4EVNA

Crystal structure of fab cr6261 (somatic heavy chain with germline-reverted light chain)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
221
Chain Sequence
QVQLVESGAEVKKPGSSVKVSCKASGGPFRSYAISWVRQAPGQGPEWMGGIIPIFGTTKYAPKFQGRVTITADDFAGTVYMELSSLRSEDTAMYYCAKHMGYQVRETMDVWGKGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Heavy Chain
publication title Structural and genetic basis for development of broadly neutralizing influenza antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 221
sequence length 221
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2012-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4evnA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4evnA01
1F97A 5BV7H 3T0WA 4FFWD 5EC2A 1FCGA 4JQVA 3ULVL 3NIGF 2EH7H 3LEVH 2R1WA 2ZWLT 4X7DC 2NY3C 1EEQA 4J23A 3QEQA 4GBXA 1A2YB 3OKMB 4PJEB 3WIHH 5KG9A 1VFBA 1T21B 3CSBA 3FAWA 1CGVA 4YDIL 3H42L 4OM1H 4PGEA 1JGVH 5CGTA 5CILH 1PFCA 4PTTA 4P46D 1RUKH 3P0YH 2FGZA 4OB5H 5T33L 1TJGL 3QQ3B 3EYOB 3T8XA 1KIRA 1RJLA 4OLWH 1NGXB 4QHUB 1KBGH 4LPCA 3O45A 4GMTH 3DNKA 4X5XA 1GGCH 1BD2B 1EGJH 1FVEA 1Q9LB 4BSJA 5C0IB 2VZSA 1BZ9A 4HLJA 32C2B 3SDCB 3QG6A 1KXQE 1DQDH 5E1AA 3U0TB 4GG6A 5GGUB 3NIDE 5GS0H 1HXMB 4RNRA 5IQ7H 4EDXB 1D5ZB 4NWTH 5C0AA 3CFJA 3NCEB 3BN3B 4O4YL 4OD3L 5FM5M 4Q58C 3VD7A 3O2DL 1E4KC 3LKOA 1XIWB 1IGMH 3L3KB 4CVZB 1BBJA 4FZ8L 2HFGL 2WWKO 4D3CL 1A9BB 3R06A 5EN2A 2R9HC 3H9SA 4ZYKA 5D9SA 2Z8WC 4YQXL 3DETC 3NCBB 1A6VH 4Z78A 2VL5B 2GAZB 5D2LB 2F54A 1P7QD 1PG7L 1NBZA 4NC2B 4YXLH 1D5BB 2EYRB 1DVFD 1JNLL 5IMMB 1PEZA 4A6YB 4U0RC 1XT5A 4JQIL 4PV9A 4ONFH 5E94A 4JDVA 3QULA 3HR6A 5C0FA 4Z7OE 5I1AA 2UYLB 4U1HB 3V6FA 1HYRC 3KPSB 4RMUA 5CJQL 4V1DD 4JZJA 4ELMB 1LK3H 3JVGA 4B5EA 4Y4HD 2ZP0T 2OZ4H 4IEFB 3EO9H 3FB8A 5EPMA 4P2QD 2V17H 4Y16B 4KROB 3SKMB 4OAWA 4NKIL 4HUVA 1L7IL 3ZTJG 2GJZB 5J6GA 2FO1A 1BQLH 3MNWB 1U8MB 3VA6A 1KPRB 4KFZC 2R1XB 5C09E 3SOBH 2YZ8A 3VFWA 1JPSL 4D9LH 4Y4KD 3IFOB 4LLVA 4O2FA 1ZHLB 5EC1B 1OTTD 4M8QA 4Y5VC 2HT2C 5C8JB 5IFAL 1JF1A 4Z76A 2P8PA 4L8DA 3V52H 2PF6A 1MFAL 5F1SA 4QTIL 1X5XA 3CXHK 1VPOH 3FRUB 3HG1B 3WNPA 3Q1SH 3HPLB 1JF5A 2GK0B 1OSZB 2YC1A 3BQUD 3HA0A 1OPGL 1DEEA 1ADQH 4A2LA 4M4RA 2X89A 4LCCA 2VOTA 4HIJB 4YDJB 5EU5B 2YK1H 3KPPB 5AZEL 3B5GA 1LNUA 2FIKA 5LAXB 4JQXC 1GGUA 4FXKA 2O5YH 2A83B 4R2GC 2HT4C 3GSVA 3WSQH 4Y1AB 3PQYE 1N5YL 2J88H 3UTQA 1YC7A 4FQJH 4JFYA 2H2SD 4D8PB 3QNZA 4I3RH 4DKFL 5EBLB 1D5MB 1KTLB 3KXFD 1LO0L 3NOIA 4KVCL 4I0KA 4FQ2L 4IRZL 5CJ8A 3VFVB 1VEOA 5EA0H 3ALXA 4YFLI 4UAOC 1MCFA 4NCC1 2Z8VC 5C70A 2EEAA 4Z7UE 2CLRB 4NQXA 3QIBD 1WFTA 5C0BA 1ZXQA 4PPTA 3TFKD 4KI5D 1KB9J 1C8PA 3RNKA 2D7MA 1QBML 2R0WH 2FLBT 3SY0A 3RPIB 4EUPB 4QOKD 1T7XA 5CSGA 1UACL 5KW9L 3L9RA 3U82B 2BMKB 1XGYL 1IRAY 4MDIA 7FABL 4MAYB 3WS3B 3B3IB 2OJEA 3TT3H 2AEPH 2VXVL 2XN9E 4LKCB 2M2DA 3IETA 4NBYB 4EUPG 3F6LA 2YUVA 4XP5H 1RUML 1RIVH 3ZDZF 5J06A 2R69H 4JHBA 3TP4A 3HZYA 4D3CH 1AXTL 5C07D 1I75A 2DB8A 2XWTB 1V5JA 4J12A 5CCKL 5CINH 1N7MH 1MH5B 3AREB 4J4PA 1DUYA 3RNQB 2B0SL 3UP1A 4NM4L 1F11B 1JGUH 3H3PH 3TNMA 3SPVA 2X4QA 4IS6A 1KT2A 4YJZL 4GAYA 2X42A 4NQED 1RAMA 1VGEH 2Y23A 5I66B 1RZIB 2VAAB 3GMOA 1UWXH 5LWYL 2F74B 5ADOL 4JHWL 3CPLB 2QV2A 4PJ5D 3VH8A 5IVNA 2ESVE 1WUNT 5IF0A 2JB5H 3DBXB 4TSCL 2I5YH 4P57B 1HNGA 2EYTB 4C4KO 5DJDB 1RFDL 1NUGA 2B5IC 4MD0B 3WNLA 1MCWW 2BNQE 1UM4H 3PWLB 1D5IH 4JFPB 2Y1VA 1PKQE 2VWEE 2AK1H 3LD8C 1JMXA 4A2MA 1C16B 1JPGA 5KSBF 4GRWF 5KANG 5C08D 3WO3B 3C08L 4NO3A 1GC1L 1A6AB 3C60D 5F8QC 2NY3D 1L6ZA 2NW2B 1CQYA 4JFEE 3T1FB 5BMFH 1HYSC 5JW4Q 4WI2A 4WHCA 4POYA 3ZYOA 4CVXA 1M7IA 2H32H 5DJAB 1IGFH 4P2RB 5GGSB 3T04D 4X8XA 2VSDA 1HK6A 2X9WA 1EEZA 4KQ3H 1J10A 2VDOH 2C3WA 3BD4A 3MTRA 3VGEA 4WO4A 2VLKE 2E7LC 4PRNA 1LD9B 3VXQA 2GIYA 4LSQH 3NZ8B 4K94L 4XNUH 1NBYB 4EI5C 2R29H 2MSPA 4GAGH 43C9A 2J8UF 1DQQB 4AQOA 1NUDA 4HEME 2ICWJ 4XCFH 4IOIB 5LGHH 5JHDD 4R96B 3OAYK 4R4BA 5I15H 4WUUA 5D7SH 3QXDA 3LIZL 2ICEB 4R4FH 2PYED 3UDWA 1ZLWK 3SGDH 3ARDA 2YPVL 2CUHA 3LKSB 5FK9A 5B38A 1TXKA 3EDEA 1NCWH 1HHIA 1U8PA 1YMHB 2VXSL 4WHTB 5F7KC 4HIXH 4N0RA 2B7DT 3PDGA 3ZE2F 6FABL 3AS1A 2R9HD 2AI0H 3NCFB 1T0NB 3MBXL 3BT2H 4X7FC 5HGAA 3HR5B 3DRQB 4I77H 3DETD 2D31B 3P4OA 4NRYB 3V6OA 3L5XH 3BVNB 4HS3B 1HXYB 5TGBA 1UCTA 5DO2C 1HWHB 4RGNB 3K8KA 4L4TE 1B0WA 3A67L 3WHXA 2IJ0C 3RU8H 4EI6A 1JIBA 1FAIL 4F58H 1HN1A 1MQKL 3QIWC 2ZCLH 4PJ8A 2Q8BL 3QDJA 2IFGA 4JVPA 1FORL 2EKSB 1HZHL 1A3RH 2ATKB 1JHKL 3MGTB 4ODSL 5C1MB 3RI5K 5IESL 4ZO7A 4YBHA 2VDKH 5BQ7B 5H37H 1WJ3A 2L7UA 4R3SB 4L4VB 5B3NA 1I1RA 1S7XA 2R0LL 2GITA 4PJAF 4OM0H 1K3IA 4OBSA 3HLAB 3VXUD 5JO5A 1BX2B 3MODH 4QRQA 2DQHL 4M7ZC 3G6JF 5ANMA 5FKAB 4NQSA 1A2YA 4G6MH 1BPVA 3DV4B 1A6PA 4JHWH 3NN8B 4HIIA 2YUXA 2A6IB 5I16B 4NKMB 1G7QB 3CX5J 1D9KD 2HJKB 5DEGB 1B0RB 1AI1L 1TQCC 3GBNL 8FABA 2WP3O 3PP4H 2AK4D 4H5SA 3VFNB 5T5FL 4DZ8A 1WLHA 3BSZH 4UOW1 4L8SC 4QHUA 4YO0A 1OWWA 4O9HH 2LQRA 1NC4D 4LGRB 4P5MB 1N8ZB 5KSBA 1KTDA 2OCFD 4MQTB 5I74C 4DGVH 5K9KA 1J86A 2HVKB 9CGTA 2DTSA 5HY9A 4OZ4A 4YZFF 3QEQE 3BD5A 1Q9LA 2BVYA 3TYGH 2YD3A 1Y18A 3QPXL 4LMQE 5IIEB 3DGCR 2EIBA 