC 2I9TA 2DAVA 3HA0A 3MXWH 4JRXE 5KVFL 3BEWA 5H2BB 3M07A 4PLNC 3NH7L 1IC7H 2XZZA 4OM1L 5E9DE 2W92A 1UCTA 4V2BA 3QO1B 5HY9A 5EIIA 4XNUL 4UBDD 5F1KC 2DYPD 3TA3B 2JB5L 5J13C 3OJ2C 1AGEA 1DN0B 1J8HD 2VQ1B 3TN0A 2XNAB 3SE4C 3NZHL 3MLUH 3P11L 5C0BB 1PQZB 2P5EE 3WXVL 2V17H 2GK2A 3VGEA 3QXWA 4OZFB 4F80A 3DMMB 1DBJH 2ZOKA 3T3MF 1JWMB 3EDKA 3MQIA 4F9LA 4FMFA 1ND0B 2NY4B 2A1WH 1EEYA 4YHOL 3LKRB 5CEYB 1S5IL 4RNRA 3T77A 5F7YC 1A14H 4WY7L 3BPCB 3HRPA 1F58L 2QQNH 2E9BA 1BIHA 1WCBB 5E8OB 1RMFL 2J8UE 5DUMH 2IAMA 4OZFG 1INQB 4YHIB 4C58B 1YDPB 5F7MC 4PR5A 1NGPH 3W0WA 4IBLT 4Z5RB 3L95B 4YDLB 1R5IA 3MRFB 2DJSA 1ZXQA 3LS4L 3CFBB 2W60A 1UVQB 4W6XB 3ZKXB 4U6HA 4CU7A 5MEPA 4TRPH 3BAEH 1JHKH 1NPUA 3QUKA 4YLQT 2OL3H 1F6AA 4PJ5A 1RHHA 5FO9B 2HG5B 2NQCA 5EA0H 1I3GH 3OKNB 3I6KA 3QQ3A 3QWOA 1MAML 1Z9LA 1MHPH 1G9MH 5EBMB 1FFOB 1RD6A 4QHNB 1MCHA 4YGAB 2NY6B 3CSYB 1N26A 5M7QA 1SHMA 4IM8A 4XP5H 4H25B 5D9SA 2DLHA 3MV8E 2YC1B 2X4RA 4L8CB 4HZAA 4HCRA 1YYML 4NRYB 1QRNE 5I1DB 1MUJA 4E41E 2X05A 2D0HA 1Q94B 4C56D 1D6EB 2Z31D 4P3DA 1NEZA 3IRPX 4JFQA 4OAWA 3S88L 5DHVH 4KK5D 3ROOB 5JPMB 2BDNL 2W65A 4WW2A 1NAKH 2GUOA 3DBXB 4U1MB 4JN1H 5H37G 2YD4A 2GTZA 3G5VA 1LEGB 4ODSH 3DO7B 3MOBH 3PHSA 3BRDA 4JAMB 1E28B 2EH7H 5DEFA 1RUPL 3RJQB 1XR9A 2DRUA 2APBA 1QO3B 1L6XA 4GRMB 1WT5C 1HWGB 4Y4HA 1KJ2H 3C8HA 1S5HB 2Z35A 5AAWA 5DMYA 5IW6A 4QXWA 1FZJA 4YZFF 2H2PD 5C0AA 1AY1L 2EO9A 3T0EE 4IRSA 2AERT 5ERWA 3JWOH 4P5MA 4JFXB 4LRIA 2EDXA 4P4KC 1NL0H 4M43H 2KUTA 1BLNA 4FQXA 2V5MA 1DBBL 1U8HA 3O8XB 1H3PL 1KB5B 4XNMB 4XP6H 5EIQA 5TE7H 3D0LA 2KDGA 2LV4A 4RX4D 2F8VA 2NY2C 3MUGB 5IP4A 1P84K 3FB7A 4YK4B 3STLA 4EI5B 4QY8A 2DD8H 3TFKD 3BYYA 5AD0B 3HNTH 4JHWL 4DKFL