4EVNA

Crystal structure of fab cr6261 (somatic heavy chain with germline-reverted light chain)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
221
Chain Sequence
QVQLVESGAEVKKPGSSVKVSCKASGGPFRSYAISWVRQAPGQGPEWMGGIIPIFGTTKYAPKFQGRVTITADDFAGTVYMELSSLRSEDTAMYYCAKHMGYQVRETMDVWGKGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Heavy Chain
publication title Structural and genetic basis for development of broadly neutralizing influenza antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 221
sequence length 221
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2012-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4evnA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4evnA01
1IAIH 3QPQC 1NGWB 4RNRA 4RZCA 5DSCB 4U05A 4WGWB 1W72L 3FMGH 2GSGB 2C1PB 2Y5TA 1M4KA 1DBMH 4NO0A 2XFXB 1MWAH 2YXFA 3C8DA 2ORBH 3EKCA 3WEXA 4GKZB 3L3KB 2M26A 4CVUA 2EC8A 1I7TB 2VR5A 4JR9H 4G7YH 2QSVA 4ZUSA 1RZJC 1A0QL 4EDWH 1RZFH 3K1KC 4XCCL 5SWZE 1KXVC 3NMEA 4KQ4L 4QTHB 3LKSA 2UZYB 4WHTB 2G60L 1N7ML 5C86A 5ETUA 2I60L 2OMNA 1FFPA 3QO0B 3MLYH 4U6XB 1IQDA 1WT5C 4PR5B 1DBJL 2XV6B 5BV7H 1A5FL 4WWID 4HK3N 4NJ9H 2EIEA 3DV6A 4JQIH 3MGAA 4R4BB 5L88H 3FB5B 1GCFA 4LLVB 4GXVH 5FK9A 4HWBA 1FHGA 5SWZA 2UVEA 4JFHD 4LARH 4WCYH 2CGRH 4BH8B 2ZUTA 1RJYB 3DURA 4JO4H 1EXUB 4WENB 2WLYA 4M00A 4HPOL 2WW8A 5F1IB 1JNHA 1U8PB 3JV5A 1T21B 4O00A 5E7BA 3VXUB 5GGVH 5DHYA 3PV6A 1F11A 3B43A 2IH3A 1OSPH 1KT2B 2AJXL 1I9RH 3OAUL 5CINH 4XP6L 3MLXL 4MQTB 1W0WA 5F7MC 5E1AB 3OF6D 3VWJD 2VMFA 1KYOK 4XNQB 3ZHKA 2AXFB 1W0VB 1DL7H 1SM3H 3AS1A 1NC4A 4G9FE 5D4QA 3HMWH 1AO7A 1CICD 1XR8B 3DLQR 1UZ8A 1Z9OA 1F8TH 4HGWA 1R3KB 3ZT7A 2HLAA 4MS8C 4MNGB 5FGBC 5HYJE 3NN8B 2P4AB 1QSEE 4JZNA 3T04D 4GAFB 5DEGB 5JNYA 3D48R 2QV2A 5L2KB 1A2YA 1RUAH 3KPLB 2NY7H 5C2BH 2EH7H 4UTAL 3W39B 2R69L 4G9FA 2CRIA 3G5ZB 5HYSA 3RNQA 2I07B 1BX2B 3PE9A 5HDQL 2DJUA 2VSDA 1HHKB 3BGFB 4OF6A 4WRLA 4XPTL 3VFWA 3KYMB 3P4MA 4OT1H 3SY0B 4F37K 2WBKA 1HHIA 2A9NH 5E5MB 3QFDB 5HYJA 2A73B 1S7SA 1CG9A 2ADIA 1IGTB 5LXGL 3IDNB 5D5ME 5E8EB 2J1KA 3QHFL 5GRYA 2DQFB 5DFTA 2QKIA 4NO2B 2BJML 1XGUB 5ICXB 1CIUA 1U9KA 5B39G 4Z76A 4TTDC 3P73A 1AP2B 3CLFL 4AEIH 3FO9B 3FZUC 3Q6GL 4X6DE 2WAHA 5I0DA 3MLSH 5DMJB 4NNPH 4UUJA 5J89A 1FFOA 5D5MA 2X1XR 3DETC 1IM3B 1U8JA 3IXAA 4DVRH 4LEXL 3TBYB 1U8KB 2CJUL 4FZ8H 1S7TA 1NCCL 5KTEH 4WI3A 1FG2A 1PZUB 1ZXQA 1EK3A 1AXTL 1DBBH 3EYSL 5IR1B 1HWGB 1G9NL 3IRPX 1KLGB 1NMCC 1LK2B 4X6DA 4PJXB 3Q3GB 2OSLB 5HJ3A 3S3PA 1HQRA 1FZKB 4AEFA 2WBJA 3OSKA 2N56A 1ORSB 4W70A 4OV5A 4D9LL 1KJ2B 3C8KA 4KDTC 4XMPL 4YPJA 2UZXB 1QOKA 4G6MH 1DSFH 3MNVA 4FQ1H 4POYA 3TCLA 3KPRB 2HN7B 3C60B 4PBXA 1NCAH 1X7QB 1I85A 4WJ5B 5DMKA 5D71L 5J13C 3ZSTA 1YN6A 3OKKB 3KPQA 1BLNB 3U83A 1BGXH 3SGKC 4MJID 5B8CA 1WFTA 3M17B 1YPZB 2BCKB 3FT2A 4JDTL 5I19H 3S36H 3NFSH 5JOEA 5FIEA 3SDAC 1OSZA 4M9OA 4NT6A 4PG2C 3VI4F 5FKAB 3ULVL 1PBYA 4MX7A 4X98B 1LD9A 2DM7A 5GGQL 1NLDH 4LIQH 5GGSA 3ZKXC 4KMTL 4ODHH 2A6KB 1UACL 1DN0A 3CFBA 5K9QI 3EOAA 3FN9A 1JPTL 4KK8D 3VFPB 3WFEL 1NFDB 1HOCA 2GFBB 4MNHA 2DLFH 2R4RL 2DQHL 5D1QA 1I75A 3P4NB 4OCRH 2G5BB 3QDGD 1QVOA 2PW1A 3RL2B 3DX6A 3HC3L 5A2FA 2F5BH 4D9QD 2YD8A 1FFQA 4FQLL 1GPOL 1JZ7A 4JRXA 1UEMA 3MRDB 3U9PL 1PD6A 1WAAF 3I3DA 4DAGH 3BP4B 4GRWH 4F7CB 5L8JB 4NPYB 4OF5A 4DZ8A 1KJVA 1KGCD 1KTDB 2D0FA 3TJHC 4FQHA 2B2XH 1RUQH 4L8BB 4GRMA 4GG8B 5CD5C 2JB6A 3OAYH 1G9MH 5LGHL 4NZTH 1ZHBB 1JHLL 1FYTE 1I1YA 1ZLSH 2OJEB 1TJHL 2R2EB 4PJBE 5ANMA 3ZHDA 3QDAA 4ALAL 3ARBB 3HRPA 2CKBB 3NACH 4ONHB 5KSBE 2J5LC 4M6OL 2F53D 4JCMA 3BIBX 4M48L 3H3BC 1CE6B 2R0KH 1IBGL 2E6QA 4U1SB 4H1LB 1QBLH 3BPOB 5H37G 3RWDA 3KPRD 4QRRB 3C60D 4FQQA 3NFPB 4KZEH 4JJ5B 5EU4A 2R1WB 1ERNA 5C0AD 5D7LB 3QI9C 3GSNA 2AEWA 4WI2A 4Z18A 4PJBA 2J2ZA 2B0SH 2WIIA 4DOHB 5KSBA 3WDHA 2NX5E 3H42L 4WW2B 4JFDD 1UH2A 3SGEI 3I50L 2JLLA 2H2SD 3AY4C 1NGXB 1MF2L 1PDKA 1OPGH 3S97C 1AH1A 2PXYB 5D2LA 2R2CA 3CDCA 5FKPB 1C16B 4NQSA 3SQBA 5I1JL 4FNLL 3TT1L 3ZDXE 1NUDA 1MHEA 4U6YA 1FNLA 3IFOA 5LBSL 4N0YH 3OKLA 1X5LA 3ZT6A 1YNTB 4XAWH 4HXAL 4PRAB 2NX5A 2ZG2A 1JYVA 4U1IA 1RMFL 2OTWA 5F96L 3SE9L 3QWRA 3K46A 3GSVB 1V7NH 3RTQB 4YEFA 4OD2A 4LAJH 3OGCB 3SDCB 1IGYA 3BEWA 4O4YH 2A83A 3V4VH 1KCVH 4G8GB 2B5IB 3KDMA 4AIXA 1OTUD 3BPCA 2HYMA 4LHUA 3G9VA 1QUNA 2DQIL 2J8OA 1SQ2N 3OR7A 4JO1H 1R5IB 4HBQA 2LVCA 1DEDA 1T4KA 2L7UA 3AFLA 1BFTA 1ZHNA 2NLJB 4HCRL 1JGDB 4M8QB 1FFNB 1ZA3A 2WZPD 5BRZE 3VFRA 1KSRA 2EEAA 1LO2H 4AMKL 3RVTD 2IPKB 2R2HB 3LN9A 3KPOB 1KB5H 2ZPKL 3RVUD 1I9EA 1LO0H 1FV1A 3GB7B 3WO4C 5HYQA 3ARBD 4KY1L 4MQSB 4Y1AE 3PL6B 1EEUA 1UH4A 1J8KA 4P2QB 1U3JA 1JNJA 3EYOA 4LOUC 2VISB 2BY2A 5CJQL 5BRZA 3I6KB 4ISVA 4QRRD 3JTTA 2BNUA 3IDUA 1C12B 1OP3H 5D7LD 3SKJH 5GHWL 2RBLA 1IC4L 3GHBH 3WIHL 5I2IB 1CGTA 3QFJE 3WS3A 1E4XH 3HZKA 4D0DA 1JZ4A 2A6IA 1IC5H 2O93L 4GMTL 3K2MC 4XVTH 3QUYD 1WC7A 5IHZB 2NY5L 1SBSL 5EG6C 4FQ2L 4PUBH 4IRZH 4YHLH 3LN4B 3AAZB 2PW2A 1MFCH 1J8HE 3N06B 5C0BE 3QFJA 4KK9D 2GAZA 4NIKB 3SKNA 1I8KA 2IADB 4Z7WB 1MIEL 2DICA 2DI8A 4OZHF 4NKIL 3RTQD 2IANB 4JN1H 2JIXA 3CX2A 2XNAA 4JPVL 3SDCD 3QEGH 2EDNA 2AJZA 4G8GD 5HPOA 