4W6WB 5GRJL 4S1DD 5FUCC 3H3BC 1S9KC 3SGJA 1ZT4B 2ZKHL 3KHQA 2B8OT 4HZLB 5DFWH 1B88A 2HT4D 1RUQL 4APQC 2VL4A 1BWWA 1Q9KB 3DTXA 4KY1L 3EGSB 4KTDH 1T83A 2HVJA 4KTEL 3MO1A 1CGSL 2DQFA 1SJHA 1IKFH 3MOAL 3BKYH 1ZAGA 4K94H 1RUPL 4NN7B 2FH8A 5EBWB 5L9DL 3AY4A 1F58L 4MHHG 3VGFA 3T0VA 2VL5A 2OK0L 3HC0B 5DWUH 5EZLB 2ZCKH 4GG6E 3OJMB 1ZVSB 2D0GA 2QSTA 3BXNB 2ZG3A 4M1GH 5T3XD 1SM3L 2EYRA 4XCCH 3HZMB 4HS6B 4A6YA 5C0AE 5FB8A 2OI9B 2B2XH 2CXKA 5IVZB 4E41D 4LASL 2CDFB 1CXLA 2UYLA 2DKSA 5IB1A 3O6FC 3ZKMC 5E1HB 4WFEE 1ZKAA 5DRXB 4XX1G 5DJZA 4CNIB 4ZFFB 3H9SE 2EDHA 5FF6A 4AY0A 3LCYA 1UEMA 4GXVH 2F54E 3B6SB 4LHUB 4NBXB 3AB0B 3AS3A 5IB5B 1G6RH 5IEHB 1TFHA 1U8MA 3IAGC 2B20A 5FYKL 1ZHBB 3KLAB 1J8KA 5MHSE 5KVGL 2GJJA 2WUBL 3IFOA 3BPCB 3JV5A 4LHUG 1S3KL 3VFPA 5IFHL 4OIIL 5EC1A 1A6UH 1MRDH 2W65B 1JHKH 1RPQA 3LN5A 4JKLA 3TV3L 3V5KB 4BYHA 5GSRA 4EEEA 1CL7I 5GS1C 3U9UB 4HWEH 1BBDL 4MNHB 2VB5A 3UYRL 3NTCH 3HZKA 4JDZB 2O93L 4ZUUA 2ZUVA 4PRPB 5TDPB 2ATPB 1QSEA 1TZHB 2E5EA 3NFNA 3RWCB 4Q9RH 4LBEB 4ISVB 5IEKA 5HXMA 2ICWB 2C3HA 2Q6WA 3OJDB 1VB9A 5C0RL 4WFFD 4ZD3H 3DV6A 4D0CB 5CGYD 3G6JA 4XAWL 4CGTA 3S3JA 2UZIL 4HIJA 3FOMB 2Z93B 4CMMB 3JV6B 4QXTB 1YEDB 3GMMA 2FBOJ 2G60L 1F6FB 2QHRL 4LCYA 3MJ9H 5INDB 2ORBL 3AROA 4HD9A 1DBAH 2BY1A 3SGKA 5J12C 4WJ5A 4OCWL 1FP5A 3ROLA 1D5MA 1GPOH 4PJ7A 5ALBH 2Y6SC 4P23B 3ES6A 1ZHKB 5DK0A 3UTSB 5JOEA 2XKNB 5CEXA 5C0GA 3MV7D 4EI5D 1YMMB 3FOLA 1IEHA 3MOBH 1F6AB 3BP5A 3L3JB 1KFAL 1YEFH 4HPYL 2CJUL 2E8YA 4D9QD 3RKDC 4N8CL 3RPIA 3EYSH 5M95B 1RUQH 4NPYA 4ODWA 3B3IA 1FC2D 1X5FA 3MXWH 4KKAC 4NNXA 2GJ6D 1OP5K 1WISA 3MOAH 1A6ZA 3UTOA 1I9IL 4YWGH 4ZG1A 3KPQA 4LRIA 5TE7L 3SQOH 4MMXC 3PGDA 2NNAA 3AREA 2VZ3A 2Z31A 4AG4H 2ARWA 5C0BE 3EOAA 1DUZB 5DO2D 3QO0B 4HG4K 4R2GB 3CCHA 3N06B 4RDQG 3MNVA 2E9IA 4HAGA 1CGXA 4G80B 2QLVB 4OBRA 1DJSA 1XGPB 4X5LA 5ID1A 3HI1B 5CHNA 1KB5B 3VDAA 3QIWD 4A6YL 2VAAA 1CFTB 2L7JA 1IQDA 4RAVB 4UAOB 3SJVA 3LY6A 5IW6B 4MJ6A 3VG9B 4P57A 2RJMA 1DQLH 4PJCF 1FG2A 3BGFC 3RUGA 1QPXA 1HHHB 1MJ8H 1RMFL 3FT2B 4KKBC 2ERJC 1C16A 1RZGB 3BYYA 4R7DA 4JRYD 5FO9A 2BNRD 3IXTB 3QHFL 3RBSA 3L6FA 4TVPD 1GGBH 5F6IC 2IPTL 4KGLA 4JPKL 3NZHH 3KJ6L 1A6AA 4Z9KB 5GIRA 4MNQD 1QR1A 1LEKA 3SGDI 1WTLA 5D1XA 2OP4L 4Q7DA 4UQ3B 3Q3GB 3LH2H 1IZJA 2C4FU 4HXAH 5B21A 2H3NA 1KTKE 1RULH 1U8HA 4ORGB 1Q9OA 5DJCA 3QCTL 1GH7A 2CLZA 2D7TL 5I1HL 4JY4B 5E9DD 3CSPA 5EOCH 3RL1A 1QFWM 1I8LC 3O41B 2X10A 1Q9WA 1PD6A 1X7QA 1X5GA 3IU3A 5EU7C 1P84K 1MCRA 1JVKA 1NJ9B 1Q1JL 3MRJA 5IJKA 3ZYZA 1CGWA 2OR8A 3RTQC 5I6XC 1QOKA 2ZSWB 3TZVB 2Q3ZA 2FJGB 4RGOL 3O3EB 5D7JA 5I18H 4MXVF 3MNZB 4P3CL 1F42A 2OYPA 2UUDH 2FZ3A 2O26U 4BQ6A 4AT6B 3LD8B 4R6UA 4FFYH 1JK8B 3PNWB 2J2ZA 1KJ3H 3BZFB 3HRZA 5IROC 4ZUVB 2FX8H 4WHTA 1YMHA 3M1BB 4ODVL 3OKLB 1DLFL 4GRWH 2YBRB 5IB3B 3ULUL 1EFXB 1WCQA 3SKOB 25C8L 1MRFH 2EDKA 3L3DA 4PJDF 5E00A 3I6LD 3TBTB 5KVDH 4WU5B 4NRYA 3TIEB 2CK0L 4NQUA 2K1MA 4HUUA 4NC0B 3IAPA 4JDTH 3IS0X 5J11C 4OLVH 1N0XL 5J57B 3B9EA 4RX4A 5GS0D 4WUUE 4NO0D 4S0SD 2R39A 3SDAA 2AQ3A 1JE6A 1JRHH 3WFHB 4NFBA 4GG8A 5INCA 5JXAL 2EDDA 2DMKA 1NLDH 1KCUH 1AC6A 4JFQB 4XCEB 4KKLC 1BAFH 2W60B 1U36A 4YLQT 2FHBA 3NH7L 2I60H 1Z5LB 5I8EB 4HS8H 4U1IA 2LAAA 3MRBB 3O6FD 4EI5B 4UT6H 3ZKMD 1O5DT 4FS0A 1GL4B 5DS8A 4QNPF 4TUKH 1K2DB 2GI7A 4UQ2B 2JJWA 4QRUB 1OD7A 4L9LA 3OKEB 5HHXH 1PLGL 1JGLH 1KPVA 1MCOL 5C0CB 5AAWA 4XP4H 3ARGA 4P3DB 4YEFA 1S5HA 4X7CC 4KHXL 2AJYH 4GOSA 3V4PL 4MXQD 2IH1A 1C12A 4HC1A 4OF6A 4XPAL 5FYKE 3A6BH 1KG0B 4LPWA 2DWEB 3ZE0E 3QDJE 4WTXA 1UJTA 3B4NA 3UEZA 1MY7A 3BGMB 3R4DA 3PJSB 2P8MA 3ZDZE 1AJ7H 5A1AA 5BRZB 1A64A 1FH5L 2LVCA 4L5FL 2BSRA 1NFIB 3HI6L 3ARSA 3EDKA 3PV6A 1RVFL 4MYWB 4P5MA 1X5YA 5HSFA 1JI2A 3BH9A 2FYYA 4JRXA 1IM9A 1MFEH 3LKNB 1E0OB 5ANME 5HHQA 5CWSA 2DQJH 4XRCB 3W9DA 5IHUH 5HGBA 2I27N 4M7LT 3QIUC 3SQBA 1T4KB 2I9TA 3VFOB 1BEYH 5T1DH 4X4YA 1XF5B 3DSFL 1ZTXL 1YPZB 4PG9B 1T0MA 2Z9TA 1T03H 3P0GB 4NNYA 2NW3A 2ZOLB 4I3SL 1SJVA 2C1OB 3EGSA 4DGYH 3V6ZB 1KLGB 2CK2A 5FGRA 3QYCA 3UTPD 3LB6C 5KSBE 3HKFA 5C0JA 5HDQH 1OM3H 3G04B 5IKCB 4C59B 4NRZA 3CMOH 3GSRB 2FJFB 3GB7B 3IXAA 1F2XK 1TQCB 1EK3A 4ALAL 4PJ9A 1CQKA 4GQ9L 4OLYL 2V7HA 3ROOA 4Y19A 1P4BL 4LRNH 4KKAD 1A1NA 1MREL 5I74B 3KJ4B 1OAKL 5D7LB 5IV2A 1A21A 1FL5B 1WK0A 5BS0B 2X7LA 2VXUH 2WLYA 4WW2A 1OF2B 2BXZA 3WHE0 3HNSL 3BAEH 4PJDA 5AWNH 5L6YH 3O2WL 3AM8A 2KZWA 1IEAA 3O8XA 2AJ3B 1SBBA 2XTJE 1BIHA 1MAMH 4GXUN 4APQB 4HLZH 1L0XA 4G6FD 1CIUA 1UB6A 3BP6A 3T09A 4OQTA 3CFEB 1QKZL 4U1SB 3UZEA 4PJHF 3P9MA 4HHAA 4LF3A 4MS8C 1RSFA 2YPLA 1WFUA 4C56D 1HDMB 2EH8L 1UQSA 4CADB 4WGWB 2VKWA 4M6AA 3ZE2E 1WT5A 4P9HL 3R8BB 4UZGA 3GSOB 2A38A 4X99A 4MNHA 1QSFD 2BHYA 3UCRA 4JDZA 1W72B 4AEFA 1MFBH 3P4NA 5HHNB 2IANA 4PGBB 1IGIH 5I8OL 5KSUB 3K1KC 4YXHL 2VERN 1I7ZB 3L7EA 1AHWA 4HC1L 4D0CA 4ZO8A 3T08A 4TUOB 3FQXB 3VD9A 3X3FH 1OWRM 1RZ7H 3P73B 4YHZL 4CMMA 4WU7A 3FL7A 3JV6A 5BW7A 5CEZH 4HUWB 5IB4A 1H0DA 1H3VA 4C58B 5E5MB 4MGXA 3K8MA 2C3XA 4MD5B 4PRAB 3D3VD 1HE7A 1IFHL 5JPMB 3HI6H 1K4DB 1VERA 3GKWL 5DZOA 4BM7A 2Z92A 2FBJL 3W11C 5CD5C 1M6OB 2ZNWA 2Q86A 5F9DC 1KGCD 1QSEE 3VFGL 4IRSC 2XKNA 3LRHA 3W81A 4HJJH 