4EVNB

Crystal structure of fab cr6261 (somatic heavy chain with germline-reverted light chain)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
213
structure length
213
Chain Sequence
VLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSAYVVFGGGTKLTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Heavy Chain
publication title Structural and genetic basis for development of broadly neutralizing influenza antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 213
sequence length 213
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 2012-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4evnB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4evnB01
1CFVL 1MRDH 3TJHC 1A7QH 5KS9F 4JM2A 3ULUC 2KL6A 3ZKXC 1NANI 1NCCL 1FSKB 1YZZA 3B9KA 2NYYD 1F3JA 1YEDA 4FQPA 3HAEG 2Y4SA 3SDAD 4Y4FC 1D9KC 4Y19A 1J0IA 4GRMB 4RFEA 2QTEA 2Y5TB 3BDYH 4CUCA 2ZNWA 3MLWL 4GS7B 5A1AA 3DO3A 2G2RB 3FN0H 2F54E 4WHYH 4Q74A 3QQNA 2ZUWA 2AXGB 1IE5A 3GJEB 1BOGB 2CRYA 3QHTC 5DZNA 2OZ4A 1M7DA 3N9GH 4UILL 3RU8L 4Y1AE 2PW2A 1JHTB 3QCUL 1CLYH 5HHXL 5C2BH 5CWSB 3MYJA 4U33A 2ZCKH 1B6UA 3QPQC 4XHJC 4D0CA 3P77A 3QHZH 5BJTA 3K8LA 3JWDC 1A7PH 3P4MA 1ZT1A 3LQZB 2DAVA 2EIDA 5DJAB 2YBRB 3P11L 1MQKH 4LARH 5F3HA 4ISVB 4I1NB 3VG9B 4PGCA 4Z7OF 5DD5H 4KKBC 1NBZB 3BPNC 4JDVB 5BO1L 2GUOB 1PG7L 4LF3A 4NRYA 4R2GC 3BP5A 4YHYC 4PJHB 1KTRL 4PBXA 4MWFA 5JNYB 5ITBH 3NIDF 4LBEA 3CZFB 4FFYH 2H1PL 4X4ZA 3LKRB 3ROLA 5F9AC 1JZ3A 3H3PL 3TCXA 1UWGH 3HB3D 1HEZA 4Z8FL 2H8PA 4L3CA 3JV0A 3GSVA 2QQQA 1CTNA 5HI4D 1P9MA 3MRRB 4X6EB 4GAFB 4NC2B 3O4LB 4DGYH 2A73A 1MCNA 1KCUH 2UZXB 3T1FB 3D0VA 4OFPA 4G8FB 4PRHD 3PQYD 2DQEH 3D5OF 1U8NB 2NY6C 3MREB 3RJQB 4LSRH 3IDJA 5J1AB 3MRNA 4H26A 3LS4L 4K8RL 5MEQB 2UYLB 4HS6B 3VXUD 4JFQA 3EO9H 1MCKA 2BZDA 3BIKB 4GKNB 4NNXA 5A3IC 2NTFB 2D4FA 1C12B 4AENA 1KJ2H 4XHQA 3QFJE 4YE4H 4OD2A 4P0DA 5HYSA 1AR2A 1S9YB 4GRLC 4LSPL 4XVJL 4LCIL 4YZFF 1LO3H 3GSOB 4MJ2A 3TCLB 