1ULVA 4KHXL 4R8WL 5TFSH 4C4KO 1ZA6B 5ID1B 3LQMA 3O3BB 1J8HA 5DFVD 4YGVB 1QTYT 3K74B 2HJLA 4NHCL 5C0BA 4JZJC 1OHQA 3CVHB 3UJIH 3N85L 2IFGA 5C07B 1BF8A 3MROA 2NY1B 2HH0H 3C2SA 3RVWC 2ZCKL 3JBG7 2P48B 2VQTA 1IQWH 3MXVH 4M6ML 4X8JA 4P2OC 5FO7B 2O5XL 2BSED 4Z7OF 4P2RE 1HKFA 1IEBB 1KCSH 1R3JA 1E6OL 3MJ9A 1G7LA 4EI5B 3KXFA 5T5NF 3NCYP 4DZBB 4HZAA 4UT9L 5DMGC 5D2NC 4YR6A 4P99A 1CLOL 5EOTB 5JIPA 5M7QA 5IWLC 2R9HD 2FLBT 2Y6SD 4AH2A 4JY6B 1D6VH 1EAJA 3IU3A 2WMPA 1XGTA 4P5KA 2RCSL 4PJHF 1FVCA 1YECL 1P4LB 1CR9L 3G5YA 4TUJA 4P2RA 3DHMA 2EDJA 1F4XH 5D8JH 4Z9KB 4P2QD 1DLHA 4JFED 1XF5B 5CS7A 2XZZA 4E41D 2IQ9H 4ZPVB 2NW3A 4J1UA 4XHJC 2BHUA 4HIIA 5DLMH 1NEZB 4I0PA 1CGSH 4HAGA 5KAQF 4RISH 1HHHA 4H0GA 1HILA 4N8VB 4TQEH 1TZIA 4RA0C 5C08A 2FECL 3RWFB 5IHLB 4NZRL 3SGDH 3JWOL 4R26H 1I1AA 2APXA 1W72A 1KUMA 5KN5A 2W0PA 1QO3B 4NRZA 2CLRB 4WEUD 5FUZL 3S35X 4LNVA 1MCWM 3UYOD 5H2BA 3WHE0 4MCZA 1OP5K 4UDTB 4KJPC 4KUZL 5T33H 1SMAA 3TPUB 4NC1E 4PP1D 4H8WC 5CJOH 4GT7A 1HZHH 3U0PB 4XAKE 1B0GA 4JY5L 2HVKB 5INDB 3FFCB 3IETA 4KI5F 2NR6C 1BM3H 4JJHA 1UH3A 3LMJH 4WV1B 3BSZL 2AKRB 2K1MA 1HSAA 1U6AL 4G8IA 4LCCA 3O2WH 1ZAGA 2NW2A 4HH9B 1IEHA 4WVRA 1N64H 1NH6A 4ODSL 4CUCA 5C07D 4E0RA 2XA3A 1A7OL 1GSMA 2VC2H 3DX8A 2VQUA 5EU6E 4Z0XB 3NFNB 2VAAB 4H20L 1BOYA 4OLXL 1K4DB 3BGMA 4EI5D 3CCHB 5DK0B 1ZLUH 2FIKA 2X4PA 2R15A 4LU5H 2P8MB 3I75B 4IOFC 3CXDL 3BP5A 4JO3L 4L8DA 1JMZA 4WI7A 1J9CT 5ITBH 5EU6A 5BJTB 4GAJL 4M7JH 2YD2A 4Q2ZB 4H26A 4XMKH 5CEZH 4ZSOB 1NFDF 3T77B 3N50A 2R1YB 2RFXB 3TZVB 5IQ9B 1B3JA 4FQXD 4MA3B 1VKXB 3CMGA 4S11A 3NCCB 5D7KE 2XN9E 1HHJB 3LS5L 2Q8BL 1VSCA 3MOAH 5E6IA 5LG1A 2GYSA 1JBJA 3QUZA 3LS4H 5IGXL 1RJZA 3OQ3B 4EOWH 4JZOB 3IJSB 3TFKD 4UMGA 4R90L 1KPUA 3LZFH 1MAML 4K23L 2YC1B 1OM3H 1LEIA 3DBXA 2ED8A 3ZSSA 5FB8B 1CGYA 3SCMD 3TIDB 3D69A 3U6RA 1C08B 3L3OB 2APVA 3D25B 1M1SA 4O2EB 1FZJB 4Z7UB 3T3MF 4X7FC 3MJ8A 2VDQH 3KVQA 1R6VA 2EDHA 2NY4B 1DEEB 2VDML 2CUMA 2P24B 4ONOA 2VERN 1GHFL 1I7ZB 1YY8B 3ROOB 2EXWD 1IGCL 5DJYB 3GMPB 1H3TA 3WXWL 2CRYA 1P1ZA 4J23A 4ZODA 5DJ0A 1IAOB 4R4NC 2ILLA 1EFQA 4WUUD 1HI6A 4R9HA 1IL1A 3ULUH 1CFSB 3O4LD 3KR3H 2LU7A 4NM8H 2CO7B 3P11H 2WBJC 3OJDA 4KJYB 1JHKL 3MV01 1HYRC 4RGMC 3V5DA 4KQ3H 5H94B 3A6CL 3H6JA 5CJBA 1OTSD 3SDXF 1VENA 4Y4FA 2K7QA 2FECI 5JW4Q 2VXVL 2XRAH 1I85C 1ZWIA 3B8SA 3GIVA 4J8RB 4JAMA 2QEJA 3B2VL 4OCMC 4UU9A 2X4QA 4JGUA 1HWHB 5B8CC 3VDAA 3J8F7 3RPIA 2HLFD 5CLWA 2G9HB 3BZFB 3E6FB 1YEGL 1L6XA 3NPSC 3GZKA 1WBYA 1MQKH 3DXAB 3H7BA 4N5UA 1DUZA 4JM2B 3IB4A 1GGCH 3VFOB 2HT2D 3IRZA 3TZVD 3ULVE 1D6EB 4XB7A 3RU8H 4L9LA 5GZNC 3ZYOA 3S7GA 1QFUL 5EUKB 2OR8A 2VABA 5F3HA 1T22A 1L9NA 4GRLA 4NFDA 5I8KL 1MVFA 4L1DA 4NQCE 4IRJD 4TSCH 4IS6B 5E2VL 1TTUA 3MJ6A 1ZGLB 5GRJH 3VFNA 1G7JB 5D1QC 1BVKB 1V3LA 4H0IA 4PRBB 4X8XA 1PLGL 3M45A 4ODWB 4YDVB 1IZJA 2P45B 3OX8B 3DTXB 4PB0L 5FYJL 3CIQA 4OZFB 1JWSA 1TJIH 5I75B 1D9KB 3HR5A 3I6GA 4I48A 4OUUA 1QPXA 5BQ7A 2EECA 4NQCA 4QGYA 4BSVA 3LD8C 4MSWA 3RGVB 1SJXA 3B5HA 3HZMA 4XPGL 1CDUA 4HAFA 4JDVA 3O6FB 4U1HA 1A3RL 2NY4D 4FA8A 2QADC 3VJ6B 3O9WB 1FBIL 3MLWL 4PJFE 1F3JA 2XA8L 3S5LB 4ZFOA 5EA0H 1A14L 3DMMA 4PP2A 4Y7MA 4DK6A 5F3BA 4HKBA 1LO5A 3VXRB 5TQ0L 1D5IL 2XWBB 3PQYB 2VXTH 4ZUVB 1M6OB 5IIEB 3H9ZA 1FVEA 5IB2B 4Y88A 3W9DB 3AB0B 4OGYL 2F15A 4QRUB 3UO1H 2DMKA 5F9JB 1MEXH 4PJ7E 3WFBH 4PJFA 5CHNB 2O5ZL 4TULL 5E8NB 4HFUH 2HG5A 2P7TA 5D6CB 5J11B 3QWOB 4RWYH 3NZHH 2E3VA 3QDME 1TQCB 3C9NB 3MV8E 1YMME 3V6OE 2XY2A 2FX8L 5IVXA 7FABH 2WV3A 1YZZA 3D5OF 1GGYA 1MJJA 3TC9A 2Q86B 1BBJB 2G75B 4PJ7A 3EYQD 3DXAD 1A4JA 4EN3B 5C09A 4XNZB 4Z95H 4JM2D 1VB9A 4AEHL 2X10A 5J1AA 4FFZL 3UMTA 3U4EB 3MV8A 1YMMA 3RY5A 3V6OA 4FRWA 3PDOA 4LLUA 4FQCH 2AGJL 5I16A 4ONFH 2UZIH 3CC5A 1C5BL 3SKOA 3WNKA 2JCCA 5HHQB 5I74B 2DQUH 1QYGL 1AGFB 3QNZA 4E5XA 3V4PH 1FGVH 4LLMA 1FORL 3ESVF 1Q94A 4HH8A 3QHTC 2BNQB 1CYGA 1D9KD 1UM4H 3S4SG 4G3YH 5I17A 3UTSB 1A9BA 5I15H 1U3HA 4FTVB 3B9DA 1R3LB 1N2RA 1VADA 3EYUL 4KJQD 5MI0B 4XVUC 5F7KC 3MCKA 3WSQL 5ICYB 3O41B 2I27N 3O6FD 3IDGB 1BIIB 1OAYL 2X1OA 3BKJL 5I1AA 2I9TB 1F90H 2FRGP 1WWBX 4KUCD 4Y89A 4PGEA 1ZT1B 4WNQB 1YYMH 4OLWL 4NWUH 4FQIH 1T1WB 3EO0B 1LE5B 1G84A 5DTFA 1MRFL 4G5ZH 5I8CB 4YFLF 3PQYD 3KS0H 1G6RH 4UDUA 3TN0B 2FO4B 2D0GA 4BKLA 4A6YB 1NCWH 1GGIH 2HT3D 1PZ5A 1I4FB 1HCVA 2ZSVA 3MRKA 3B5TA 2BY0A 1I1FB 4JRYE 1U92A 1INEL 2O5YL 2ZCLH 4JFOA 1PW3A 2JF1A 3BP7B 2J8UB 3N1QC 3P40A 4YHKL 1JGEB 1WZKA 1J05A 4NKOB 4ZUUB 4R7DB 3X3GL 4K9EC 2CDFA 3QIWA 4F7PB 4WTWA 5LAXA 5T3ZH 1K8DB 1CL7H 2FNBA 2XZAH 5F9DC 5T5FH 5A16B 1CK0H 1JI1A 4JRYA 5HI5C 5JR1L 5HHXH 3PWPE 2A6DB 5IVOA 1TCRA 3GMNB 1T2QH 4M61B 3C09C 3T0ED 3OKOA 1NBQA 4NGHH 1IAKB 3JTSA 4PRHB 4HV8B 1YNKH 4LVHC 2EIDA 2BC4B 4M1CD 2WQRA 5D6DA 5E0QA 5J6HB 5DD3H 3RUGF 4S1SL 1RZKL 2FX7H 1UT9A 1IGML 4OZIF 5BV7B 2D4FA 4XVJL 4OGZA 4QKXB 4PTTA 1NAKL 1FPTL 4OB5H 1KG0A 4MD0A 3MREA 2ZKHH 3MV7A 4C59B 2VZSA 1KJMA 4PJGA 5CBEA 2BNQD 3H9SE 5B21A 4UZGA 3UTSD 4QRSA 4FTVD 3LDBB 3L6FA 4GSDL 1FZMB 1XIWA 3EO9H 4I5BB 3T09A 43CAA 3FRPG 2D03L 1A7BA 3FT4A 3O0RH 3BKML 4YXLH 4H0HB 1ND0A 3TWCL 4MQXC 4MJ5A 4ZD3H 4NQTA 5GS0D 2ADGB 2VLRB 5EOQL 