5E8NA 2P42B 3ARZA 3GRWH 4NZJA 4P4KD 1D5XB 3L3JA 3RTQD 5B4MC 2UVEA 1NLBL 3KPOB 3G6JE 1RURH 4Y2DC 5E6IB 1NH6A 2HWZH 4YHNB 2FEEL 5GS1B 2V2WB 4UIMA 5DK2A 1RHHB 3GHEL 3WJLA 4FQCL 2C1PB 1Q0YL 3SE8L 2JF1A 5FYLL 2VLME 3MRMA 3G5ZB 2JJSA 4OD1L 3KGRA 4PJ7E 3BZEA 1ZVHA 4E5XA 5T5NG 3ULUE 3U7AA 1HHGB 3BJ91 3LMJH 2V5MA 5JDSA 4IJ3C 4M9PA 1OAXL 4GAJL 1FYTA 5JW4N 1NMAH 4EIGB 4HGWA 4N8VA 3V4VH 4OTXH 3QO0A 3OKNB 3U46B 5J12B 3D0LA 3OAUH 4LPTA 5DMJB 3O6LH 4X7EC 1CE1L 4KKLD 1KB5A 1OW0A 3P4MB 1AKJD 3QUYC 3S3SA 4PD4K 1FGVL 3MRNB 1YECL 2AGJH 1U8QA 3P4LA 5H2BA 1FE8L 3VMNA 1DSFL 1DN0B 2AQ2A 1V7ML 2CRIA 5FKPB 4B7LA 1CICA 3F12A 4LLMA 4U1GB 2F5AH 2Y07H 1R3HA 5EUKB 4B50A 1FVDA 4ENEC 1KCRH 3MYZA 3ILPA 2P8LA 2MMXA 1J1PL 1RU9L 3LKQA 4NZUL 5GJTH 3VXMA 1R3IH 5GRVK 2I07A 1DL7H 2DDQH 3DXAB 5CSBA 1WICA 5F1IB 1J0ZA 3MGAA 3L3HB 5DD5L 4S2SA 3RBGA 4NWUH 5AD0B 1KV3A 3ARTA 3I9GL 3DX8B 3EJYC 3D85B 1FYHB 4G6JH 2F8VA 4LDOB 5FA3B 5ALCH 3V5HB 2PTTB 3X12A 4PS4L 1MWAB 4OQTL 3QDMD 5F96H 3SJVE 2ITDA 4JFZH 1IGYA 2VJXA 5DD3H 5GS3A 4WRLA 3LEXB 3QA3B 1OSPL 2RQ8A 2GEEA 4GAFB 4HUNB 4IMLB 4KJYB 3RUGE 4JY4A 1OVZA 1XR9B 2NZ9C 4LLYB 3ILQC 4OZGB 1R5WA 1J0KA 2A6KB 1KC5H 3TO4C 4XPFH 4U1LB 2P5WB 2EDQA 4JFFB 4AIZB 4YHOH 1FL6A 2HJFB 4ACPA 5T1MB 3IVKB 1JRHI 3NACH 3QFJA 2H9GA 1CFVL 4HC1H 4HH9B 5GHWH 5BJTA 1CLZH 5L8KB 3U9PL 2DBLH 5EOTB 2FJGA 4GLRH 2Z91B 2IQ9H 3QIUD 3QUZC 4NKQB 3RGHA 1D7FA 5HYJB 1C08A 4JB9H 1A9EA 5FO8A 4PJGB 1K8IB 4OCSH 4WY7L 2ERJB 2GTZB 1LEGA 3S37H 1YY8A 35C8H 5IHZA 1DFBH 2EE6A 5ACMA 4IOSD 1KLUA 5K9OA 3EOYG 3PGFL 4M7LH 1GZQB 4X6BB 2Z8SA 2VXTL 5EIIA 4NT6A 1CBVL 5IVXB 2CKBA 4HDIA 4MDJA 4OLZL 3MRCA 2W9LA 3RVTC 1FVCB 4YHIB 5LXGL 2QL1A 1G84A 3KPMB 1U8NA 1UC6A 3RVWC 2IGFH 4I2XB 2CKNA 4OF3A 4UUJA 5EU6D 3DVNA 5FYLH 1A7OL 4HPOL 4XCEA 4DCQA 5CD3B 4OD1H 2YN5A 1CXFA 1JHLL 3ORJA 2EECA 4AYFA 1QEWB 4XC3L 4IIQA 4R0LC 3MYJB 3QJHB 3MRBA 4IOFC 3TA3C 3QXAB 2ICES 2AXHA 3RTQB 5I6XB 1RZJH 3KYAA 4GKSB 3PHQA 3VMPA 5AUMB 4NKDB 4JN1L 4M7KL 2D7OA 1MFCL 4TQEH 3S34H 5DHXB 1FDLL 5F21B 1C5CH 4ODUA 1V7NH 2EYSB 1JFQH 2CH8A 4KRPC 4YPGA 3CVIH 5TE4L 2QQLL 3E6HA 3IFLL 1NC2D 5DD1H 3G6DL 1KB5L 2CSPA 3BH8A 4J8RA 4X4XA 4DKDC 3SKUD 1G7LA 1FNEA 5ELIA 1MCJA 2OR9L 1U8IA 4KZDL 3T0AA 4FP8H 3GBLA 2BRRH 2QHLA 3RRQA 4JO1H 3GJEB 3VI4E 5T3ZD 1ODAA 3O4LB 1A6TA 1S7UA 4N0UB 4J2XA 1Q94A 3DMMC 1N5AB 1HKLH 5KAQG 4LCWA 2JTDA 5E70A 2VXQH 3AAZA 3C5ZC 3LKNA 2EDYA 5IMKB 2VDQL 4WFHE 1LILA 4DUWA 3STLA 1TTUA 2IPUK 1C5DA 3MRDB 4YUEH 1RZFH 2AEIT 2NCMA 2DS4A 1TJIH 3FRPG 3P30H 4ZTPL 1YN6B 1RI8A 3E3QE 5D1QC 2G75B 4F9LC 1XH3A 2A77H 2EE9A 3SE4A 5TFSL 3W11D 5CD5D 3HMWH 3PDOB 4NQDA 3CVHA 3MV9B 3MUY1 4JRXE 1JUFA 4LLUA 4I0CC 1EZVY 4M48H 5B4MD 2VZUA 5BVJB 2R0ZH 2FX7L 3AFLA 1CDCA 4X6EB 2VLJD 1T20B 1A0QL 3S4SB 4YDLB 5IR1A 1PX3A 1S9XA 5E8DH 1NCBH 5B3JF 4K23H 2E27H 3CFDB 5FYLE 3LEYH 5F7EL 5KVEH 3CFBA 4RWYH 4FQLH 5CBEB 5I17B 3FONB 4LVNC 3IAQA 2QR0A 3S4SG 1FL5A 2IG2L 5BS0A 5EU3A 5I73B 4ZS7H 1FFQA 5DUBB 1HHJB 2HFEA 3RX5A 1OF2A 4NZRH 3F7VA 2CKBL 2ENYA 4HCRA 3N1FC 3RQ3A 4M6OL 5DVLA 1KIQA 1YEGL 2AJ3A 2BOCB 3ARQA 3GK8H 5J9PA 1I9JL 2GSIB 3ET9F 3LQAC 1I85C 2A6DB 2XZAH 3CLEL 1T89A 4UV7L 3WXVL 5DYOA 3RWGA 2KH2B 4Y19E 2AV7B 2DQDL 2ADJA 5FGSA 1BGXH 1MLCB 4HWNA 4WVRA 1JHLH 1QFUH 4QCIA 3DURB 4P49A 2HLAB 4G42A 1EFQA 1L0QA 4NQVA 3LSOA 3TBYA 2XG4A 1AXSB 1LK2A 3G6AA 4HIEA 2BVPB 2IEPA 2QQKL 4TOYH 4ENED 4LCIH 1IC5L 3GJFA 4CVUA 4PJDE 1MVUB 2QQNL 3QFDA 1ZGLM 3ARBB 2IQAB 4IRJB 1WBZA 3MCLH 5DUPH 1GZPA 4JFHD 3R0NA 1G9EA 1TVBA 1ES0B 5HGDB 1ZSDA 1R6VA 3RWEA 1OOAA 1DDHA 5GGRB 3UTTA 1YNLH 4PGBA 4CBPA 2DIJA 1A1OA 3UJTL 5ADPH 1GOGA 1WTGT 3EYQD 2BDNL 1C7SA 2A73A 3SE9H 5SWQB 5D2LF 1U2HA 4WWKA 2YPLE 2VC2H 2HT3C 5E08L 1IL1B 4YFDB 3UBXB 2XZCH 5T1KB 4K8RH 4Y5YA 1HSBA 1JGEA 3ILQD 3CZFB 3LS5H 4XHQA 3OPZL 2MCG1 2ILLA 1C1EL 4NYLA 3TO4D 4BQ8A 1YJDL 2XA8H 5HHVL 3PGCB 4K9EH 4K3GA 1HQ4B 4F15B 2NXYC 2IANE 4QRSA 4ELMF 1NC2B 4OCXL 3GMPB 2R4SH 1G7HB 4Y7MA 1X44A 2X4NB 3AU1A 2W92A 4MLIA 4UOW0 1A7RH 1AD0B 1XGRA 4YHNA 3C9NA 3IU4H 4MAUH 4PV8B 5D6CA 5JIPA 3HUJA 4GKNB 2A74B 1BQSA 4RAUB 2NXZB 4JKPH 4EDWH 3AXLB 1L7TL 3HE6B 3MRQA 2KBGA 2VLRD 3B9VA 4XAKE 2CDEA 2G5RA 4H8WL 4Z5RB 2XWBB 2NX5D 3G5ZA 3L95B 4Z7QF 3V7MA 5F1NB 3MLYL 3OKKA 4G8FA 2MCPL 4Z8FH 1AO7B 4L3ED 2H1PH 3W2DL 4HK3N 1I1AC 3D39A 3ZMRA 2VR9A 3ZKNC 3EKCA 3WS6C 1VADA 3BEWA 1MPAH 3WE6A 5EBGA 3MREA 4RFOH 1HILB 3RVWD 3TBSA 1ZHNA 5IBTL 5ILTH 1QD0A 1WFOA 4P59L 4XPHL 5JIHA 1FIEA 4LLQA 4OV6F 5C2BL 2LVEA 3W5MA 1UH2A 4NZTH 3U6RB 4UDUB 4FQ1H 3P4MA 4G5ZL 4WI8A 4IRSB 5IBLC 3EIFA 4IOFD 1K8DB 4LK4A 4LSUH 5FGCE 5F88B 1DN0A 5EO0B 3FCTB 4Y2DB 3GIZL 4LCUB 3IKCA 4XPTH 1FYTE 4HCRL 2YSSA 3PABB 1FZJA 1OCWH 4G9FD 4GLRI 4Q2ZA 3U79A 4QYOA 1P7KB 2OBGA 1MHHB 3R1GL 1NDGA 1FLTX 4DZBB 2AJVH 5DJ8A 4KRPD 2ADGB 3WD5H 5JTWA 1QYGH 3CJJA 5J6HB 3DSNA 3W9EB 4NO2A 1RJCA 2DQIL 5BO1L 3VWJA 2PTTA 1HSAA 2UWEF 3OHXA 4GW5A 4XC1L 3NCJH 3MFGB 4IJ3B 2W59A 4QXGH 5E99H 3O2VL 3KR3L 1IBGH 2G5BB 3T65B 4YHYC 2DQCL 1IC5H 4MX7A 1X5AA 2A9ML 5DJ0A 3VFTB 3MX0A 4KDTC 4BZ1L 4P2YA 2KQNA 1XGUA 1N59B 3DMMD 3TH4T 4LQ1A 3QEGL 5TDNA 3VXME 1CFNB 3C5SA 3ZT5A 3U36A 1CVRA 1KIPA 1S9YB 3JV4A 3BESR 3C5ZD 3OWEA 3G9VA 5DRNA 3QUYB 5EZOL 2OQJB 3QEUB 2UY6A 3GI9L 4O58L 3N1PC 1MAJA 4AM0A 1FAKT 5HGHB 1INEH 4PLKD 5E08H 1WVZA 3ZT7A 2XFXB 4KHTH 1ZVYA 4LLDB 4OZFG 3MRLA 4FN0A 5DD6A 3EOTH 5E8PB 4ZFZA 3L3GA 3REWA 2HYMA 4NBZB 1OGAA 1BOGB 2IAMA 3BIKA 1S7SA 5HJ3A 4PRHD 2AS5M 4OGXH 4YDVA 1QFWL 4KAQL 4DTGL 5KN5B 3QFJE 2FD6H 5DT1L 3WIIL 4K3EL 3DUUA 1OARH 3TT1L 4CW1A 4JGJA 4KMTL 3FMGL 3HAEB 3IJYA 2VQTA 3GSQB 1WAAF 3QDGB 2EDRA 2QKIA 3NA9H 2XKUA 2XWJB 5HHOD 1PSKH 5EZJB 3TO2B 2W0FA 5IQ9B 4EN3C 1CDJA 3T4YB 4DAGH 5EWIL 4CL7A 4GFTB 3T0BA 1I7TA 3VCLB 5I30H 3TO4B 4W4OA 4UU9B 2FECI 2DQGH 3HAEG 2EDXA 4MB5A 1QEWA 4ONHA 3CVHH 4R26L 5DR5H 2YR3A 5DEZA 3RZCA 2ZG2A 3SO3B 5AUMA 2FWOA 3QUZB 5GQBA 3V0WH 2MPAH 4BZYA 1JTOA 4NHUA 1G7MB 2EDEA 5JR1H 5HPMA 3F6IA 3HE7C 2EYSA 3W0WA 4HT1L 1NSNL 1WZKA 3IF1B 2AJUH 3T0DA 3E1F1 1IAIH 2X4SB 4UDTB 1UWEL 1W0WA 3B8YA 3DVFA 4JM4H 3F7RA 4DW2L 4CU6A 4O2EA 4PY7B 3SDDC 2JJTC 2F53D 3CDGA 1RZKC 1AIFA 1WCBA 3ZHDA 1NGQL 1U8JB 1KJ2B 1NFKA 4Z95H 5EUOA 2BVEA 2APFA 3B2UC 1Q8MA 3MMEA 1RIHH 5F3HA 3FB6A 1N5AA 2W9EL 1PW3A 5D2NA 2ITCB 1WWAX 2VWEC 1IC7L 1H8SA 3HPJB 4XVSH 4G6KH 5IMKA 3ULVC 2IFFL 5CJXA 1EO8L 1DQML 3PHSA 3LQZB 3TA3B 3KDMB 3MACL 3MRDA 4NN6C 2WIIA 2RCSL 2HT3D 4XNMB 2UWEA 3L5JA 4JFXA 4JHAH 4P46A 3D0VB 1R24B 4Q0XL 3VXNB 4PRID 4I5BB 3GJFH 1NGPH 2VQ1B 3LPFA 4OSUH 3O3UN 4M61B 1P5VA 4MJID 3PDOA 2ZUTA 2HKFH 5SV3A 1NGWB 3MV9A 4PP2B 5JPNA 4G7VH 2PO6C 4LCWE 5SX5H 1BQUA 2NXYD 4NM8L 3VGDA 3OGCB 4KPHL 4JKKA 2WINA 3HN3A 4Y89A 4KI5F 1CR9L 3O3AA 4LSRL 3QG7H 5KVFL 4DVBA 4QRRA 2X41A 4W68A 1AFVL 1XF4A 5DXWA 2UUDK 2NY7H 2NY5H 3MLSL 3LDBC 4X6EA 5IWLC 1FNSH 4Z7WF 1MJJB 5TQ2L 4PFEA 1DBKL 1FLRL 4JN2A 2DM7A 4DGIL 1JMZA 2VQUA 1R0AH 1HQRA 1HIML 4LVHB 5CBEA 5I17A 1F90L 5ID0B 1BJ1J 4NQDE 4FQXC 3C5ZB 2YEZB 1CFSA 1NAMH 1MF2L 3UPAA 1EO5A 1I1AD 2B4CH 4UNTA 3ZKND 3MLTB 4JM2C 2EDFA 5EFIA 4ZODA 3WDHA 4ZQKB 4HGMA 1K6QL 4LSPL 1HINL 3QNYA 4JO3H 5MEQA 5DSCA 1P7QA 5FYJH 5D1QB 3CUPB 2MJWA 1FZMB 4IHOA 4JCLA 1WAAA 2P44B 1DVFA 5I1CH 3PL6C 4J6RL 1WBYB 5I0DA 4CAGA 43CAA 1MUJA 2CLVA 3QUMH 3RIFF 1DQJB 5IBLD 3U4BL 4HFWA 4KV5E 1OAUH 4V1DA 5BS0E 2NPLX 1HEZA 5CEYB 2BVPA 5L7XH 4Y4HA 3G5YB 2CR3A 5I1GH 4PBXA 1G7JB 3UROR 4AEHH 4X6CB 3MLUL 2AJZB 4MZ2A 2LTQC 1IGTB 2Q87A 3VXPB 4P2QA 4LL9A 4HF5H 4CN1A 3GUTB 4RISH 4UT9L 1F4XH 1QG3A 2NTFA 1SYSA 4M62L 4PIRF 4G9DB 2FR4B 4ETQA 1IQWH 1KCSL 1OAZL 4LVNB 4KI1A 4AJ0A 4OZIA 2ZOKB 3S97C 4XT1C 2AEQL 4RFNB 4U1NB 1WWWX 4XH2B 3VFMB 2CRZA 2P5EB 4Y4KA 4M7JH 4GKOA 3PIQA 4XCNA 5HYIA 4EIZC 5C09D 4NKOA 3IDIB 3DO7B 5GRXG 1BQHB 4EBQL 3BFOA 3VD4A 1Y0LA 2X2YA 3CLFH 1TJHL 5D96C 3C5JA 3PWJA 3D2UB 2FJHA 3FO0L 4P5TA 4S1RH 3NABH 1OGTB 3FB7B 4KUCD 2BCKB 1HQ4A 4LEOA 1XEDA 3BEVB 1NCAL 1BQHG 3X3GL 3UTTE 1QLFA 3BQUA 1DE4B 1QQDA 1TZGL 3WLWD 2HP4A 3DGGB 4QHLB 4D9RE 5LGJB 2O61B 4JG1H 4GBXC 4EQ3A 4YHPA 3V0AC 1R3JA 4RBPH 1N6QL 4EJ1C 5D72L 2DIBA 4H0GA 1CD8A 3HE6A 5ITBL 3NFSH 1FFPA 2EEBA 5IMLA 4L29A 3U4EB 3GHBH 1JCKA 4HKZA 3PQYD 1IC4L 3BO8A 8CGTA 4LAQH 4ETYA 3WLBB 4F2MA 3U7WH 4ZFGL 1SMOA 4QEGA 3QIBA 3C6LC 4QRPD 3TJEH 2X4RB 5D7KD 3I3DA 3QXWA 1VENA 2GQHA 1FLRH 4QOKA 5T1LD 3VGGA 4FXLA 1I8KB 2XZQL 3HUJE 4DGIH 4EN3D 4RA0C 4Z7WA 1SBSL 5DDHA 2VABB 1UG9A 3OR7B 5HHMD 3U6RA 3I02A 3PWVA 3MFFB 2NXYB 4YHML 3CFCL 2EC9T 4YIQB 4X6DF 5C07A 3FCTA 1YNTA 3D39E 4M3KB 5MI0C 3ECBB 4WV1A 1U6AL 4KJPC 3ZTJH 3QI9B 1FIGH 3VWKA 1NGYB 1PQZB 1INDH 1FFNA 1P7KA 1W0YT 5JUEL 5A3IC 3HE7D 4OUOA 4F7EB 3MRRA 4DZBA 3B2VH 4QTHA 2KUTA 4NQEA 4J6RH 3B5HA 1BIIA 5F3BB 1JF6A 2Z0BA 5DHVB 1G9ML 3O6ML 1E28A 3KLHC 1AGCB 1ZWIA 4ZPTA 4PJ5A 5HYFA 5DC9B 1I1AB 2BJML 4X7TA 3SDDD 1HH6B 5F71A 4EKXA 1PZUB 4QWWD 2X1QA 1PAMA 2H26B 1T22A 3ISWA 4MZ3A 2E7CA 1TPXC 4Z6AT 4WEBL 4OCLC 2PXYB 3B2UD 2J4WL 1M71B 1D6VH 3JVGC 4EXKA 5MERB 4QRTA 3SKJL 1CFNA 5C08A 4R97B 2HJLA 5ETUA 5CJOL 4ZFOB 1CK0L 3C60A 3SBWA 1CGYA 2AKRB 1OAZH 2A9NH 2XPGA 3TBWA 3JTSA 1SJEB 3ULVD 4OZFA 1GC1C 1RZ8A 2CIKB 2EDLA 2OQJA 3QEUA 4S1SL 3JXAA 2XIDA 3QQ4B 1KN4L 4DK6A 4ZXBC 3ZDXE 4WIQA 1JNNL 4QLRA 4N1HB 2YOCA 5EU4A 1O7SA 4H88H 2ZUXA 1CCZA 4L3CB 4U6HB 3D18B 4FTVD 1EMTH 5F9JA 1N64H 2Q1EA 1JBJA 3C6SA 2Y7QA 1JGDA 3T77A 5ICYB 1AP2A 4JZNA 4UIKH 5JNYA 1CLYL 4OCYH 4Y4FB 2EIZA 1DANT 3JWOC 1FC1A 2VO5A 4N5UA 2AABH 2ZPKL 2PO6D 4HKBA 5EORH 1UM6H 5D1ZA 1X5JA 1Z3GL 2VLKD 1IAII 5DRZB 1XGTB 5EOQL 4Z0XB 3P0VL 4IM8A 2PYFB 3WO4C 2GTWB 5JHDA 5M7QA 2D4FA 1UM5H 2V2XB 3FB5A 3A6CH 3TO2A 4EUPH 4HXBH 2PYEA 1OGAE 3SE3A 4O02H 5JLZB 1QLEH 6CGTA 3FQTB 5DD0L 2PW2B 3BUYB 5E5UB 1E4KA 2Q8AH 5I1DA 4PYGA 1YYLH 3HC3L 3BDYL 3GGWA 5DA4A 4JM2D 1WC7B 2X70B 3SDXF 4TULH 2APWA 1EJOL 1JJUA 2WAHA 5FO7B 3T3PE 4HAFA 2F8OA 3GIVA 3PXHA 4X4MA 4U1KB 5ENWB 1VGKB 3E8UL 3WFDH 3TCLA 3PL6D 5F7MC 3P2TA 3LHPL 5KSAB 2DN7A 3MLVL 2Y06L 4UDTA 3QH3A 3FN0L 2YRPA 3HTLX 1BF8A 4B53A 5DLMH 4FG6C 4X6DA 2PW1B 4XI5D 3SDYH 1EXUB 2BY3A 1U8JA 5DJ2A 3WJJA 5DURB 1X6LA 4Y8DC 1N2RB 4Z7UB 1ZGLP 4LSDA 3MLXH 3EO1A 1I1CA 2NY6C 2HN7B 2WSKA 1RK1B 3HFML 1ORSB 3VXUA 1ZGLA 4YFLF 4J4PC 2Y36H 3W0WE 1H3XA 3MJ7A 2A1WL 4WUKL 2YPKA 3OAYH 3VI3F 3MZGB 2X4TA 