3CX5J 5C6TL 1CT8B 5K9JH 1HQ4B 4ZAKD 3MRFB 1NAMH 4AJ0A 4CW1A 4HMCA 4R96A 3H9SA 4WTZA 3SJVB 3JWNC 3L1OH 4HULB 4FZEH 1RU9L 3V7AG 3HB3D 1G9EA 5JXEA 1K4CA 3R8BB 3WDIA 1MRCH 4RCAA 5FYLD 5KVEL 1T7ZA 3BKCL 3RRQA 2BSRA 5FGSA 3TN0D 5JZ7D 2AJYH 4NQEB 2W9EH 1Y0LB 4GAYB 3RX5A 1MI5E 5DWUL 1Z9MA 3VXQA 4F33B 4BZYA 1A0QH 3QSKB 4I0PC 3TO4B 3QEHB 2H2PC 4KAQL 4P3DB 1Z5LA 2XPGA 2OK0L 4U3CA 3VFVB 3LH2H 5ICZA 1JF1B 3HPJA 3HG1B 1WIOA 5FUOH 4Z7UF 4NZJA 2CPCA 4OD3H 3UC0H 1I1AC 1MI5A 1S9WA 3O11B 4QHKJ 1OL0A 1C8PA 5ALBL 4OD1H 3UTOA 2NPLX 2J4WL 1TNNA 3QIUB 1AGCA 4N90D 2OL3H 4YHNB 5KZCB 4IMKA 4PRHD 5DZLA 1MHHA 3X11A 1QLEL 3UAJD 4Y2OA 4LLYA 3NA9H 3BQUA 4CVXB 4V1DB 1ZHKA 5CILH 3WD5H 3ZKMD 5I1EL 2I9LA 3HZYB 4ZNCD 1Q0YL 1G0XA 2V2XA 4MXWH 3MRGA 1ZKAA 1IFHH 4LCCC 1UVQA 3HUJB 2AJXH 3ILQC 3OAUH 4XP6H 3MLXH 2JB5L 5F88A 4NC1C 4XGZA 5C0DA 5JORA 5E03A 2B1HL 5H35A 1BAFL 4YZFE 1OTTD 2PO6A 5C0CB 1A9EA 3RWHA 4TVPH 3R1GL 1CDYA 4XI5C 3LEVL 3WLWD 2D2OA 3HE7A 4U6HA 4X0KA 3O3EA 3STLA 3VWKD 4XPFL 2VLRD 4P4KA 4OF3A 5A2JH 2ICWB 3MBXL 4L3EA 2X4OB 2KDGA 3OKNB 2DLIA 5DYOA 3SJVD 4HHAA 1SEBB 3P0VL 4I3SL 4YBLB 3GUTB 1J1XH 1L7IH 3DVFA 2FLRT 4QY8B 3UTQA 2F54B 1FG9C 1OD9A 1ETZB 2VLJD 2WWKO 5DDHA 1GZPA 2P47B 2CKBL 1EMTL 1MHCB 2D31B 3LQZB 3QG6A 4PJEB 3TBTB 3OPZL 4JG0L 4NQED 5HDQH 4XBEH 1LHZA 2P5WD 3IFNH 5DUML 3D85D 1GZQB 1NQBA 3MLUH 2FBOJ 1R5WB 2R0WH 4PRNA 5CP7A 5E6IC 4XWOD 2GTWB 1R0AL 1WSST 3QUZC 4KXZH 4X7DC 2JELH 5IB4B 3SGEH 5KG9A 2AXGA 1UB6B 2WINA 3ZKQD 3TBSB 5CGTA 5F9OL 2VDOH 4YE4L 3CFJA 1LP9B 1P7QD 4H25A 4LRIA 2FJFA 1NCDL 4M43L 1AQKL 3NCFB 4KKAC 1BVZA 3C6SB 4XWGL 5KZCD 3KYNA 1OF2B 1UCBL 1NCCH 5DJ2B 1JN6A 1KFAL 1AGBB 4V1DD 4GRWB 3G6AA 1RZ7H 2VTFA 3GEWB 3ARGB 2XWJB 1K5NA 5E8PA 4PJAF 2IG2L 3HNTL 1IT9L 2QTEA 1EHNA 5J6GA 2FWOB 3CDYA 1QA9B 4K71B 3WUWG 1KF9B 4KTEL 1U8OA 2NXYD 4PJ5D 3GKZA 3MRBB 2VXUH 2FSEB 2NTFB 5C0CD 4UT6L 1SJEA 5KJRL 2IPTL 4Y2DA 4F8TA 1MHPL 1HXMB 4Q9QH 1MFBL 4Y4FC 3BH8A 1WTGT 1LNUA 3FQWA 4HIEA 5HGHA 5IMMB 4OLZL 4C54A 4PGDB 5GSRB 3L3IA 5IBLD 3M8OH 4HUKB 2NY6C 4M7ZB 1BHGA 3U30C 3ZE0F 5GGQH 3SPVA 2F54D 1TZGH 3EGSB 2X4TB 4P3WA 3EFFA 5I1HL 1KOAA 5EB9A 1J5OL 2PYEB 3EOTH 4HX1A 3VD4A 5GS3A 3WFEH 4GXUN 4PJDE 4EBQL 3FQTB 1P69B 2DQHH 3RI5F 3DGCR 5ESQA 3RWCA 4C83A 3KPNA 1WWWX 4B7IA 3MLTA 5TE7L 2CDGA 3HC3H 2GJ6E 4GRLC 5E2TH 5F9WC 4IRSD 3VMOA 3Q5OA 4YO0A 2W92A 1WCBA 1BJ8A 3QQ4A 1KIUA 5MERA 5AG9A 2EDEA 5A2IH 4PJ8B 5BMFH 3ULVC 2OJZH 5IHUH 1YEFL 3MGOB 4JKMA 2GTZB 5FYJE 1KTLA 4TVSa 3Q48A 4U3HA 2IAMB 4L3CA 5CZVL 3REWA 2YPLA 2GJ6A 5ENWA 4WFED 3ZE1F 1BJ1J 3U0WH 4LSPL 1Z9SA 5ADPL 4QRTA 2H3NA 2GUOA 3ZTJH 5IF0A 5EN2A 4XCFL 2NZ9D 1SYVB 5LGHH 1QD0A 2P8LB 4U31A 3H7LA 2CUIA 3BESR 1DJSA 3ARGD 3P0GB 3BEVA 5DF0A 5IW6B 3IDMA 3RP1A 5KBNC 5T1MA 4M6OH 5F1NA 4CDGC 3DMMC 2ATPA 2VDPH 1BOGA 2VE6A 3MZGB 1GC1C 4PREB 5EC2B 2Y1VA 4E9LA 4IIQB 5T1KA 4ELME 3CVHL 1MLCA 1VGEL 3VGAB 1KB5B 1PG7X 5AUMA 5FCUH 3DO7B 2J8UF 2P8PA 1EJOH 4JFXA 5DJAB 4MVBD 1XR9A 4LDOB 1LGVA 5F97E 4KROB 4Y4KB 3H42H 3NZ8B 1QACA 3B4NA 1RHHB 3I50H 3UBXA 3LB6C 1L7TL 4MNQB 3DGGB 2Q7NA 1MH5B 2OP4L 3RVVD 4FNLH 1A6WH 5J3HD 1TJGH 3GSXA 3TYGH 2ADFH 4MAYD 1V5JA 4O02L 4MXQD 2NYYC 3EYFA 5HGBB 3V5HA 4HKJB 1JNNL 2F19L 2PYED 1N0XL 6CGTA 3G08A 5A2LH 1CLYH 3OXRB 3U7YL 1FO0H 3RY6A 4NUGH 4DCQB 4P5MB 1T3FB 1NKOA 5MP6H 3V6OC 1NGPL 3D87B 2NZIA 5DJXB 3RWIA 1YNLH 3P4LA 5BZDA 3CFCH 5IEHA 4OQTH 3F7PC 4X9FA 1U93B 3QNXB 1UKSA 4LSDA 3HRZB 2DQIH 5EBWB 1NGWA 1IILE 2P42B 1G6VK 2OR9L 5J57B 2APFA 5I18L 2GSGA 2ZZUT 1ACYL 2C1PA 4WI9A 3LKNB 4UV4H 4HCRH 1U3HC 1MCIA 1XGYL 2XFXA 4GG6B 2V5YA 3QDJB 4I9WD 4G6KH 2ERJB 1P7HL 3DHJA 1U58B 2BVEA 3L3KA 1VEMA 1BPVA 1I7TA 2P49B 1S7WB 3GJFH 3L5IA 2A1WH 3GK8L 1KENL 2OM5A 3JUZA 4QTHA 5F72S 2FBJL 4FFYL 4WHTA 5ERWB 2YR3A 3CVIL 3WFDH 2P5EB 5CJQH 4B0MM 3QO0A 4U6XA 2Y7QB 2EC9U 4PR5A 1GAFH 2MFNA 5DR5L 3LN5B 1F00I 1DFBL 3VXUE 3NCJL 2FX9H 4C4KT 1IC4H 4R4BA 1KEGH 2FJHB 3FB5A 3A6BH 2OXHA 4LLVA 4JHWL 4KROD 2F8OA 4PJIF 4Y4KD 3ZE2E 2BRQA 4UQ2B 5GS2D 3LY6A 3ARVA 2HMIC 3J7HA 2CIIB 5I8OH 4LDEB 4BH8A 1RJYA 1EXUA 2FJGB 2E7HA 3RI5K 3ES6B 1AXSB 5F1IA 2MKWA 1U8PA 1T21A 3QIWC 3S35H 3VXUA 4LSUH 1S78C 3WFCH 5GGUB 4LCUB 4MNGE 3GSQB 4NN7C 1KT2A 1U2HA 1OAUH 25C8H 5E1AA 3K4AA 2DLHA 3DSFL 3BZ4B 4XNQA 4IJ3C 4LQ1A 2AXFA 1W0VA 2UY7A 5DC0A 5BVPL 2XWTB 3NABH 5CKGA 1XR8A 5D6DC 1EA9C 1FYHB 4CMHC 1R3KA 1L0QA 4XNXH 1JZ2A 4MNGA 1D3CA 3MA7B 1A7NH 3SO3C 2NY5C 1L9MA 3NN8A 4OAWB 5TPWH 1KN2L 4EJ1C 3QDGE 1UWXK 1WZ1L 5DEGA 4HDIB 5L7XH 1CE1L 5L2KA 4D9QE 4X4XB 3KPLA 4U33A 1NBVH 3WIIH 3W39A 4APQD 3G5ZA 4ODVL 2I07A 1N5YH 1XIWC 3QDJD 1HHKA 1ACZA 2IGFH 1NL0H 2ZP0T 2YRZA 3KYMA 5GGTL 4PV9B 4PIRF 3SY0A 3PWUB 5E5MA 1TQBB 3QFDA 3F7YB 4FHBD 2A73A 3ZT5A 1IGTA 3IDNA 5E8EA 4D9RD 1KGCE 1JV5B 3I9GH 2DQFA 2JTDA 4LVOC 4NO2A 2RCSH 4S1QH 1XGUA 5ICXA 1CGUA 2GCYB 4M7LT 3RDTB 2QJDA 5FYKU 3B5GA 3WKML 1AP2A 3VG9C 3CDGB 5IROA 2P5ED 3FO9A 1K3ZA 4NCC2 5JXEC 5E4EB 1KIPB 2N7BA 4PJXE 4EUPG 3S37X 5ACLA 4PLKD 3U36B 5D7JD 3IDIB 5JOPD 1IM3A 3QJHB 4KKBD 5I1CH 1U8KA 3KPRE 3OV6A 2EO1A 3BRFA 5CBAB 4OLYL 2BVUA 2D7QA 4WHDA 4XC1H 4QHUB 3QJFB 2X4SB 2XQBL 