5LCVH 5DHYA 1PZ5B 2V5YA 2DI7A 1YEJL 2VMFA 3KPLB 2E9JA 1WWCA 1QRNA 2FGWH 2XN9B 2DTML 4H25A 1ZLWH 1G9NH 1FBIH 1D9KA 2XNAB 4Y5VA 1R24A 1U58A 4UV4L 4FNLH 3WKMH 5F89A 1QNZH 2DQEH 4UT7H 3RWFB 2AK4A 3TN0B 3FQWB 2J4WH 4M61A 4W70A 3MA7B 4BSVB 1L4IA 5EUOE 1JZ6A 3ARFA 1NC4A 5IK3B 3VMOA 5KVMC 1T7VA 3BISA 3IDUA 5D2NE 4ODHL 1II4E 1XCQA 1YEHH 1KTRL 2W0KA 2HRPL 5ESVB 5HHPB 5ISZD 1U3HB 3EOBA 3QEQD 3DRTA 1BVLB 4GBXD 2ESVB 5K9JH 3OR6B 1ZK9A 1L0YA 1K3ZA 1RK0B 2UWEE 1I7UB 3BKMH 4G8GD 4QXUL 5SWZA 1H5BC 5DFVC 1ZT1A 2BNQB 1VESA 4JR9L 4TSAL 1HHKB 1PKQB 4XBEL 4XNYH 1S8DA 1FZOB 1S5IH 1U9KA 4HBCL 2WBJA 2R1YA 3MV9E 4AMKL 2PETA 3CZJA 5E7BA 4UINL 4BUHA 4GS7B 2GW5A 4WTZG 5FYKU 3MLTA 4TSBL 4KGJA 4JFEB 4NN6B 2D7QA 2VDNH 1P4LA 2FO4B 4XMLL 1ED3B 3C6LD 4PBVC 3O0RL 4QRRE 4F7TB 5CBAA 1IEBB 3RFZC 3HC4H 2VDLL 3QNXA 1K4CB 4KMQA 5GZND 2R2HB 4QT5A 4NRXB 5H94A 4U6VL 1WBYA 2WW8A 3IYLW 4M8VA 4XVTH 1WEJL 4E41A 3IDMA 5CIPA 1PG7W 2GCYB 3TIDA 3UDWC 4NGHH 2VLKB 1OQXA 1T2QH 2R23A 4UTBH 3S98A 3CXDL 3EDJA 2Z4QA 2C3VB 4GRLC 5IMOA 3F58H 1CXEA 4X6CA 2BSSB 3UJIL 3SDXA 4KJPD 3LDBB 4WFED 1A02N 3GUTA 3VE0A 4RIRA 1XF2B 2EE3A 3SKNA 3DX7B 5DQ9B 1JNHA 3V6OC 1F4YH 1WAAE 4XGZB 3TNNA 1KJMB 5DTFB 4CN4A 3KLHD 1LE5A 2ZOKA 3FKUS 4FQXB 3GNML 4OCNC 4XH2A 1CLCA 2F5BH 3MJ6A 4M5YH 2HFFA 3BGAA 4I0PB 1MHPH 3ALWA 1VFAB 3LRSA 4FZEH 1GIGL 4V1DE 3ZTNL 3IDIA 4NUGH 4PJ8C 1I4FA 5K59F 4HKXB 2W0PA 3MCG1 5I8KL 4YC2B 3QUKB 1UWGH 4X8JB 4P2QE 1H3UA 2KL6A 4LSTL 1Q72L 3L3IB 4FOMA 5IOPA 5FUOH 3BPOC 2J6EA 4L4TB 4KUZH 4D0DA 1GGIH 5KBNC 2AJSH 3S88H 3MRIB 4JLRA 1IGCH 3RY5A 5DJ6A 1OAQL 5I8CA 4OZIE 1OTUD 3C87A 4KK8C 4LNVA 2C26A 4ZXBD 4RQQA 5IGXH 3WBDA 2P45B 4QHNB 3E6FB 4BFEA 2I9LB 5LQBH 2BX5A 2XG5A 3RGVA 4X0KB 4LDEB 2C7UB 5LG1A 3CC5B 1M7DA 2VDPL 2E7LA 3GSXB 3QHZL 1I1YB 4ONGH 1U91B 3MV7A 1ZANH 2CGRL 4RFEA 3G9AB 1C5BL 5E2VH 3STZB 4U1JA 3EUUA 2IADB 4KXZH 4O51A 5SWSB 1V3JA 1NL0L 3MRFB 1FRGL 4JG0L 2X89D 3GO1L 3SDCC 4DFHA 4N9OB 1W0VB 1CLOL 2ZUYA 4FMFA 5I1JL 4JO2L 1E27B 3SGJC 2FX9H 4LIQL 3VG0L 1XMWA 5CJ5A 2IBGA 3LQMA 2OTWB 1CT8A 2YD6A 5FHBL 1LP9F 1E6JH 3KXFE 4RMWA 5GGSY 5EC2B 3U1SH 5DK3A 4DKEH 1TZIA 4OCRL 2DLEA 4Q74A 2D7PA 5F93C 2R1WB 3TGXA 1T83C 1MNUH 4KZEH 1NAKL 1OL0A 3QEQB 1N6VA 5KJRH 3QI9A 5KG9B 1VFBB 5DA0B 4PJFF 4KI5E 4NHCL 4Z7VF 3QWQB 4PGEB 4F7EA 4QOKE 1GAFL 1B4JH 3QZWG 4PTTB 5CMAA 5T3XL 5F9OH 4Z7WE 5ERWA 2OTUA 4NQCD 1F5WA 1QBLH 2XTJC 1JYVA 5A16A 3QIWA 4XVUC 1KIRB 1RJLB 5FECB 4FG6D 1HH6A 3EJZC 3O45B 1MHEA 4HX1A 4C83A 1LDPL 2CD0A 1QPPA 5C07E 4DQOH 4X5XB 1UCBL 4M5ZH 1FVEB 1YUHA 2NY6D 1XGQA 1BZ9B 4FQIL 4XWGH 3T4AA 1LE9A 4JRYA 1NDMA 2BNRA 5MERA 2VYRE 4Q9QL 3QG6B 5E1AB 4J4PD 3O9WB 4GG6B 5I1EL 1DLHA 4Y16C 3HMXH 4NQEE 4FRWA 4FQHA 4RNRB 4MNQA 4X98A 5DVMA 5I0ZA 3VXOA 1LO2H 5C0AB 3CFJB 1VA9A 1J8HD 4KVNL 4PJ5E 4WI4A 2ADFL 1YEEL 4EVNA 4L3CA 3LKOB 4ZOEA 1BBJB 5EN2B 4MA3B 5IVOA 3UO1L 4Y4FA 1F8TL 5E9DA 3H9SB 5E95B 4ZYKB 4CDGC 3BWUC 1RJYA 5D9SB 4Z78B 3S5LA 4OKVA 1V3KA 1BFOA 2YKLH 5DUMH 5C08E 4K55A 2F54B 4K2UH 1NBZB 2FHFA 3GMRA 3HNTH 3QXUA 2J6EL 3C09B 2NY0B 5H37G 4NJAL 5DRZA 1XGTA 5B8CA 3V0VA 5E94B 1PVHA 4JDVB 3QULB 1DEDA 3PUCA 5C0FB 2MOVA 1QBBA 3RWHA 2YWYA 5I1AB 1T1ZA 3V6FB 3UPRA 5DFVD 1FO0A 4JZJB 3MSPA 4XPBH 4BH7A 5KANI 2YA1A 3F7YA 3FB8B 5EPMB 3O4OB 4FQQA 4LFHG 3U83A 3SGKC 1A7QH 3VXTA 3B9AA 1FGNH 1ETZA 5J6GB 2WMPA 2ZUQB 4JFDD 1EGJA 3ULUC 3HZVA 3OJVC 5FCUL 1SHMA 4H20L 1OD9A 3VFWB 2NR6D 5JHDE 4LLVB 5TF1L 1FNFA 4O2FB 1VGKA 4NO0A 4M8QB 4PJIA 1I1FA 4JO2H 1EEUA 1JF1B 4Z76B 3H9YA 2P8PB 4L8DB 4AEIH 2PYEE 3QWOA 4WUUD 5KSAA 3N9GH 5I1KH 1JPTH 4S11A 1CDYA 1TVHA 3LKRB 1H15A 3UTZA 3O6FA 4F57L 1LP9A 5EOCJ 5EO9A 1B2WH 4GRLD 4J3UA 4MXWL 1YEKH 1UB5B 4MA8L 1A14L 4M43H 4TTDD 1DEEB 1G7IA 4KMLB 1O0VA 2VISA 5KZCB 1LO5A 4LRIC 2APBA 4LCCB 1SY6H 4PJFA 4X4ME 5FYJD 4FFVC 4Z7VA 3AREC 1NEUA 3LZFH 5L88H 1I7RA 1QTYT 4GMSH 2Z31C 3DI3B 4EZMA 5GGVH 1LNUB 2FIKB 1T5XA 3IT8D 1NCDH 4FXKB 4XTRC 2PR4H 3GSVB 1PZ5A 1UADC 1NMBL 5CZKA 1MRCL 3UTQB 4JFYB 3UXFA 1LO3H 5FYKD 1JV5A 3QNZB 4TNWF 4OKDA 1RUAH 1AGBA 1WBXA 4PJ8D 2AXFA 4DOHE 4RGMC 4X6DE 3O6KH 3D25A 4AH2A 3TN0A 2OZ4A 3T0XA 1FJ1A 1ZLSH 4PY8I 1F2QA 1P1ZA 4NQXB 3M17A 1MJUH 5C0BB 4C54A 2BSTA 1IT9H 3RNKB 2B1HH 3VXUE 1REIA 3SY0B 1N0LA 3RWDB 4NFCA 3P11H 3BPLC 5FDWA 3BRDA 3L9RB 4MDIB 1NMCC 4KK8D 1HCFX 3GI8L 2OJEB 1JWMA 3D9AL 2ADFH 1QRNE 2MTPA 4PJXA 4XB7A 1IAOB 3IETB 3WFEL 3D6GA 4LQFH 4PUBL 5F9WB 1G9NC 4AENA 1EHNA 3HZYB 2MWCA 2NY6B 4YDKH 1E6OL 3C8KA 4WTZA 1KN2H 2AK4E 1IGJA 3I50L 4NSKA 1NGZA 1DUYB 1IARB 1ZT7B 2MQCA 4BK5A 3D69A 3C2AH 3VFSA 3BWAA 4X4ZA 1MHCA 5BV7L 3TNMB 2X4QB 1WIUA 4IS6B 1KT2B 3BW9A 1VCAA 4GAYB 4NJAH 3WNOA 3LEVL 5CUSH 2E9BA 2ZNXA 1ADQA 1BD2D 3S36H 3GMOB 5I1IH 5IJKC 1D6EA 2QTEA 4OM1L 5IF0B 5SWZE 1JGVL 3SDCD 5ECJE 4W6XB 1RUKL 5D7JC 1VEPA 1YN7A 3OV6A 5J3HD 3QJFA 3P0YL 4LIQE 4OB5L 3FT4A 4UILH 1U95A 4ZUSA 5L2JA 2MHAB 4TUJA 4OLWL 1CG9A 5FV1L 1KBGL 3NAAH 1IAKA 3PG2A 4NO3B 1LDSA 1PY9A 2VN4A 4GMTL 4RRPA 2XI9A 1XIWD 3V5DA 1GGCL 1EGJL 2R15A 5TPWH 3IDNA 3V7AG 3WIFA 3MLZH 1DQDL 4R9HA 5T3XE 5GS0L 1N4XH 5FOJA 2UZXB 5C7XH 4XMKH 4RGNC 3FO2A 5IQ7L 1EEZB 4ODTH 4NWTL 4XVUD 5LGKA 4E41E 4I0PA 1A8JH 2L4OA 4BJLA 2D7NA 4MHHI 3K3QA 4PR5A 3EJZD 4WO4B 1IKNC 3IDYB 1EEYA 4JKWA 3VXQB 4KK5C 2NMSA 4X6CE 4LAJH 4JY6A 3SDXE 1QSFA 3REVA 4HFUH 1YQVH 3M8OH 3MRPA 4KXZI 4P9HC 43C9B 1A6VL 2XV6B 2FNBA 3KNBA 2H2PD 4R4BB 4Y16D 5DVOA 3W39A 3QXDB 4OUUA 4YXLL 1OAYH 3OGOE 4Q6IB 4JE4B 3W82A 3ARDB 2OSLA 4POZC 4ONFL 5FK9B 1AR1C 5D6DA 1JYXA 2VUYA 1U8PB 2EDTA 1X9QA 3FFCB 4KJQC 3TVMB 3D3VA 2ENSA 5I19H 4ZTOH 1LK3L 1KXVC 3ARWA 5HGAB 1QZ1A 2OZ4L 4G6AC 3P4OB 4H1LA 1SEBA 1YDPA 5SX5K 5TGBB 5GZOD 2V17L 4TVPH 2OR7A 4HQQH 4MB3A 5GRVL 3HG1D 3WHXB 4P4KA 5F7HA 2O5ZH 5AZ2H 1BQLL 4EI6B 5GGVY 3DVIA 4MD4A 5SWSA 3SOBL 4LEXH 4JANA 3QDJB 4D9LL 1YNKL 1L6XA 2H32A 4I48A 3QBTB 2AV1A 2ZJSH 1E6OH 2YMXH 1W0VA 1OT2A 1NCUA 3BX7C 3V52L 1NBVL 1Z2KA 1S7XB 1BVKA 4I9WD 2GITB 1AXIB 1WSST 2EO1A 4Y5XB 1VPOL 5JO5B 4NJ9H 2MKWA 3Q1SL 5E03A 4QRQB 2XQYG 3MV7E 2JCCF 2G2RA 1CFBA 1X4YA 3QZWA 4XP6H 4YX2H 4U1MB 3ULUD 1AE6H 3Q6FA 1WWBX 5ANMB 3G08A 4NQSB 2ICWI 1ADQL 4NN7C 3PXJA 4HIIB 2OXGA 4LARH 4D9QE 3O3DA 4CUCA 1YY9C 4XP9H 2OJZH 3IGAA 2YK1L 4HUXA 1FO0H 4UB0H 5ITFA 4MLSA 8FABB 3OTTA 4GUPA 2O5YL 4H5SB 3WSQL 2C4FT 4DZ8B 1AKJA 2J88L 4YO0B 2GJ6E 4FQJL 4MAYD 4GSDH 4EXPX 4I3RL 5FECA 3S3PA 3WFBH 2X44D 1GGYA 5KSBB 1KTDB 2OI9C 4XZUA 4XP1H 5K9KB 5EA0L 1IMHC 1MSPA 3KYMA 4MQXC 4OZ4B 5AYUH 5HY9B 5E4EB 5HGGS 4WW2C 1Y18B 3S96A 1NFDF 1QVOA 4YNYA 1BVZA 3GSUA 3ARED 2N1KA 2XKSA 3O9WA 5FM8A 2R0WL 3VGHA 4U31A 4XTRD 1MCKA 2GT9A 3O8XC 2FIRT 3KHOA 3AB0C 3DTXB 4LU5L 4ZSOA 3QDMA 2DM3A 3TT3L 1A6WH 2AEPL 5HVFB 2HVJB 3MO1B 3QO1A 4XP5L 2HG5A 1RIVL 2DQFB 1SJHB 2R69L 5IG7B 1WV7T 2HKHH 4MA3A 5BZDA 4HK0A 5CINL 3S35H 1N7ML 1KUMA 1P4IL 4JRYE 2BNRE 1WQVT 2XTJB 1JGUL 1KEGH 3H3PL 4N5EC 2ZUUA 1BFTA 1ULVA 4MNQE 5GISH 1VGEL 1J5OH 5JOFA 5FB8B 1U3JA 3BMVA 4PB9H 4RBPK 3QIUA 5F70A 3TM6A 1X4XA 1GOFA 5IB1B 3OXRA 2JB5L 4OGYH 2I5YL 2E6PA 5BW7C 5HYSG 3F62A 1H9VA 3BP4A 5DJZB 5E9DE 5K59E 4P2RD 5FF6B 1UM4L 1D5IL 2XACC 2AK1L 1SYVB 3ZSTA 2X4UA 1EHLH 1LO4L 2D4DA 3QCUH 1R3LA 3VD5A 4P23C 3WXWH 5KTEH 1BZQK 3F7PC 5BMFL 5FUCE 1YNKH 3VFPB 1AQDA 2QADC 3LN5B 2DKMA 4X83A 5D7JD 1M05A 5GSRB 5EU6A 1IGFL 2X4OA 3N85H 3GDBA 1NBVH 5JW3H 3VFUA 2C3GA 4G3YH 3BIBX 2J12B 4KQ3L 2VDOL 2HH0H 4MQ7A 3HZKB 4OFPA 1MOEA 3LKRA 1Z9LA 3MLRH 4ZUUB 1T1YA 4N0YH 1YQ2A 1QSEB 2FDBP 3NFNB 5DEFB 1S7VA 3MUHL 3V8OA 1FZKA 1UB5A 4LSQL 5IEKB 5ICZB 1X5HA 2JCCA 4XNUL 2Q6WB 4BH8B 3DV6B 2VNCA 2R29L 3G6JB 4GAGL 4LLWA 4P4RA 4XCFL 4R7NB 2P4AB 5LGHL 1TCRB 3GMMB 4PJIE 5I15L 5D7SL 4BSWA 4RGND 4LCYB 1UJ3B 4R4FL 4Z7NF 4OIAA 5C6TH 3UAJD 3WEXA 3ARVA 3DYPA 4WJ5B 4QXWA 2AJXH 4M1DH 1EBPA 3ROLB 1BZ7A 4PJ7B 1MWAH 1NCWL 4X9FA 1LP9E 4HIXL 5BXFB 1CN4A 1MFNA 3ES6B 2NY2C 3EYVA 2CIIA 5DK0B 3FQUA 5EH1A 4ERSH 5CEXB 5C0GB 2AI0L 3OSKA 1CL7H 3FOLB 2XXCB 2D9CA 3BT2L 3VG9C 3BP5B 4I77L 3RWJA 3L5XL 3IJHA 4H26A 2RAMA 1NFDA 4L4VD 4MB4A 4PJFE 4Z7VE 1TITA 3RWDA 4HMCA 3CDCA 1G6RA 4M02A 4NPYB 2GFBB 4ODWB 2H8PA 3RU8L 4LU5H 3MXVH 4POZD 4YBLB 5HI3D 4F58L 1AR1D 3IKKA 1IAOA 4NNXB 2ZCLL 3U0WH 3L3OA 3MUGA 3T2NH 3KPNA 4HLZG 4IDJL 3IFNH 1MCBA 4KJQD 1A6ZB 2FLRT 2VAJA 2P1YA 4Z18A 1CDHA 1A3RL 2L0DA 3KPQB 5BCAA 1M4KA 3H8NA 4G43B 3LKPA 1XR8A 3PGDB 2NNAB 2OXHA 2VDKL 4G6AD 3CD4A 3ALPA 1P4IH 1ZT7A 2Z31B 1MEXL 3EOAB 3ZDYF 4WI6A 4OM0L 3CCHB 2ZUWA 2CQVA 2GUOB 2W9DH 1AGFA 3ESVF 3KLDA 1J1OH 3MNVB 3MODL 5E8EA 3S36X 3JWDH 3IFPA 5ID1B 5CHNB 3WKNA 1KEMH 1NCTA 4G6ML 1IQDB 4JY5H 4PJXE 4RGMB 1BM3H 3SJVB 1JWUA 2VLJA 4HMDA 4MJ6B 4NUJA 4O5LH 3TZVC 3V79C 5HDLA 1FG2B 1QRKA 3MV8A 3MJ9A 3RUGB 2IWGA 5FHAH 4HWUA 3PP4L 2R4RH 4OV5A 4H1LH 3IDXH 2MHAA 5FO9B 3BPLB 3BSZL 4R7DB 3U2SB 4O9HL 3UTPE 3L6FB 4I18A 1LO4H 1R5IA 4PGCA 1NMCB 3H7LA 4DGVL 3I75A 4JREC 5GIRB 1QR1B 1LEKB 1MCDA 1CS6A 3T1WA 1VFMA 5D1XB 3TYGL 2GHWB 1T0PB 3MRGA 1N3NA 2A6JA 2JELH 1P9MC 2H3NB 4KK9C 1U8HB 1Q9OB 5DJCB 5SV4A 2CLZB 3MV01 2XXMB 3RL1B 3H0TA 5J0BA 4PGDA 1XCTA 3X11A 1Q9WB 1X7QB 3IU3B 4KTDL 1J1XH 2AXJA 1IKFL 3BKYL 1WITA 4MQXD 3MRJB 4DJMA 3VU2A 1Z9SA 5F1OB 2J8HA 1WZMA 3PWPA 5D7JB 3CH1A 5DWUL 2BC4A 2ZCKL 2FZ3B 3EHBC 4M1GL 3NPZB 3U7YH 4Q6IA 3MJGX 4XCCL 4LHUD 1TDQA 2N4IA 5DC0A 5CP3H 5DC4B 3HRZB 2B2XL 1I9RH 4C56E 1EA9C 3FFCA 4Q6YA 3TVMA 3ZL4H 3L3DB 5E00B 2R2EA 1NBQA 3GMQA 1BOYA 1QSFE 4X7SH 5FEBA 4HUUB 5TE6H 3EO0A 1KELH 4YBQC 2EIEA 4GXVL 4N5ED 4X80H 3BN9C 3SDAB 2WBWB 3BZDA 1Z6JT 4PRPD 4GG8B 1G6RL 1U8OA 5INCB 4BKLA 4ZAKA 2DL2A 4LPVA 2XT1B 4F9PA 1EH9A 1GOHA 4IDJH 1CDIA 5F7NC 1SVCP 4U1IB 4LSVH 1OHQA 1A6UL 1MRDL 3D3VE 5DS8B 3IB4A 4MCZA 2VLRA 5TQ0H 2D0HA 2BVUA 2NX5A 4OLXH 1MEXH 4HWEL 3LPGA 4IMKA 4L9LB 1S7QA 2Z8RA 2CDGA 4XAKD 4YE4H 3NTCL 4P3WA 1KPVB 4Y5XA 2EDWA 4L3EA 1KGCE 1UENA 3SE4C 4BQCA 1PBYA 3ARGB 1F4WH 1S5HB 3OKYA 1IE5A 2IH1B 1C12B 4U1MA 3X17A 4Q9RL 4P23D 3UTSD 4ZD3L 5ICXA 1YMMD 4HMEA 2P7TA 2DLGA 5ACZB 5SWSE 4DN3H 2E8ZA 1JZ3A 3AGVA 3NIFE 3QCVH 3KWWA 4TVSa 4JZOA 1QO3A 2HT2D 3QP3A 4WNQA 4GXUM 2P8MB 3BOVA 1GHFH 3MJ9L 1TIUA 2BSRB 1DBAL 2YD5A 4ZUWA 4R0LA 3B8SA 3PV6B 4ZMAT 1GPOL 3BZ4A 2VLLA 3P9LA 4JPVH 5ALBL 5E6YA 4K7PH 3BH9B 3KJ4C 2FYYB 4JRXB 1IM9B 3GZKA 5CSZA 4U6TA 1MY5A 3MRHA 3MOBL 5HHQB 2AQ1A 5CWSB 5JQHC 