1YEJL 5DEZA 4OFYA 2VB5A 5DVOA 5C0AE 5IR1A 1KLGA 1LK2A 4PJXA 3Q3GA 1E4WL 2OSLA 5IVZB 3EHBC 3QPXL 1FZKA 4N8CL 1YPZE 4JFDE 2DIAA 1ORSA 4LDLB 2CRMA 3QIBA 5ESVB 2FD6H 1QRNB 1KJ2A 5DMIL 1VFAB 3KPRA 2HN7A 4GUPB 4WJ5A 1CWVA 2DI9A 4DFHA 2FO1A 2AJSH 5DVLA 4IMKC 3OKKA 1BLNA 2NY0C 3M17A 1YPZA 3BQUC 2A77L 4OFVA 2BCKA 1FNFA 5CP3A 5F6HI 2C26A 3HNVH 4RX4A 3JWOC 1CFBA 2YD3A 1U3YA 5FKAA 4X98A 1MJ7H 4KMLB 3GI8L 2BERA 2R56L 5B38B 2A6KA 4H8WH 3DVIA 2QHRL 2PO6C 3WXVH 4QRPB 1OAKH 3VFPA 5C3TA 3HAEH 1XF2B 1NFDA 2A74B 2GFBA 5TGBB 4DQOH 1MCCA 3HE7C 5BW7A 3GSRB 3P4NA 2G5BA 5C0JB 2R39A 4P4KC 3I6LD 3RL2A 4JEGB 4GAJH 2DDQH 1RJCA 3OAZK 3FB6B 3RDTD 4NBZB 3MRDA 1P4BH 1RIUL 2F8XC 4ERSH 1B9ZA 5D1ZB 2HFTA 5I71B 3EDJA 4F7CA 1UEYA 1BEYH 3LS5H 4NPYA 4ODTH 1KIRB 3O6LH 2JJUA 1B0WA 1OY3B 5C1MB 3WDJA 5C0RH 1KTDA 5CGYD 4NCDA 5IGXH 1RZ8B 3EJYD 4L8BA 1IC7L 3ZL4L 4LHJB 4GG8A 3MNWB 3VD5A 4HIJB 4QRRE 4ZTOH 3DVNA 1MAMH 5D7LE 3SDDB 1ZHBA 1YY9C 1CGVA 2OJEA 2R2EA 1N6QL 3ARBA 3TCXA 2CKBA 5F8QC 4F57H 2Z31B 4ONHA 3BX7C 4X6CB 5JPMB 4JN2B 4NBYB 1WIPA 4I1NB 1QRND 1CDBA 3KHQA 4U1SA 5E2UH 4H1LA 4LRIC 3PDDA 2C4FT 3NFPA 1A7PH 2R1WA 5DO2D 5D7LA 4POZC 4KJWC 3TBWB 4WTXA 4HLZH 3FO1B 1TTGA 1UA6L 5KW9L 2BDNL 1JPSL 4F2MB 4WW2A 4LRNL 5DHXB 3L5JA 4QXTB 3HE6D 2Z35B 5FYJU 4UI2A 1NGXA 1NANH 2HP4A 1JHKH 2PXYA 4NO5B 5FKPA 1C16A 3HMXL 4G8GE 4M7KL 2GITA 4YDKL 3A6CH 1GVIA 1JE6A 2DL9A 2NQCA 4LQFH 3X14B 2MWCA 1YNTA 2WWMD 4PRAA 4DGIH 1T2XA 1AGDB 1I1CA 1REIA 1NCTA 4Y2DC 1J12A 2YKLH 3GSVA 5AWNL 3ZDYF 3RTQA 3OGCA 4C56D 4G8GA 3BPLC 2CH8A 2X1WL 1YEGH 2BSTB 5AAMA 4WI4A 3TA3B 1MPAH 4LSSH 2V7NB 1Y6NR 1JPFB 2EEDA 4UAOC 5D1ZD 4YDLB 3FOLB 1G1YA 1R5IA 5DD1H 2LU3A 5EORH 5FYLL 3N1FC 2R29L 1RUML 3CPLB 5DUPL 4KVNL 4QTIL 3CSYB 3S9DB 5ID0B 2NLJA 5SX4I 1T6VN 1IAIL 4P2QE 4X9IA 4V2CB 4JFEE 1JGDA 2FH6A 1FFNA 1DLFH 4HS6B 5MEND 1VFOA 3QUXB 1EEZB 3FMGL 2IPKA 2R2HA 2E7LA 3KPOA 3HI6H 1X5ZA 3S96B 5C9JB 1DBML 2MQCA 3GB7A 1MWAL 1TETH 3HFMH 2Z31D 3PL6A 4NNYB 3ZHLA 1I9JH 4U7KA 5TE4H 4P2QA 5DHVH 2VISA 2RB8A 4MHHI 2LFGA 3QQ9D 1MFEH 1IRAY 4G7YL 3I6KA 4FXKA 2FDBP 5F1SA 2D9CA 3O45B 4EDWL 1RZFL 1FBIH 1TPXB 3MLWH 1C12A 4YHOH 4P9HH 3DROB 4I8DA 1VHPA 4Z78B 5I2IA 3WFHB 4X80H 2EYSB 2F74B 5IVNA 4Z7WE 2GQHA 1BFVH 1PVHA 5BV7L 4XBPB 4M93B 5IHZA 4NJ9L 2BHZA 5DGQA 4JQIL 2C4XA 2HFEB 3GRWH 4KZDH 1QKZL 3QULB 4OGYH 5L88L 3LN4A 1H0DB 3AS3A 4I2XE 4Y1AB 2NXZC 3AAZA 4LARL 4TULH 4WCYL 5FOBB 1FL3B 5E4IA 2CGRL 4JO4L 2YA1A 4EIGB 2FH8A 3IJYB 5C07E 5I76B 2IADA 1QQDB 4M6NH 4Z7WA 3HC0B 4UV7H 5GGVL 2J6EL 4XXCA 4ZO8A 1ES0B 2IANA 5TQ2L 1OSPL 1I9RL 4GAGH 5CINL 3GHEH 3TA3D 4MZ2A 1ZA6A 5HGDB 5ID1A 3O3BA 5L2JB 4YGVA 4NQUA 2H6PB 4RIRB 3FOMB 2HJFA 2DQJL 3CVHA 1DL7L 1SM3L 4KKCC 5C07A 3WNLA 2DTSA 4G6AD 4AK1A 2I5YH 5FO7A 1DBAH 4M3JA 3E1F1 4RGND 1F8TL 1IEBA 5DJDB 2XI9A 3JXAA 1RSFA 1C5BH 2H41A 3B9VA 3C5ZB 1Q9OB 5FA4A 3Q5YA 1INDH 3QUXD 5CSGA 2Z8VC 1RUAL 4RDQF 3MRLB 5EOTA 4ACPA 5C2BL 1HNFA 2NY7L 3MO1B 2EH7L 3VU2A 4L1HA 1A7RH 4K7PX 4JY6A 1AJ7L 3RKDD 3MUGB 3PP4L 1P4LA 4FP8H 5CKAA 4ODXB 4M7LH 1KELH 5D7IB 4F58H 1D5ZB 1XF5A 4HGKC 4ZPVA 4R2GD 1T1XB 2OX5A 1FNEB 3TVMD 1NEZA 3HCVA 4MJ4A 5F1KC 1NFKA 3C6LA 1Q0XL 4GBXB 2IEPA 4OLWH 4HFWB 4N8VA 1N8ZB 3N1PC 4R6UA 3OKMB 4NNPL 4LSVH 3TM6A 1L0YA 4YNYB 1EHLL 4XP5H 1QO3A 1Q8MA 4OGAD 3WL9B 2CLRA 2DKSA 4DVRL 3LEYH 1T5WB 1NAMB 1IAII 1A1NB 4UDTA 4WUUE 4FZ8L 2JK5B 3O4LE 4V2BA 3TPUA 6FABL 1J0HA 2KBGA 3V95A 1DBBL 1ZLVH 2X1QA 1INEH 4G7VH 3U0PA 4NM4L 2BNRB 2EYTB 1HNGA 2HVKA 4ZYKB 4G43B 1EUTA 3S3JA 1V7MH 4YHKH 5INDA 1MSPA 4WUKH 1HYSC 3FFCA 3D2UB 3KLDA 4WV1A 2AKRA 3DJ9A 3RAJH 5IMOB 2AJUH 5GZOC 4WHCA 4N1CA 4DWHA 4G6ML 1DSFL 4X9BA 4X6DF 3SE4A 1NCAL 1ZANL 1ZVHA 1ZLWH 4HH9A 1WQVT 5GGRB 4X4YB 1EO8H 4EVNB 4OLUH 1GGBH 5TE6H 1FIGL 4Z0XA 1WF5A 2CLVB 3NFNA 5EPMB 4ZSOE 4HSQA 2BMKB 2VAAA 2J12B 5I19L 3S36L 4OZ4A 3NFSL 1EPFA 1K4DA 1TFHA 1WGOA 5T3ZD 3CCHA 5DK0A 3C5ZD 2C4FU 1CI5A 2P8MA 3I75A 4KRLB 4LIQL 4N0FB 2X09A 2OL3B 4K9EH 4F9LA 1A6ZB 1IM9D 4K8RC 5BJTA 5HYIA 4Q2ZA 2LU4A 4ZSOA 4GSDH 4JKWA 1MY5A 4CL7A 1FJ1B 2DLFL 3F65A 3T77A 2R1YA 3BKMH 2RFXA 5IQ9A 3TZVA 1GRWA 4NP4H 4R97B 4OCRL 4MA3A 1VKXA 4YPGB 5ISZD 1KPRB 2YMXL 3IGAB 3MYJB 3EO1B 1XCTA 2F5BL 1S5IL 5C6TH 1HHJA 2VSCA 1IJ9A 2SEBB 4KK8C 3BGFC 3BP6B 5EZLB 3OKEB 1U91B 3MR9B 1RU9H 3LQAC 1RZKC 5HYSG 2LTQB 1WBZB 2ADJB 5CFHA 3VXOB 4JZOA 3VI3E 4LSQL 5BZWB 2H9GB 3IJSA 5CUSH 2Z93B 3GSOB 4OCSH 2ARWA 2C3HA 3K3QA 3DX7B 3EAKA 5JDJA 5JMOC 2YC1A 2EIZB 3BGAA 5FB8A 1RUQL 3TIDA 5IROC 3L7FB 1C08A 3L3OA 3D25A 2UYLA 1LEKB 4O2EA 1FZJA 4Z7UA 4NZTL 4Y4HB 2F5AH 2BNRD 1ZLSL 3IDJB 4NZDA 1DEEA 2XN9B 4BYHA 1YEIH 1I7ZA 1YY8A 3ROOA 3NACL 2OK0H 1CN4A 5DJYA 3GMPA 3D2UD 2XTJD 2BOBB 1KB9J 1IAOA 4HMDA 4BSWB 4E42B 4HEME 1TCMA 4XTRD 1QBLL 3OTTA 5DQDH 4GKNB 1CFSA 3Q6FB 4KZEL 1J0KA 4XCNB 4KI5C 3MUHL 5LCVL 3W9EB 3KLHC 2B0SL 2MOVA 3QIBC 5HY9B 3BIKB 3S36X 1BP3B 3QPQD 4DW2H 5H94A 4LLAA 3DXAE 2FEDD 5BVJB 4PRDB 3FN0H 4WO4C 1OPGL 1T5XB 3B9EA 4U1GB 2WWKT 3KPSD 1BQHB 4J8RA 5ECJE 1EO7A 4PJBF 4O9HH 1CXLA 5KSBF 1JPGB 1F45A 4N0YL 1MCSA 3PXHA 1FVDB 4XNUL 2C3GA 4XAWL 2G9HA 3BZFA 3E6FA 3U9UB 1VGKB 1XGPA 3DXAA 