4XCYA 1F45A 2UV3A 4G9FA 1FYTD 3W9DB 1YEFL 5HGBB 4CVWA 1FSKC 3OXSA 2VZVA 2I9TB 4X4YB 1E4XH 3EYSL 4R2GD 1EDQA 1T0MB 3B83A 1JN6A 5HI5C 4NNYB 1T89C 1MIEL 2NY1C 2NW3B 3EYFA 3MXWL 3ZKXB 1SEQL 1I3RA 5C9JA 2EICA 1AQKH 3S35X 2BY0A 1LVEA 2WM0A 5C0JB 5IG7A 3QXVA 2H6PA 4YWGL 3JTTA 1ITCA 4HWBH 3U0PB 2BHZA 3AMLA 4NRZB 2MKLC 3SQOL 1T3FA 3DMMA 3IXAB 4WENB 4AG4L 2J8UA 2E6JA 4PJ9B 1TTFA 4WCYL 4Y8AA 3VRLF 3KYKH 2V7HB 3Q6GH 3ROOB 4Y19B 1KB9K 4F7PB 5MP6H 5HYSA 3RIFK 1A1NB 2XA3A 1OLLA 4ZSOE 3QDME 5IV2B 3CSYA 1VEMA 1Z9OA 4OI9A 3NIDF 2BNUA 2X7LB 4WW2B 2I26N 1DQLL 1KENH 4F9LA 4Q9CA 3VW3L 5T3ZH 2J1KA 4PJDB 2O5XH 4F3FA 4BA8A 1MJ8L 4AL8H 4Y5YC 4TPRH 5D4QA 3V4UH 1TVDA 1SYVA 3V6BR 1IEAB 3O8XB 2KQMA 1QLRA 5IB2B 1CZ8H 1GGBL 4YK4C 3RHWK 3NZHL 1ZEAH 1ZLUH 1UB6B 1K5NA 3BP6B 3QFJD 3DROB 4HWZA 1AD9A 2DD8H 4DN4H 5FUZH 3P9MB 4HHAB 4LF3B 2YPLB 5C0NC 5E6IC 3TZVD 5HD8C 3LH2L 1SVZA 1UQSB 2PUQT 2GSGA 3UYOD 1CYGA 4HXAL 4ORZC 5JHLH 4XNZC 1RULL 4JO4L 3WNMA 5FAAA 4X99B 4U2YA 3T2PA 5EOCL 2VDMH 3BHBA 5EBMA 3HNVH 1A4KB 3P4NB 4PJAA 3SHSA 4PTUA 5DEFA 4RMSA 2IANB 1KYOK 4AEEA 2F15A 1CF8H 5ICZA 2IF7A 2UY7A 1EFXD 3L7EB 4BH8A 1P2CA 1AHWB 2E7MA 5KS9F 1XF3B 4WU7B 2EDJA 4R7NA 3DX9A 4N8PA 5IB4B 1H0DB 5I18L 1TCRA 4LOUC 4KK9D 3M45A 3B9KB 5EU6E 1UJ3A 4NIKB 12E8H 5ESQA 1ACYH 4QKXB 4FFYL 2YN3A 5D8JH 3PV7A 1KJ3L 5EULV 2BOBA 2Z92B 2FX8L 3JWNC 4HW6A 2Q86B 3GSNA 2F53A 5BXFA 5C86A 2OL3A 5E8NB 1MRFL 3NIGE 2WK2A 2JCCE 3O3BA 4BFIA 5KVDL 2QADB 4KUCF 4U1GC 2EZ0C 2DQUH 1F13A 4M6NH 3X14A 3BE1H 3VFRA 4JDTL 4OLVL 2QSVA 3EHBD 1IAIM 4UIMB 5DK2B 2ZSVB 5C0CD 1JRHL 2GFBA 2LV4A 3KYNA 3X13A 1MIEH 3RY6C 1NLDL 1KCUL 1SEQH 1BAFL 3MRMB 2DMBA 2WUCH 2OTPA 1U41A 5FGCB 3BZEB 2I60L 3WN5A 4HS8L 4CU8A 4E5XB 3VWJC 2X4PA 5DJYA 4UT6L 2VIRA 4DFIA 5JDSB 4PRIA 4G43A 1UGNA 1FYTB 4PREA 4TUKL 5T3ZE 5E24E 5BRZD 4K7PY 4HGWB 2IPKA 2WQ8A 4N8VB 1AY1H 5HHXL 1JGLL 3QB7C 1NFDE 4YBQD 3BN9D 4WCYH 2GUOA 2ADIA 1Q0XH 1BFVH 5I9QB 4XP4L 3GM8A 1TNMA 3D0LB 2AJYL 4O2CA 3RZWA 3A6BL 4N8VG 5I75B 4R90H 1JWSA 1NEZA 4NZDA 1OB1A 5GGRY 2NY2B 5GRUH 4WGVB 5C9KA 1U8QB 5H2BB 1HOCA 3HAEH 1BREA 4YHKH 3VDBA 1BLNA 1CICB 3VW3H 2FB4H 3F12B 4LLMB 4N90D 4J3XA 1AJ7L 1R3HB 1FVDB 3I2CH 2QSCH 2JKXA 2P8LB 3ILPB 4MNGE 3LKQB 1U92A 3VXMB 5LJYH 2YHGA 2I07B 4WFGD 3U2SA 4P2OA 4PRBA 1VKXA 1YC8A 5D5MF 4S2SB 3H2WA 4HEPG 4ZDHA 1MFEL 3GRWA 4JAMA 2RFXA 2R56H 1X4ZA 5TH2A 5MENB 3WCYA 3JWDC 3H7BA 3X12B 3K74B 2DQJL 3RVXC 1A3LH 2VLJE 2ITDB 5IHUL 5F7DA 1G0XA 1IGYB 1BEYL 5T1DL 2BP3A 4JO4H 3P77A 4GH7B 3MV8E 1IILE 1TQBC 3CX5K 1R5WB 1T03L 2WBKA 5I1LA 4W4OC 3V7AE 2NZIA 4DGYL 4E9LA 1FL6B 2P43B 5D7LD 1JI1A 5IBUB 5GRZA 2R8SH 5HDQL 4Y0GA 3QFJB 1OM3L 2H9GB 5BS0D 4UTAH 2OMNA 2EKJA 4NNPH 3CMOL 4HUMB 4S1QH 3FFDA 5BJTB 3DWTA 5KS9A 4Z0BH 5IBUG 1C08B 5IFJA 1A9EB 4J3WA 3LQAL 4KWUA 4CJ0A 3ULVF 4NFDA 5FO8B 5D70H 5FV2A 3TH3T 3OG4B 4APQD 1LEGB 1X5LA 3WFCL 1YA5A 1YY8B 5HI5D 4FFZH 5IHZB 4LRNL 2NY1D 4P9MH 2X05A 1S9VA 2DYPA 1A7NH 1KLUB 5K9OB 2OM5A 5EO1A 4JREB 5EIIB 4NT6B 1G1CA 2VXUL 2CKBB 4HDIB 4PJBF 4KDTA 2CO7B 3OKDA 4MDJB 5A2IH 3MRCB 1E4WH 3BAEL 5AWNL 5L6YL 4ZO6A 4PB0H 4TTGA 2E7BA 4JPIA 1U8NB 3LS4H 2KPNA 2W1NA 3PWPE 1F3DJ 3C2SA 3FTGA 2DKUA 1MAML 4P0DA 4UUJB 3DVNB 3UTTD 4DCQB 4OZHF 3F8UB 4Z7NE 3G5XA 5EZIH 4ONOA 4YH6A 2XZZA 2LU7A 4IIQB 5CJXC 4U7KA 3AS2A 3TBVA 1KCLA 1LEIB 3FFCE 5GJSH 5HDOA 5J56B 2BVQA 5CKAA 5A40E 4PRDA 3PHQB 1FNAA 4P46C 1CD1A 5DI8A 4DVRH 5C3LD 5AG9A 1TNNA 3NVQA 2XYCA 4JM2F 1MFBL 4ODUB 3DVGB 1E4XI 1VACA 4C55A 4YPGB 1IGIL 1I3GH 2I25N 3E6HB 4OI8A 5FOBA 4GT7A 4QRPA 4X9IA 3BH8B 4J8RB 4X4XB 5ACZA 2V9RA 1G7LB 2ZZUT 1FNEB 3X3FL 5K9QI 1RZ7L 5C0ND 5T1LA 3AUVA 4GKZA 5E6ID 4L1DA 5HD8D 4EN3A 5CEZL 5J7CC 1U8IB 4OF7A 3UBXI 4PJCA 5D71H 2VLRE 1LHZA 1GYAA 4YDLC 2NX5E 3OQ3B 1A6TB 1S7UB 1WF5A 1Q94B 3ZDYE 4LCWB 4L3EE 5IW1A 4GJTB 1S7RA 1I8IA 4NO5A 3AAZB 1S7TA 1INQA 1UKSA 1B0GB 2DI8A 4HJJL 4OT1H 3GRWL 5IP4A 3FO1A 3OKOA 5I73C 1XFPA 3STLB 3D39D 1YEIH 2F9BT 3BKJH 1C5DB 1RIUH 1RURL 5I71B 3HE7A 1NUNB 2NLJB 2HWZL 5JQ6H 3MROA 5DMIH 1ND0A 2HAZA 4LOUD 3U30B 4E42A 2PNDA 1FFRA 2ZCHH 1FN4B 3L7FA 4U6XA 1DVFC 1XH3B 2DLFH 4RMTA 2GKIA 3CU7A 3TESA 3OZ9H 1G9MC 2Y6SD 3SDDA 4NQDB 3CVHB 4HV8A 2YD4A 5E2UH 2PCPA 4GRWE 1KNOA 4OD2A 1JUFB 4LLUB 1CI5A 3LMJL 3U0PA 3MGOA 3QEHA 4U4BA 1G7PA 4N0FA 4Y4HC 4F8TA 2EZ0D 4E0RA 1NMAL 4G9FE 4J7RA 3RKDD 1MCSA 4J3TA 3LQAH 1EJ6A 3DARA 3V4VL 3ARBC 4OTXL 4IRJC 5GS2D 3DXAD 5IR1B 4R4NC 1B90A 1S9XB 4F7PA 3BP7B 1U8KA 3WFCH 3OAUL 3O6LL 4M00A 3PWNA 3CFBB 3TCXA 1J12A 4MA7H 2QR0B 3D85D 1HI6A 1MCPH 3VWJD 4FTVA 3GSNH 5EU3B 2AGJL 5C0EA 2OL3H 2HFEB 1MI5A 3IDJA 3F7VB 1HH9A 1ORQB 1UVQA 2F5AL 2Y07L 1FSKB 4PJBA 3CXHJ 1KCRL 2LAGB 1TTGA 4K3DH 1H3PH 2J8UE 1R3IL 2PO6A 5GJTL 1KIQB 1X5KA 1DL7L 2DDQL 3HI5H 3I6GA 4XNXH 5J9PB 5IB2A 3T2QA 1NKRA 4P5TC 2P5WD 2NY1B 4JFFD 5DYOB 3RWGB 4XXDA 3Q2CA 1A5FH 1FFOA 2H41A 2Y72A 4NWUL 4F15C 2R0KH 2ADJB 3DROA 2RIKA 4LNRA 4G6JL 4QCIB 5ALCL 4OZHA 5IWLA 4G42B 3RJQB 1QFOA 4NQVB 1DBBH 3LSOB 5F96L 5BZWA 3TBYB 2M26A 4GG6F 3VRJA 1LK2B 3G6AB 4HIEB 2B39A 4JFZL 5DD3L 5HYJD 1KCVH 4Y88A 3GJFB 2DQTH 4KKBD 2NXZC 3QFDB 3RDTB 3L5WA 3HE6C 