4YHYB 4TPRH 3VFOA 1V7NL 1D6EA 5CMAB 4YEEA 1SY6H 4O4YL 1UXSB 3V4VL 5EUKA 2ICWI 3PABA 2YEZB 1FN4A 1RK1B 3P4OB 4Q97A 4QGTA 1AR2A 4JFYB 3ZDZE 1D7FA 4IS6A 5BW7C 1ZGLA 1G7JA 1BVKA 4QOKD 3ULSB 4PRBA 3D6GA 3UEZA 1EFXB 4TVPD 4MJ6B 4YDVA 3ZDXF 3CZFB 3OX8A 3BRDA 3DTXA 2K3TA 4HC1H 3UTZB 1S7QB 4OZFA 4NRXB 4YHPB 4YIQB 3GDBA 1JMXA 5DUMH 3IDXL 3VXRE 4NC2B 1LO2L 1ITCA 3RGVA 1MAKA 3PQYE 3IKCB 4S10A 5DEFA 1CD1B 3UTTD 4F15B 1KB5L 3G6JB 5F89B 1LO0L 4Y4HD 4QEGA 3O6FA 1DQDL 1LDSA 2DM3A 3VJ6A 3O9WA 3MJGX 3QEQD 3VG0H 3K2UH 1YN7B 3S5LA 1HXYB 4P46A 2O26U 2X5PA 4HUXA 3TP4A 4S1RL 3SKUD 1XGRA 3VXRA 1G7HB 3ARUA 3QRGH 2XWBA 3PQYA 4ZUVA 1M6OA 5HPMB 5IIEA 3HN3A 2V9TA 3ARBC 4M43H 5EBLB 4CBPA 2PETA 4M5YL 3SKJL 5IB2A 3RIFF 2V2WB 3BIAX 3GHBL 5HI3D 3W9DA 4XWGH 4Z7VE 1E4XL 1UCBH 2UUDH 4QRUA 4L5FL 5F9JA 3PG2A 3HZVB 5CHNA 1CXFA 1IC5L 3BPOC 5E8NA 1BD2B 5D6CA 3DYPA 4XVTL 3FO0H 5JW4N 3QWOA 1PKOA 2AV1B 1MFAL 4LPTA 3UPCA 5E24E 4PUBL 3C9NA 4IRZL 4YHLL 4LBEB 4CNIB 4WHYG 1F4HA 1JI2A 2OQJA 3FCTB 1MFCL 1A47A 4WW2C 1S9YB 1YYLH 3HS0B 4KTEH 4AQOA 4K3EH 2Q86A 1UWGH 2G75A 5L6YL 2PXYC 1NBZB 3O2DH 4EN3A 2ED9A 2C7UB 4UT6H 2COQA 2HVJB 4MB4A 4C55A 5C6WH 1MHPH 1PG7H 2HT4C 4JN1L 4HIXH 1MFBH 4RBPH 2BNQE 1CFVH 4TTDD 3U4EA 2G2RB 2BY3A 3UTSE 5TFSL 2XTLA 4FTVE 1IVLA 5T1LB 4EEEA 1JCKA 1TXKA 5FV2A 3UJIL 3QDMB 4UILL 5HHQA 3RTQC 2HH0L 1AGFA 3BYTA 4NZUH 4P9MH 1JZ5A 3MXVL 4OSUH 1DVFB 1CLZH 2B5IC 3HMXA 1P5VA 1KCSL 2BNQA 5C0GB 1Q9KB 2AP2A 5SX5K 4BZ1H 3UTSA 5C0FA 2ZG3A 4Q6YA 4FTVA 1ADQH 3DVGB 2N7AA 4BQ9A 3FAWA 1R3LA 3BH9B 2YWYA 3JVGA 3BKYH 3RL1A 4LHUG 5FYLE 4MLIA 2I26N 5ICYA 3O41A 2W60B 1D6VL 1MCJA 3QAZB 3IDGA 1BIIA 3L3DB 4ZNEE 4PGCB 2I9TA 2W91A 1ZT1A 4WNQA 1F4XL 1F4YH 3PP3K 5D8JL 4X6FB 1FO0B 4UBDD 4UQ3B 1T1WA 3T8XB 3EO0A 4MGXA 1LE5A 2E7LC 2IQ9L 3ALWA 1H3WM 2R9HC 5I8CA 5CZVH 5DLML 5IB5B 1CGSL 1LWRA 4G42B 4OKDA 2FO4A 4RISL 3QXUA 3TN0A 3PL6C 4A6YA 3JUYA 1KPVB 4TQEL 4ZNEA 1QZ1A 1I4FA 2EDDA 3SDAD 5AZ2H 3O8XB 1XCQB 1BD2D 1I1FA 4R26L 1MRDL 1DQJB 5JQ6H 4YGAB 4N90E 5GGRY 1Z0NA 3BP7A 2J8UA 2OTUB 4PRHE 1JGEA 3CFDB 3QQ3B 4HKXB 4NKOA 5T33L 4N8PA 2EDRA 3H0TB 4ZUUA 4R7DA 1QFPA 3BO8B 3TIEA 5L0QC 1CTOA 5CJOL 4F7PA 4RRPA 1HZHL 1MCKA 3QCUH 4XNYH 1Y6MR 3F7VB 1K8DA 2VKWA 4IOIA 3GJFB 1DTUA 1BM3L 1X5GA 3LMJL 2A6DA 3W82A 1QSZA 1JPST 3GMNA 5FM8A 4M61A 3B3IB 4LKCB 1IAKA 4PRHA 4PP1C 4HV8A 1RURH 1YJDH 3O2WL 2BC4A 4HUUA 2VDLH 5B22A 5J6HA 4HUVB 4NQVA 1KJ3H 4U0RB 4XXCC 5IUSA 1PKQB 2VC2L 3VXPA 3QUKB 3TJHD 1DVFD 2VLRE 1E4XI 1A3LH 1GC1H 5HD8D 5CD5D 1FLRH 2EE9A 4PBVC 3SJVE 3BWAB 3PV7A 3BAEL 1RUPH 3WHXB 4I5BA 1FZMA 4LU5L 1TIUA 2NY1C 4HS8H 1J10A 2MKLC 3QXAB 3PWPB 4NN5B 2Y5EA 4NQEE 5GQBA 1EIBA 2YS4A 2X9XA 5ITBL 3RIFK 2ADGA 4MLSA 2P5WE 4M7JL 2VLRA 1CT8A 4XMKL 5KS9B 2B4CH 3MRFA 2VIRB 4UOW1 3WE6B 5AG8A 3SJVA 1KIQB 4OZGB 4CU8A 4RMUA 4HG4J 3QEUB 3QI9D 4OGXH 3SQOH 4JG1H 4G8FB 1JL8A 1XGYH 5FM5M 5KOVC 4DUXA 4NQEA 5F7LB 1Y0LA 3LS4L 3MSPA 2PCPB 3NTCH 2W9DL 1UJ3B 4EOWL 1DE4B 2Z8RA 4F33A 1EBPA 3LZFL 1Y18B 3OL2A 3WYRA 2GI7A 3TO4A 3QEHA 3C6LC 5ALCH 3ZZ1A 4P3DA 2JJWA 5FGCB 2FBJH 2WIMA 3VMPA 3VFVA 1Q1JL 1JF1A 3BW9B 3HG1A 2AABH 4V1DE 2VDQL 3TV3H 1Z3GH 1CLCA 3O11A 4JFFB 5ELIA 3NCJH 3S37H 4ZDHB 5IFAH 5DFWH 4L4TB 3QIUA 3HUJE 5DRNB 1NLBH 1X5YA 2KKQA 4JHWH 4GKSB 4YHNA 2DBJA 2FR4B 3ULUL 4CVXA 4K55A 2VZUA 4V1DA 5C0CE 5HDLA 3KR3L 1OAXH 4NM8L 4P2OB 4CN4A 4LSRL 5AYUH 3HZYA 1P4IH 4RQQB 4WV1C 2HTLC 1HIMH 4TSBL 5EO9A 4KQ3L 1JF6A 3HUJA 3FFDB 1NCBL 3MC0A 2XRAL 1YEEH 2J3SA 2DTML 2F54E 1M7XA 5C0CA 5J56B 3W2DL 5I6XB 2PYFB 4GJTB 1R24B 3VCLB 2KPNA 1OTSC 4PJEE 1QFHA 3U4BH 5HHOD 1BZQK 2Z92B 4LOUD 1JGUL 1MQKL 4ZXBA 2X4OA 3OKNA 4IDJH 2DYPD 1WZ1H 1SEBA 3GUTA 3I2CH 4LIQE 4QY8A 3RU8L 1F2QA 2F54A 2HLFC 4F9LC 5K9QG 1XZ0B 4YX2L 1ETZA 5EU5B 1JYXA 1H5BB 3LQZA 1MHCA 3B8YA 4PJEA 3TBTA 4XT1C 4ZUTB 5GGTH 2HT2C 5GRJL 3TZVC 5JLZB 1GZQA 4G6FB 3PHSA 3MTRA 1LP9E 1R5WA 4UT7H 4P57B 1EH9A 3BHBB 3LKPB 1TZHB 1TJIL 4WFEE 5D7SH 2GTWA 1H3UA 3HAEB 5IB4A 4Y5XB 1UKTA 5I9QB 5B4MC 4GRWE 3ULVF 1UB6A 1VFMA 3TBSA 4JFFD 4L4VA 1LP9A 2E6JA 2OR7A 3TT3L 3MCG1 5EO0B 1UM5H 4BQ6A 3V4UH 1U8LB 3A67L 4L4TD 4PRPB 4PV8A 3C6SA 5EA0L 1OAZH 4HBCH 5FUCC 5T3XH 1EERB 1UFUA 5ILTH 1VA9A 2NY3B 5DJ2A 1OGTB 4OLYH 2H26B 1E0OB 3ZYJA 1Q9LB 2XQBH 1F11B 1YEJH 3RVWD 1AGBA 4P2OD 2C1OB 5AZEH 3QPXH 3ARGA 2XWJA 2ED7A 4DKEH 4NFBA 3UO1L 2YRPA 3LKQB 4YC2B 1MEXL 3WFBL 3WUZA 5DMGD 4HFUL 5DMIH 4C57C 2FWOA 1MIMH 1QA9A 4RWYL 4N5EC 3NZHL 3NIFE 5F7WC 1YEHH 4PYGA 5KSVB 1MCBA 3MRBA 1CQKA 3U0TB 4QT5B 3TEUA 4BQCA 1F5WA 1CTNA 3LEXB 3VFTB 2NTFA 3B9KA 3G9AB 7FABL 1YDPB 2AV7B 4PJFF 3VH8B 1HXMA 2E8YA 1G0YR 2PYEE 2A77H 1T0NB 4Z5RB 1RVFH 5IMMA 3MLVH 4PGDA 4Z95L 4ODBD 5DZOA 4XHJD 5GSRA 2ARJB 3EFDH 4NO0D 3ISWA 2C3WA 3EGSA 2X4TA 4PJ7F 1H3GA 3KJ6H 4FQCL 5HHVH 1KLUB 1ZHLB 3CFIC 4ONFL 2UZIL 2DM2A 4MWFB 2DS4A 2DQUL 4G6FD 4PJ9A 3FQTA 3MMEB 3V4PL 3UJJH 3HTLX 1FGVL 1IGFL 5DD0L 5E8OB 2MSPA 2WANA 4I9WE 1CGXA 1J88A 3DRTB 4RMVA 5I15L 1WISA 1M05B 5AEAA 2B1AH 4YHZH 4PJ8A 3TBVB 2DOCA 2NR6D 5SWZD 3MGOA 3R06B 1S7TB 2GTZA 5I75C 3K80A 5KSAB 2IAMA 3KAAA 2PN5A 4XCYB 5EOCH 1YYML 2BVTA 4PRPD 2FHBA 4NWUL 4FQIL 4PJDB 3RGVC 5EC1B 1BQLH 1RPQA 2NY3D 2WBJB 5DRXB 5TDNB 4G5ZL 1OT1A 1SYVA 2DWDB 4LHQB 5DVKA 4KHTH 4OV5B 2P8LA 4X4ME 4RGMB 4EIZC 1G6RL 1XF1A 3O9WC 1N4XL 1G7PB 1OB1B 1NCWL 1Z2KA 4EXKA 1GGIL 5IW6A 3D0LA 4HK3J 4P46C 1MLBB 1BBDH 3MUZ1 4PLNC 1S3KH 3EYVB 1KCKA 4PREA 5EC2A 5IBUG 1RHFA 2V2TB 2JJVA 4IIQA 1NC4D 4IOFD 1AO7D 1VPOH 2ZCLL 4OI7A 3FT2B 2YBRB 3AB0C 3GMQB 1TITA 3CSPA 5MEQB 3DO7A 5DJAA 2VYRE 2HFGH 1JP5A 4K94C 1R5VA 5KW9H 1JPSH 4Y4KA 1DANU 3JV0A 4LRNH 3NZ8A 5J11C 4ZQKB 1RHHA 4HUMB 5DHVB 5C8JB 5T3ZL 4MNQA 2XZAL 3DGGA 5T5FL 1TQCC 1CK0L 1MH5A 4JFZH 5HHXL 4ZPTB 1MJ8H 3L5XH 4GXUM 4NGHL 1LDPH 1FSKB 4D0CB 1X5HA 3FJTA 3IS0X 2CMRH 3DUHA 5HGBA 1QFOA 4HKJA 2BVPA 1P2CA 4TRPH 4EN3C 4XNZC 5DD3L 4ELMB 3QISA 3OXRA 2FX7L 5H37H 4L3AA 3P9MB 4DCQA 4P5MA 1EVUA 1CFQB 1T3FA 2IALB 4JRXB 5IW1B 4RAVB 5GS0H 1EV2E 5DJXA 2ZKHL 1WICA 3MXWH 1MELA 1EEQA 2BVQB 4GG6E 4M1CC 4BFIB 3QDJE 1WCQA 4OUOA 5IFJB 3VWJB 3OB0K 4G8EB 1ZEAH 1CDJA 1U93A 2VLKB 3QNXA 4N1HB 3HRZA 3GSWB 3EO9L 5EBWA 3W5NA 3O0RL 2QQNH 1X4YA 4YXLL 4D9RE 1CFNB 4PB9H 3OHXB 3I84A 1CICB 4ZD3L 4PRIB 1E4KA 4QHKI 1ZGLM 4J2XA 1LILA 4NJAH 5K9JL 3LKNA 4R4ND 3T0VA 1NAML 4GG6A 2P5EE 3QDJA 1I1YB 3L1OL 1OT2A 5ANMB 3JVGC 3QXDB 4FZEL 5MI0C 2Y23A 3T0AA 3EBAA 5TF0A 1U58A 3UTPE 2WBJD 4HT1H 1YEKH 4KRMB 1I3VA 1MRCL 1ZV5A 5JOPE 1S7WA 1DQQB 2IBGA 4P23A 1MAJA 2AJYL 35C8H 2W9EL 4K7PH 4JQVC 3HB3C 5ERWA 3EJZD 2P5EA 5JTWA 2Y7QA 3TN0C 3P77B 3LN5A 3C5JB 3LH2L 4DUVA 5FECB 2YA0A 2FJHA 2YK1H 3INUH 5FUOL 4LPYA 4OD3L 3UC0L 4HWNA 4UQ2A 3DUUB 4D0BB 1WIUA 2CIIA 4U1KB 2FJGA 4OD1L 3IVKA 1QKZH 3ES6A 1AXSA 2OL3L 4U1IB 2X41A 4JFPB 3BDXA 2E27H 4GS7B 1UYWH 1S7XB 2N1KA 4LCUA 3CFEB 5D1QD 3NA9L 1AFVH 5CILL 1RZJL 3FTGB 3WD5L 1INQB 4NO3B 1BFOB 1CVRA 3BZ4A 4CADB 4MXWL 4JRXD 2J6EH 1IFHL 4EKXA 4LF3B 1D5XB 4NYLB 5TQ2H 3O3DB 2XWTA 4Q74A 3QZWB 5LVEA 3UAJC 4QF1B 2VLKD 4JPIB 1CDIA 4KKNA 2FL5A 3RJQB 3MA7A 5BV7C 1QFWM 3DOSA 2DQJH 3KYKH 4M62H 4JVPA 1M7DB 4TVPL 1IKFH 3I6LE 4MJIB 4HDIA 2ZOLB 4PRID 3E8UH 3DV4B 5FDYA 4X4XA 4RMRA 4RFOH 1FCGA 3CAFA 2W0LA 3LDBC 1PSKH 1CL7I 5DS8B 3QT2A 3OGOE 5I1IH 5EOCJ 1NMBH 4PJCE 1J1XL 4PV9A 1L7IL 3PWUA 3F7YA 4K3GA 3O6KH 2CLZB 4NNXB 2AJ3B 1JV5A 2E9IA 1AJ7H 3NBNA 5CEZE 3PP4H 4XBEL 5GJSH 3IFNL 2GCYA 1NUFA 2HKHL 3RDTA 4YZFF 5C0EB 3CDGA 3MLUL 1AR1D 2R0WL 1QSEA 1DUYB 3QDGB 4WTZG 1OP5H 1KIPA 3GJFK 5FA3B 5EULV 2ICES 2GSIB 3U36A 3K4ZA 1Q0XH 3IDIA 4R4FH 3PUCA 2HRPH 3D18B 2JELL 4I3RH 1QRNE 3MLRH 2HWZH 3QJHA 2X89D 3WNMA 3QBTB 4P48A 4NDMB 2VDOL 2ZUSA 3TO4C 4QHUA 4XWOC 3QJFA 1EHLH 4P4RB 4P5TB 5IVZA 2WM0A 1H9VA 3MRJB 3QWRD 5JW5B 1EAPB 1O0VA 5ESVA 1QRNA 1JIBA 6FABH 1JRHH 1VFAA 4NM4H 3V7AE 1RZ7L 4N9OB 4MYWB 1N6UA 3QIUC 4GUPA 3VE0B 2IQAB 2F53B 5D93B 4CGTA 4LHUD 3ZYZA 1CGWA 5DJ8B 3RGHA 4NQDB 4RFNB 4WFFE 1YEDB 4UB0H 4QRPE 3ULUE 3G04B 1ZANH 1RIHH 2VXUL 3E2HB 3HNSH 5C0AB 4YAQB 4BUHA 1BWMA 3SOBH 3F12B 3BN3B 3GNML 2JJTA 5J06A 3IDYB 2H1PL 4Q9QL 3KXFB 1FIGH 3NH7H 1LK3H 4JFDB 3E6HB 1NCNA 4XX1G 4OI8A 1QBAA 4J3UA 1PY9A 5B38A 1O5DT 4XP1H 1K6QH 3M8OL 3ARXA 5E99H 4QRPA 3BISA 3MZTA 1XF2A 4P5KB 5TGBA 2V5TA 4OCXH 2Q76B 1YMHB 1TZGL 1MCEA 1MUJB 2VL5B 3GSRA 5C0JA 4W4NA 2EYRB 4D3CH 4Q9CA 3EOTL 4ZXBC 3PWLB 2HFFB 5IBLC 5MENE 3FB6A 4YBLC 5C71A 5D1ZA 1ZTXH 4D2NA 2YMXH 2ZSWB 1S5IH 5E2TL 1KIRA 3ARFB 3KPPB 4X6CE 3MFGB 5KN5B 5EIQA 1CDCA 1RZ8A 2Q8AH 4BELD 4OKVB 4XXDB 5EU3A 5BMFL 5HI5D 3MNWA 3MRHB 2OJZL 4LSQH 5IHUL 4J12A 3ARWA 3SDDA 3U0WL 4K8RH 4P5TD 1HH9B 3VXNB 5CCKH 1WZMA 3D39B 3CDFA 3VDBA 4PJDF 5JPMA 3NIGE 2DQEH 2W65B 4JN2A 5IV2B 4O51B 5GGSY 1U8HB 4MA8H 4EQ3A 4OCYL 4I18B 4LCCB 1VFBB 3BT2L 3DWTA 3ARYA 5JPNB 4XP4L 3TBWA 2VDPL 2C3VA 4NQDD 1ZSDB 3FO1A 3JWDH 4DTGH 1MCHA 4F2MA 4KRNA 3VRLE 3EOBB 4X7TB 2Y36H 5D96B 1B4JH 4QXTA 1BZ9B 2Z35A 2D3VA 1X6LA 5FCUL 4MQXD 5LCVH 1EJOL 1FYTA 4NO5A 3VGGA 4CN1A 4KXZI 3KXFD 1KC5H 2FIKB 3HA0A 4I77H 4K71C 4JVUA 1G9MC 2X4NB 3X14A 3QUYB 1S8DB 3B9KC 1AGDA 1A6WL 1TJGL 4MVBC 3TYGL 3GBNL 2ADFL 3QA3B 3SDYL 2VL4A 3RZCB 1TNMA 4PY8I 3P9LB 4XNUH 3UJTH 3I3BA 1JTTA 3FHAA 3PGCB 2FGWL 2BSTA 1CLYL 2V7NA 15C8H 1FO0L 1RZIB 1T0MB 3RVVC 4ELMF 1JZ8A 4NUGL 1C5CH 5E6IB 2H2PD 4M7ZC 1JPFA 5L8LB 4UTBH 5IESL 5MP6L 3FOLA 4OF0A 1RJZB 3VGEA 1KJ2H 1YNLL 1RI8A 3CPLA 5C08D 3CFCL 3O4OC 4OQTL 3ARFD 3CSYA 5ID0A 4DGYH 5CLTA 2R0ZH 1I1AD 4ZMAT 4MMXC 4N68A 4PJ9C 3SE3A 5DQ9B 4ZFGH 4HS6A 4M1DL 4I3GA 2CR6A 3QUXA 1EEZA 2YN3A 3IT8D 5I73B 4Q6IB 1LEGB 4LPVA 4UV4L 4FOMA 4CVZB 3S96A 1S9XB 3U46B 5C9JA 1DQMH 3KPMB 2X9YA 3X17A 1L4IA 3D39D 4G6KL 1T66C 3IDXH 4NNYA 5EU7E 1K2DB 1GXEA 4PJ8C 3P9WB 1CDGA 2ICEB 4X4ZA 2YPVH 4G6JL 3MA9H 2IAMC 3BXNB 1DQDH 2GK2A 3WN5B 3O45A 2A1WL 5HHMB 1OARH 3QUMH 3LHPL 3DROA 3QWQB 2X7LB 5GS2H 1MCPH 4JFEB 4Z78A 3WFDL 3WFHA 2EYSA 4E41B 2V5RA 4YXKH 1LE9A 1HK6A 4S1RH 1GAFL 1U42A 2F74A 4GH7B 2ICWJ 2LABA 4PS4H 4R0LB 3QQNA 3BVNB 1T7WA 2FB4L 4M5YH 4XBPA 2FX9L 1ZWIB 2HFEA 1KEGL 1X9QA 3QULA 3MLZH 1H0DA 3A6BL 4L5FH 4Y1AA 3FO2B 1FL3A 2OTPA 4LEOB 5I8OL 5F9AC 2P43B 3VGAC 3IJYA 1MFAH 2V17H 3HI1B 1V8HA 5I76A 5EU6D 1QQDA 3HC0A 3S35L 3F62A 4KROC 4LSUL 2IBBA 4Y4KC 1J1PH 3VA2C 1ES0A 3WFCL 3RZCD 5DJ6B 3N1GC 3P30L 1OAUL 