1FL3A 4PRHE 4L8CA 1WBZB 1A4KA 1GZPB 3VXSB 5EDXA 1KC5L 1TVBB 1ZSDB 3RWEB 4XPFL 1DDHB 3EFDH 4JM2A 4YHOL 3UTTB 1R5VA 1A1OB 3NACL 4Z77A 2NY4C 1G0YR 1UXSA 5GHWL 3TLRA 1CLZL 1S9WB 2A73B 2DBLL 1XF3A 3RVXD 3VGAC 4WWKB 2IQ9L 4JB9L 2XRAL 5IW3A 3PL6A 4XNQA 4J1UA 3B9KA 4Y5YB 1HSBB 4OCSL 4M93C 1JGEB 3S37L 35C8L 5DHVH 1DFBL 4NYLB 4YK4B 4OI7A 4D0BA 4H0HB 4K3JH 5JXEA 2XQBH 4M7LL 3NPSC 3QUXA 4PJAE 4XMPH 2ED9A 1MJ7H 4QRSB 5I76A 4EQ2A 3K2UL 2RGSA 3THMH 4R8WH 3H6JA 3AU1B 4RA3A 2W91A 2ICCA 2MNUA 1XGRB 3C9NB 4XNZB 5D6CB 3HUJB 4X5WB 3VWKC 1T2JA 2IGFL 4K7FA 2ZSVA 5DMYA 3MRQB 1IAMA 4O00A 4XPGH 1U93A 2CDEB 2JJVA 5TDOA 3ARYA 1ERNA 3OKKB 1KF9B 5HPOA 4G8FB 3RL2A 3VRIA 2F53E 4YXKH 4OJFH 3D39B 3KPRA 4PLOB 3GBMH 1RZJL 2VUOA 1VADB 3BEWB 3RPKA 3WE6B 3MREB 4YZFE 1BJ1H 4TQEL 3TBSB 3S34L 3K80A 3O4LD 1ZHNB 1JPST 4L8BA 1HYSD 2JIXA 1C5CL 3E2HB 1V7NL 1JFQL 4YHLH 4LLQB 1AGEA 3BIAX 3CVIL 3OB0K 3C60C 2HFTA 3SBWC 1NCNA 4FABL 5ISZA 1X6NA 5DD1L 3GEWB 2JB6A 5LBSH 5L2KA 5B39A 5HI4C 4JPWH 4G8GA 5FFLA 3PDDA 2VH5H 4FP8L 4PRIE 3IKCB 2BRRL 3DYOA 2YSSB 4JO1L 1UYWL 4N1EA 3RA7L 1T6VN 1FZJB 2FECL 4MJIE 4XVJL 4HKJA 5E8OA 3QRGH 2AEWA 4Q2ZB 4QYOB 4WI3A 3VJ6A 1HKLL 1NDGB 5DJ8B 2PTVA 3MV9D 2VXQL 2GYSA 4MJ5A 1MCWM 3WDIA 4NO2B 3VRLE 5MENA 1XZ0A 3C6LA 5D1ZC 3VWJB 3MCKA 4JFOA 4KJWC 5HYQA 1HSAB 3OHXB 4GW5B 3K2MC 5JA9A 4YUEL 4PJHA 5BOPA 1RZFL 5CEZE 4QRRD 1UXWB 3QAZB 1TJIL 3P30L 4XWOC 4MX7B 3DJ9A 5DJ0B 1MELA 5GGQH 3CK0H 2JK5A 5BOZG 1XGUB 2A77L 5TDNB 1TMCB 1AR2A 3JSSA 4NP4H 3C5SB 3CH8A 4G8IA 1CFQA 3HMWL 4QF1A 4S0TD 3U36B 5EIQA 3HCVA 3SE3C 1KIPB 3JV4B 5JMRA 2DJ4A 3ZKSD 5DRNB 1KPUB 1TETH 4LSSH 4OFDA 2SEBA 1QP1A 4NDMA 2X1PA 4M48L 4AM0B 3GMLA 4KRMB 3SO3C 2FL5A 2R0ZL 1F3JA 2DM4A 2XRAH 2F19H 3QDAA 1P7HL 1WGOA 4Y2OA 3MRLB 2BFVH 5DD6B 4ZFZB 3L3GB 3REWB 5E8DL 1NCBL 4K71C 4LPYA 4K23L 2E27L 2C5DC 1OGAB 3MV11 3LEYL 2IAMB 3BIKB 2BY2A 5KVEL 1S7SB 4RWYL 3BD3A 5HJ3B 4FQLL 3WDJA 2CMRH 3LB6D 4YDVB 4KQ4H 3L1OH 1CVSC 3K2UH 2Q7YA 4ZS7L 1WZ1H 4NZRL 2YXMA 5D7IF 3DUUB 3BMWA 4CW1B 3DIFA 3WJJC 1T5WA 2F58H 3IJYB 5DJXA 5KS9E 3ARBD 5BVPH 3BPNB 1A7PH 2QKIB 4IRJD 4PY8J 3GK8L 1MIMH 1TQBB 2W0FB 4R4ND 1DBMH 1CXHA 4YR6A 2XZAL 3EDDA 3TEUA 3LV3A 1I7TB 1MCCA 1GSMA 5C0DA 4ZXBA 5IT2H 1BGXL 1QFUL 3S6CA 4ONHB 2P24A 1RZKH 2WWMC 1LEIA 5J89A 7CGTA 3G5VA 4WDIA 3RZCB 1D9KC 2VN7A 4ZUTB 4TOYL 2FWOB 5T1KD 4LCIL 2V2TA 4HJGA 3F65A 4NHUB 5HPMB 4BZ2H 3MCLL 5DUPL 5IHBA 3DVGA 4P5TD 3W0WB 5A2LH 3ARFC 1W2KT 1YNLL 3ULVH 4JRWA 2DWDA 5ADPL 4FABH 3ESUF 1W0WB 1KJVA 3ULSA 4MS8D 3DUSA 3DX6A 4TNWK 4TNVK 4YDIH 3H42H 3L5IA 3SE9L 2COQA 3I6KA 4O2EB 2VC2L 3ARXA 3CDGB 2RHEA 1AIFB 1WCBB 1FQ9C 4S1DC 3V8CA 2XZCL 3K8LA 4K8RL 1UYWH 3RA7H 5T33H 1TJGH 2NXZD 2YD7A 4XVJH 5A2JH 3MJ8A 3HE6D 3LS5L 5DMKA 5EUOB 1U8LA 3MMEB 4P5KA 5F3HB 3FB6B 4LVHC 2BVOA 2XA8L 5D2NB 1IM3A 4K9EL 2WBJC 3FQNB 3IDGA 1AO7D 1B0GA 1A22B 1A4JA 2R4SL 2NY4D 3K4DA 1EHXA 4QRPE 1P6AB 3LAFA 5D7KE 1A7RL 4K07A 1KLFA 2FRGP 2WIIB 1JHTA 2NLJA 2DBJA 5A2FA 2UWEB 2AXGA 3IU4L 4JFXB 4MAUL 1FNGA 4P46B 3VXRA 3ZZ1A 4NQCA 2HMIC 4JKPL 5ESAA 3FN3A 4PJCE 5HHME 4EDWL 5I2IA 1FN4A 4F7CA 1FHGA 4X6FA 4XXCC 3MBEA 1TLKA 3SCMA 4O4YH 1UZ8A 4OD3H 3ZE0F 4U6YA 5JPNB 2M1KA 4Z8FL 4IRSD 3O2DH 5F7YC 4PG2C 3FQRB 3LOWA 5JDJA 2H1PL 4FZ8H 2HFGH 2WINB 5D5ME 3O3AB 4Y2DD 1MPAL 4DVBB 4QRRB 4YQXH 1XF4B 2HRLA 4RFOL 3UPCA 1AGDA 3K4ZA 2R2BA 3VWKD 1PG7H 5ILTL 2V6HA 2VE6A 2BSED 4JN2B 4LHJB 5KSVA 3BP7A 1FV1A 1JNLH 1HQRB 4MJ4A 1J8HA 4NZTL 4PJEF 4JQIH 4FQ1L 1ZA3B 4ZOCA 1SMAA 1J9CT 1J0IA 4LSUL 4RFNC 1CFSB 1NQBA 5CJQH 1PYWA 1CXIA 3T0EA 5DQJA 5EFIB 3FZUC 1ORQA 1I8MA 4XPTL 4UBDC 5EIVA 3QNYB 4GW4A 1QFHA 3TYFB 5D7IA 5MEQB 5DSCB 1OCWL 1P7QB 4I13B 1KYOJ 4IHOB 4NKIH 1L7IH 1DVFB 2AJVL 3NGBB 4MXVE 3ULVE 1KULA 3WD5L 1QYGL 3RVVC 43CAB 1MUJB 3T2OA 2CLVB 3QUYD 5JOPE 3F5WA 5HI4D 4HFWB 2VSCA 1JPSH 1H5BA 2N56A 5CGYC 4ZPVA 3NCJL 4FTVE 4QXGL 4V1DB 5E99L 4F7MB 1HEZB 4WTWA 4OLUL 4Y4HB 1IBGL 1MI5E 5IFAH 4JJ5A 3JWOL 2G9HA 4PJBE 4P2QB 3RDTA 4FA8A 3RGVC 1MFAH 2JE8A 4F33A 3VXSA 3VDCA 4LKXA 2NTFB 1SYSB 4QTIH 3WL9A 1EAPA 1CTNA 5MEPB 4ETQB 3D87B 1JPFB 4JFDA 3EJYD 4OZIB 1BP3B 3GSWB 5D1ZD 1OPGH 4KJWD 4U7SA 4Y4KB 1B6DA 1S9WA 4OZHE 3NFPA 2JLLA 1INEL 3PIQB 4XCNB 3QPQC 5J1AA 4NKOB 5AZEH 4XWOD 5DZNA 3QDGD 4KHTL 3RWIA 1GRWA 4ELKA 3TPUB 3EOTL 2NZ9D 1Y0LB 4QNPE 5FA4B 1N5YH 5E56A 3C5JB 3PWJB 2FJHB 1CU4L 4P5TB 3KYOA 4DKFH 1EO7A 1LO0H 4LEOB 4OGXL 1NAMA 1GVIA 4GRLA 4KVCH 4FQ2H 3DUHA 2ED7A 4IRZH 1QLFB 3BQUB 1QQDB 4YGVA 2FD6L 1GJIA 5EB9A 4HG4J 1OARL 3Q5OA 3QUZD 5JW5A 1VDGA 3QI9C 4YHPB 1R3JB 4X5WA 3NA9L 1LWRA 1QBMH 2P48B 1PSKL 1KIUA 4DAGL 4DKAA 1UACH 4WW1A 5KW9H 3QSKB 1XGYH 1FFPB 4YAQA 3IJSA 5I30L 5IMLB 4L29B 2E7HA 7FABH 3QUMA 5CS7A 2DQGL 4HKZB 2X5PA 3KXFB 1ONQA 2MQ3A 2VXVH 5C6WH 3BO8B 3CVHL 5DR5L 2MFNA 1RUMH 4F2MB 2NY4B 2Q76B 1AXTH 5CP7A 3VGAB 5CCKH 4KU1A 3QIBB 3RVTD 3V0WL 2MPAL 2PXYC 5JR1L 3NCYP 2B0SH 3B43A 4M93B 4QOKB 4NM4H 2VR5A 1B9ZA 4K3HA 4Z7WB 3QWRD 4R97C 5DDHB 3I02B 2AJUL 2X1XR 3PWVB 3NPSB 1IAIL 3OKMA 4PJEA 3BUTA 4FMKA 1T21A 5LWYH 5ADOH 4NC1E 4JM4L 2WWMD 3MZTA 3TA3D 1PKOA 1QRND 1JNJA 2YA2A 5IHLB 4TSCH 5C07B 1YNTB 3KPRE