5T3ZE 1ZS8B 5L6YH 1CD8A 25C8L 5HGDA 5L2JA 5SWSB 4RIRA 1SBBA 3FOMA 3IXTA 5E6ID 3UBXG 1PEWA 3FT3B 3QUZD 3CGTA 4LAQH 2X4RB 4I2XB 2XXMB 4AIZB 3NABL 2YUXA 2CSPA 5CJ8A 3ZE2F 4XNXL 2VXQH 5DJDA 1MVUB 1G7QB 5DMYA 4PD4J 5D7IE 1U41A 1A7NL 5TPWL 1MY7A 2OZ4A 3MRIA 4UILH 1KLFA 3C5ZA 1Q9OA 5ISZE 5DRZB 3AXLB 3PNWB 4KKAD 5L7XL 3MPCA 3MRLA 4P59H 4LFHD 4JPWH 3MO1A 4B53A 1RIVH 1NBVL 4PLJD 3WIIL 1QR1B 1N5YL 5JW3L 3MUGA 3SEPA 4GLRI 2IGFL 1NL0L 4YH6A 5E56A 3OZ9H 4ODXA 1B90A 5BO1L 5D7IA 1D5ZA 4NRYB 4TNVF 5J12B 4GKOA 1FFRA 4DK3A 2X05A 1A21A 1E4KC 2MNUA 3I9GL 1T1XA 4KVCL 1FNEA 4PGBB 4S1QL 3VW3H 2YRLA 5HHMD 2ERJC 4GBXA 3D3VB 4WFGD 1KCLA 3ZTNH 4HFWA 4FQXB 1N8ZA 1QRKA 2BNRE 3BUYB 4IHOB 3OKMA 4P23C 3LRHA 2OBGA 4LCYB 4MJ2A 3T2NH 1UZ6E 1U0QA 2AI0H 4YNYA 4JGMA 3WL9A 4JFQB 4WU7B 2OYPA 4OCNC 1IKNA 3AREB 3KWWB 5C7XH 4XP9H 1T5WA 1NAMA 5I1CL 1A1NA 2VN4A 5IVXB 2JK5A 2ZWLT 2NY6D 1QHPA 4XC1L 4Q0XH 1UQSB 1H3VA 5GXBB 1MRDH 4S2SB 2BNRA 2EYTA 1ONQB 4JKKA 5HGAB 1RULH 4ZYKA 3SCMB 4G43A 3QH3B 4KKBC 2LAAA 3D2UA 2ZNWA 1SHMA 3BWUC 2FD6L 5IMOA 1CXIA 3MFFB 4KK5D 1NDGB 1UGNA 3UPAA 3V6ZB 3F6IA 1AD0B 3KPSE 4PJXF 4QHMB 5SWSD 1UADC 1WITA 4GRLD 2AJSL 4UIMA 1KB9K 3U2SB 5GGRA 4X4YA 5DURD 5LWYH 4EVNA 3NCEB 1DBKL 1WV7T 4WUUB 3LAFA 1KULA 3MOBH 1BQUA 5JHLH 3O4LB 2BMKA 3LPFA 3LIZH 1TENA 3HNVL 4NWTH 4IEFB 4QLRA 1TTFA 2QL1A 1EGJH 5EUOB 4H88H 1N3NB 4X5XB 1YPZF 1MJ7L 5F71A 2OL3A 4DN4L 1A6ZA 4H8WL 5FHAH 3MCKB 3RNKB 3WXVL 1OAKL 4XB8A 5DK3A 3BAEH 2W1NA 4QOKE 5DI8B 1FJ1A 4TVPE 4DQOL 3MJ7B 4Z7QE 3TGXA 1T7VA 4ZFZB 4YPGA 5T5NG 3DMMD 1KPRA 3ARPA 2VDNH 3IGAA 3MYJA 3EO1A 2DDQL 4ORGB 2SEBA 4OQ1A 4LGPB 1CQYA 4A2LA 3BP6A 3D3VD 1P4BL 5EZLA 3OKEA 1U91A 3MR9A 4NHUB 4ERSL 3UTTE 1TQBC 2R2BB 1VACA 1HKLL 1WBZA 2ADJA 2VLMD 5EBMB 2AVGA 3PGFH 3VXOA 5HI4C 2VUOA 3PHOB 5BZWA 1BEYL 2H9GA 2WLZA 4ODTL 3O6LL 1GGTA 2Z93A 3QEQE 5JIHA 2YUWA 3DX7A 4GO6B 5C0RL 4IRJB 2EIZA 3ARSA 3ARED 3CD4A 2W9DH 1CF8H 3VXSB 3L7FA 3TNNB 1ZGLP 5K33A 1FE8H 5E4EC 4ZTOL 1LEKA 5KAQG 1RAMA 3R8QA 5DVMA 2Z91B 2ENYA 3PWNB 3QIWB 1TDQA 4Y4HA 2VJXA 2NYYD 3IDJA 1S7VB 1A8JH 2XN9A 4ZS6C 1AGEB 4YUEH 4F57L 3BZEB 3EJYC 5C09D 4O2CB 3Q5TA 1Q1JH 5DD5H 4FFVC 3QRFM 2BOBA 1H8OA 2EE2A 4LL9A 3VRJB 5DT1H 4IJ3B 4BSWA 4KDVA 4E42A 5E2UL 1YC7A 3T2QA 3LPWA 4GKNA 1A7PL 3Q6FA 2BOCB 4XCNA 3W9EA 5HY9A 3BIKA 3F5WB 3SO3B 3T08A 4LSTH 4HK0B 1KBGH 3VGFA 1I9IL 5HHPA 1KG0B 1AI1H 5BVJA 4PRDA 1FQ9C 5TDPA 1S7UB 4PTUB 5CBEB 4PJGB 1T5XA 1ZLWK 4JHAH 4LSRH 2BX5A 4TNVK 3EIFA 1KTKE 1BQHA 4TSBH 5TJWK 1U3HD 4HS3B 4LPUA 1I3RB 1JPGA 4WW2F 5IK3B 2XACC 2H8PB 4LQFL 1HH6B 1NCBH 4S0SD 4YK4B 2EDLA 1R3HB 3U9UA 4DGIL 1VGKA 5E2WL 2DLTA 2DTMH 2JJTC 2YKLL 3W2DH 1A1OB 1YA5A 5CMAA 1UXSA 4R3SB 5B39B 4JLRB 2YEZA 1ZT7B 1JGUH 1MPAL 4LSSL 1RK1A 1K4CB 3P4OA 1XGQB 4ZUWB 3ULUC 5GRVL 3LKRB 1T20B 4R7NB 3TNMB 3G6JE 5DD1L 4U1MB 1GL4B 5EORL 3ULSA 3VD9A 2CK0L 2BFVH 2D0HA 4YX2H 1EFXA 4MJ6A 3EDEA 4X6EB 3UTZA 1S7QA 4NRXA 4YHPA 1AY1H 3AU1B 2HMID 4YIQA 3NGBC 4FABH 1DLFL 1EVTC 2VQ1B 4X7CC 1SVZA 5D1ZC 5K9OB 3VXSD 2P46B 4BJLA 5SV3A 3IKCA 1YUHB 1CD1A 3L95B 4QXUL 2BZDA 5F7UA 3G6JA 3HI6L 3QIWD 5F89A 5GIRB 1S78D 1JGVH 1TETL 2ZCHH 3HFML 4Q58C 4MD4B 1I9JL 1JUFB 4JDZB 5TE4L 5GRWA 1YN7A 1BD2E 1HXYA 4OBSA 1RV6X 4OJFH 1MFEL 3HR6A 3TT3H 3SDDC 1G7HA 5HXMA 5HPMA 3GM0A 4P9HL 4YHOL 3A67H 5BOZG 5E5UB 2V2WA 3RHWF 3FQRB 4X80L 5TH2A 4B41A 2ID5A 3ARDB 2DJSA 5JDSB 5HTSA 3HZVA 2CDEB 3TH2T 4YQXL 1B4RA 1BD2A 3MV7D 1BFVL 4WEBH 3CXHJ 2AV1A 2R0LH 4U1NB 5EIVA 5FHBH 3GRWL 4KZDL 2XZQL 4LK4A 4H1LG 4LBEA 1S9KC 3S34H 1WVZA 4CNIA 1XIWD 3CH1B 3FCTA 3IFPB 3S6CA 3C5SB 4AT6B 1S9YA 3RWHB 4GW5B 5T3XD 4OM0H 5DK2B 3HS0A 4OM1H 1I8MB 3N9GH 1JYNA 3RQ3A 2ESVB 1NBZA 4M6NL 3SE8H 2C7UA 5I8EB 4L3EB 4UV7L 2HVJA 1G7MB 2ZOKB 5ACZB 3CK0H 4Z7VB 4GAGL 2G2RA 3ARQA 3GHEL 4O58L 4KRPB 5JXED 2H32H 5DDHB 4KGLA 5T1LA 4ZO6A 4Z7WF 2EICA 4L29B 1AE6H 2MQ3A 4XNMA 3QDMA 3T0EB 3MBEB 32C2B 1SVCP 2I5YL 3THMH 1DVFA 1DBAL 5CD3B 4KPHH 3CLEL 1NGYB 3EW3B 1SMOA 4BK5A 1X5AA 5C0GA 1X5JA 1Q9KA 4HJGB 3DUSB 1NANI 3GSNL 4F7MB 4Y8DC 2OS7A 1INDL 2F8VA 3DVGA 5FO9B 1BQSA 3BH9A 3GKWH 1AQDB 5F7DB 1IGFH 3EHBD 5DD0H 2DKMA 1A7RL 5KG9B 2W60A 5E8DL 4HUWB 3L3DA 3SE3C 4PGCA 4TNWF 4FP8L 4XPBH 3GGWB 4M7LL 1KELL 4F58L 5E94B 4X6FA 1FO0A 2FZ3B 4UQ3A 3T8XA 4Q7DA 3DIFB 5JO5B 5JHDB 5EZOH 2Q6WB 3FRUB 1T7XA 2NY0D 1L6ZA 4ZTPH 4ZAKB 5IB5A 3RKDC 3GMLB 3BQUD 4G42A 3GMMB 4OQTA 4HG4K 4EI6B 5JW4M 1KPVA 2MPAH 3ARDD 3O8XA 3IU4H 4CU6A 3GI9H 1XCQA 1W8OA 4LSVL 5DC9B 1TPXC 1N4XH 4XC3H 4XP5L 2DAVA 1DQJA 3A6OA 3LEYL 4HCRA 3B2UC 5FV1L 2OTUA 1C7TA 3CFDA 5CIPH 5MEPB 3QQ3A 4HKXA 3NCMA 3H0TA 3RIAF 1P53A 3BO8A 3LV3B 4G7VL 2XQYG 4M93C 4OZFH 5IG7A 4UOJA 1J0IA 1PKQE 2CQVA 2ESVD 3F7VA 1V7ML 4HKZB 4P4KD 3GJFA 1LO4H 4WUKL 1MWAB 4L3ED 5C92A 1WEJH 1CXEA 3RAJL 1B0RB 2AJUL 4WW1B 3B3IA 4LKCA 3FQNB 5LQBH 5FYKD 3SPVB 4HW6A 4KRPD 2QSCH 3CZJA 3AGVA 2E7MA 4HPYH 3BMWA 3LSOA 1K8IA 4HUVA 1NFIB 1EO8L 1FL6B 2JJSA 4N0CC 1PKQA 3N0PB 1GGBL 4OLUL 3QUKA 4RBPK 5HHOE 3MBED 5TE6L 3WIHA 2MCPH 5KS9E 3DI2B 2CDGB 3H8NA 3IFLH 1F3RB 3BWAA 4P3CL 4EZMA 1B2WH 3CU1A 4S1DD 4OZGE 4QXGH 4YBQC 3WHXA 1YY9D 3QXAA 3PWPA 1V3MA 4K94H 5TF1H 4K9EL 3GO1L 3RHWK 2A0LC 1VERA 5KS9A 4Y16B 3C5ZC 2VIRA 3UCRA 3WE6A 4Q9RH 3OKDB 4NP4L 1KIQA 4OZGA 3QEUA 3QCTH 5DJCB 5JHDD 3VWKB 1GIGH 1MJUL 4KJWD 4G8FA 5FGCE 1JWUB 2AW2A 2XQYK 3LOWA 3CJJA 3W0WB 3ZKNC 5EIIB 4PG9B 1N6VA 3C87A 2FHCA 5IJKA 3LPGA 2E9JA 2PCPA 1RUKH 1S7RB 5F7EH 1UJ3A 1DE4A 4JFFE 4BK4A 2VLJB 5CUSL 4MAUH 5A2KH 3ZKSD 3R4DA 4OCSL 1QFWH 1Y18A 4L4TE 2DMCA 5T1KB 1UM6H 5JA9A 4GBXC 2P5WB 2MJWA 5HVGB 3D85B 2HRLA 1RY7B 4U1JB 3BW9A 5GS1A 5JIIA 1NEZG 2UWEE 4Y2DD 3DX9B 1A22B 4KI1A 2F5AL 4N8VG 3PDGA 4JFFA 3MJ9L 1YEIL 1BMGA 2WK2A 3ARTA 3O6ML 3ZYIA 1IKNC 4ZDHA 4L4TA 4J3XA 5DRNA 4HWEL 4GKSA 4NUJB 1P7QB 4UINH 3VI3F 5DQDL 2FR4A 2ZUQC 5KVGH 3G5VB 3VRIB 2MHAB 4P2OA 3WHE1 3GMOB 2QQKH 3K8MA 2P1YA 5EWIL 4XPHH 4DW2L 4JY4B 5J9PB 4TNWK 1JJUA 2VZOA 3FFDA 3FN0L 1RZJH 1PFCA 2AQ3A 3GIZL 3WJLA 2Z8SA 3BDYH 3BI9X 4A6YH 4O9HL 5MHSD 1A7QH 4CRPA 1MCOH 2AK4B 1R24A 2PYFA 3VCLA 1AHWB 2FEDC 2F58L 2NXYB 3IF1B 4PJ5B 2Z92A 2BHYA 4W6WB 3V0AC 1IARB 4Y16D 4TPRL 2YPLD 1CXKA 2GJ6D 4NKDB 5CZKA 3F6LA 1KXTB 5HVHB 1SY6L 4HZLB 5EFIB 3FONB 1XZ0A 5EU5A 1H5BA 5M94B 3PWVB 3W0WD 4TOYH 1CVSC 4JM2F 3SBWA 4ZUTA 2VDRL 3RIAK 5JLZA 2WQ8A 3VXMB 5FYJD 4R97C 2ZUVA 4HC1L 4LPCA 4M1GH 4P57A 2NXZD 3BHBA 3LKPA 1TZHA 4PRPE 5T1KD 1Q72H 4X7EC 3OR6B 3KS0J 3STZB 2HKHH 2KQMA 1WBXB 3SGJA 2LTQC 4LCIH 3HAEA 4Y5XA 3QNYB 2PKDA 5A43C 4IRSB 1D5MB 1HSBB 5EO0A 5KANI 1KXQE 2Q7YB 3VG0L 1U8LA 4DKAA 3K2UL 3VFGH 1FRGH 4PRPA 2X2YA 3P2TA 3ZDZF 1AO7E 1PYWB 4N0RA 4OZHB 1OGTA 5J4MA 2H26A 4KKCD 4GFTB 4L4JA 4Y4HC 2Y06H 3AMLA 3QRGL 1Q9LA 3BMVA 5IMLB 4WY7H 4KUCF 4F7EB 4AG4L 3ETBF 2C1OA 3A0OA 3MACL 3G5XB 2DQGL 3LKQA 4OF7A 2EH8H 1XH3B 1OVZA 3T3PF 4FG6D 4J4PA 4F3FB 3FO0L 4RA3A 5KSVA 3U0TA 4QT5A 4YDIH 5HI3C 4EUPH 1RJLB 3LEXA 3VFTA 1F4AA 5DQJB 1YDPA 2AV7A 4KKLD 4JM4H 2AK4D 3VH8A 1YYLL 4K3EL 2YZ1A 1EHXA 1UWGL 1T0NA 4Z5RA 4U1GC 3KJ4C 1ORQB 3O2DL 5CZXC 5IEKB 2ARJA 3GNMH 2BVOB 2H1PH 1PG7L 4PJHB 4KV5E 4HIXL 1Q9WB 3OAZH 5IQ7H 1CFVL 2VUYA 3QHZH 4Z7VF 4QCIB 3QYCA 3MRPB 2KZWA 1KLUA 1ZHLA 4L8SB 4YHYC 5FM4A 1G9NC 2DD8L 4MWFA 2VZTA 3JV4A 3VXMD 4MAYB 3LRSB 5JQHC 3MMEA 4NZUL 4P9ML 1CD0A 4WDIB 4OSUL 1SYSA 1QLFB 3X12B 1CLZL 5E8OA 2DQDH 1AXIB 5K59E 2RR3A 4PY7B 4ETQB 2KH2B 4BZ1L 5D9SB 3DRTA 1M7IB 1ADQL 2EDKA 2X6MA 1M05A 4L9LC 4O2FB 4S0TD 3BKYL 5L9DH 2DRUA 1HYSD 3TBVA 3H9YA 3R06A 5GZOD 1X3DA 3RPKA 5KSAA 5KSUB 4XCYA 4H5SA 2OI9B 3VFMB 1F4YL 4OTXH 5LGJB 3QO1B 2VDKH 1NGQL 4HXBH 4OZFG 4PJDA 5EC1A 4F15C 1NMAH 1CXHA 4XZUB 5DRXA 5TDNA 4Y5VB 2DWDA 3VXUD 3QIBB 3UYPA 1U8IB 1G7PA 1OB1A 4DN3H 4WWKB 4K7PY 4MHHG 3MODL 4WO4B 4UBDC 1MLBA 1PX3A 1ZVYA 2J8HA 5AZ2L 1PQZB 2CK2A 3EYVA 4YWGL 5GRUL 3SKMB 3UROR 4BA8A 4K3DH 2V2TA 4OCYH 3S5LG 1FH5H 1QLRB 1DR9A 2GJJA 3AM8A 5JQ6L 3ABZA 3BT2H 4ETYA 2YBRA 2QR0B 4JB9H 3GMQA 4JFHE 5MEQA 4K8RD 4XP4H 4OIIH 4X5LA 4FFWD 3MRCB 4JQXA 3PGDB 2VH5L 2YD9A 4AY0A 1FNAA 3QCUL 1TLKA 2R4SH 5L2KD 4LNRB 2EDBA 4ZQKA 5DHVA 5IM7A 5C8JA 4XNYL 5J1SC 4JRXE 3KNBA 3QUMB 4ZPTA 2W0FB 1I7RB 5F7NC 4LKXB 4MDIB 4X99B 4D0CA 4LVEA 1MFNA 1LO3H 1RURL 1YJDL 2VLKE 4Y19B 4PLOB 1S5HB 3EUUA 4Z77B 4GLRH 5BXFB 2VDLL 2BRRH 5B3JE 1P84J 3BE1H 4ELMA 2ZUWA 1KJ3L 3GBNH 3P9MA 3SDYH 4ZFOL 1CFQA 2V9QA 2IALA 3BPNB 4PRIE 4RAVA 4NC0B 2IFFH 3GRWA 5IW1A 1CDHA 1A3LL 1GC1L 1VDGA 4U4BA 2FGWH 1FLRL 2IF7A 2BVQA 4BFIA 5IMKB 3OB8A 1TMCB 5ANME 1FLTX 5IFJA 3OF6A 4G8EA 3VWJA 1F02I 2IH1B 2VLKA 3KYOB 1RUPL 1ZVSB 3O3UN 4GMSH 3GSWA 4BFGA 5E00A 1QSVA 5IESH 3BN9D 4HS8L 2JKXA 1H3PH 1A6UH 1CFNA 1DVFC 3OHXA 5HD8C 5F1OB 1CICA 1KTRL 4PRIA 5E08L 1HDMB 3BZDA 5JW4R 1F13A 2B4CL 3DVNB 4JGJA 2VR4A 1X5FA 4KGJA 1N59B 4OFYD 1OCWH 5DSCA 4M1DH 4QWWC 3QXDA 2NY2C 4KI5D 4OGXL 2XG5A 3SQOL 3KLHD 4JG1L 5KVMC 3V2AR 3QIBD 3QAZC 4APQB 1DQQA 3ROLB 4RMSA 5D2LE 1WFOA 4WWKD 1RFDH 4WO4D 3NTCL 4GKZA 3VMNA 3GSUB 5C0NC 5HYEA 4LGRB 4K7FB 4PY8J 4G6JH 3RWEB 5CAYB 4JPKH 4DEPB 5ALCL 5GSVB 3SDXB 3P77A 4AL8H 3C5JA 3LHPH 4RX4D 5FECA 2AABL 3S88H 3O8XC 2X89A 3BOVA 2GITB 3TV3L 1FGNH 1I3UA 1Z3GL 3DUUA 4D0BA 4DKFH 3B6SB 4F9PA 1M71B 2FB4H 4U1KA 5D7JB 3S37L 3F8UB 4QNPE 5IFAL 4GW4B 1NLBL 1QPPA 1XFPA 3VFSB 4HJJH 2WUCH 4JFPA 1A6VH 3NCYS 3KLAB 1S7XA 2VAJA 4Y19D 3CFEA 1G7IB 4NKMB 2OXGA 1OAXL 1AKJB 5EH1A 4LVNB 3FTGA 5AYUL 3X3FH 5ADOH 4ELKB 1INQA 4NO3A 1BFOA 1P4IL 1NCUA 1QEWB 3L5WB 4MJIE 3Q0HA 1HIML 4M4PA 4RRPG 4CADA 2DQTH 3LKOB 4LF3A 1D5XA 4NYLA 4U1LB 3O3DA 2JE8A 3S4SB 3QZWA 4I0KA 3P30H 4HJ0C 4W81A 4ZOCA 4QF1A 3FB7B 1YEEL 5JUEH 4JPIA 1JWMB 2Z4QB 4U0RC 2VITB 5T1DL 2AQ2A 2JJSC 1VFUA 4OBRA 1M7DA 5CJ5A 3HUJF 2BSSB 4MJIA 3U4BL 2ZOLA 3DV4A 5J8OA 3L9RB 3MRRB 4IDJL 5DS8A 5AYQA 4AENB 1U95B 4JREB 5IKCB 2FATL 3I2CL 4NN5C 3Q1SH 5IOPB 2CLZA 3R0NA 3QDHA 4NNXA 5I1GH 2AJ3A 4TSAH 1BX2A 4FXKB 5JW3H 1C5DB 2PR4H 3F58H 1IEAB 4KFZC 5BO1H 5C0EA 2BXYA 5IBTH 4UT7L 3QDGA 1DUYA 2ITDB 4QHNB 5D7SL 4KVCH 4PJEF 3UYRH 4F7TB 5FA3A 3MRNB 1KCUH 5IJKC 2GSIA 5L0QB 2LAGB 5GRXG 1VEOA 1X6NA 3D18A 1UJ3C 2PXYD 4PJCB 5GJTH 2DLEA 4NDMA 2HT4D 2PF6A 4BH7B 4U7MA 3TF7C 2F53E 2P44B 2D7PA 1I7UB 3H3PH 1UWEL 5HHNB 3JV6B 1UM5L 3V4UL 4P4RA 4J3SA 3HPLB 4NQDE 4P5TA 3TBYA 4GOSA 3D0VB 3TO2B 5GS1C 1HEZB 1OAZL