3AFLA 2PYEE 4IHOB 3GMPA 4XC3L 3SQBA 3IS0X 2PXYA 2EE9A 5EIIB 2B4CC 5CGYD 2J8UA 3EJYD 4R4BB 5FYLD 2OXGA 5E8EA 4KMTH 4LHUD 3FB6A 3RL2B 3WLBA 5SWSB 1KN2L 5DI8A 3HLAA 3G08B 4G6FD 4R4FH 1XGQB 5IT2L 3PGDB 1J88A 4OZHB 4XHJD 3VFSB 1S8DA 2J2ZA 4ZFZA 3QDMA 3O3DA 3U36B 3CUPB 1NLDL 4OZIA 4OCWH 1MCWM 5B4MD 3RZCC 1WT5A 3S7GA 4GAJL 3QULB 2WZPD 4XBPB 3ZDXF 3WKNA 1JV5A 3PWVB 1U58B 3GHEH 4U7KA 2X4QA 3TEUA 1XGUA 3IDGB 5GGVL 4MAYA 1J1OL 5L9DL 1FSKC 1YNKH 1PYWB 2GT9B 5D9SB 4HIXL 4PG2C 3E8UL 5GGRA 2ED9A 3VH8B 1X5ZA 2LU4A 1YECL 3QUML 3PABB 1A6UL 1A6ZB 2IADA 4L8CA 4HK3N 1S7WA 1HIMH 3B9VA 1PLGL 4YPGA 4MA3A 4GS7C 4G6JH 4KZEH 1DN0A 2VLLA 4GSDL 3AS2A 3RKDD 5LCVL 3TNMA 4YHOH 1V3KA 4RISH 3V4UH 4P48A 2UWEB 1RULH 2EE2A 2ICWJ 2JJSA 2QQNH 3K7UA 5JORA 4Y4KD 3DSFH 4QWWC 5FV1L 5FDWB 3KPSE 5DMIH 1RI8A 3I75B 1QOKA 3RWFA 3BX7C 3D9AH 5F1NB 2V2XB 5HYEA 5IW6A 3HRZB 1LD9B 5JXED 2YSSA 4KTYA 5DEFB 3C9NA 4UV7H 3VXTA 2B2XH 2E7LC 2J6EA 4GRLD 1CGXA 1Z9OA 1T6WA 4YHPA 4FXKA 4P9HH 1DQMH 2FEEL 3VMPA 4X6FB 3FQXA 3MFFB 3EDFA 4HUUB 3ALXA 3RWGB 4JFEA 1A9BA 2XTJE 3VI4F 3DTXA 3T0ED 1WIOA 1LDPL 4X6DE 1GC1L 2DWEB 3QA3A 4KDTA 5H35B 5E8DH 4ELME 3JZ7A 4DZ8B 3KR3H 1KNOA 1KPUA 1MPAL 4P49A 3O2VH 1NGZA 4DTGH 1LEIA 3CSYA 1A0QH 5DJ0A 2XOTA 1CE6B 2ZUUA 2ZPKH 1RK0A 4ZSOE 3UPRA 4GBXA 5FO9B 2IQ9L 2HVKA 4U6YA 5D2NB 4YUEH 5IF0B 5AZEH 3WIHA 3BXNA 4M5YH 5E08H 4MXWH 5FYKL 3IAPA 1U8MB 3REVB 3OAZH 5DA4A 5EC2B 5A2LH 3QG7H 3L5JA 4Y5YB 2EXWD 4P2QE 1KCSL 4YDKL 4U1MA 1ZVSA 1RMFL 4HIEA 4BFIB 1JF6A 1YEEL 2HVJB 4YC2B 5ACLA 1MAJA 3CU1A 4XVTH 4JEGB 1T4KA 2XNAB 3QEQB 5GHWL 1B0RA 5HHME 4KVCL 1JZ2A 4LSVL 4QTHA 4D0BB 3BO8A 4C58B 4LCWE 1A64A 4YDLB 4EDXA 4QCIB 4JO4H 3C5JB 3P0VH 4E42B 4X6CB 4P9MH 1II4E 4HMCA 4ODSL 3JV6B 3MRLA 3V6OE 3LRSA 3SE4C 5BRZA 1HNFA 5T1MA 3OAUL 5L7XH 3SN6N 3QQ4A 1WK0A 4OCRL 3OKNB 2SEBA 5F44A 5J1TC 4Z77A 2VB5A 4NBXB 5DSCA 3UBXB 3W0WB 4XBEL 5MI0B 3U7WH 1XR9A 3HE7A 1MFDL 2CRZA 1NUDA 2R0KL 3TFKD 2B20A 2C3VB 1QQDA 1U92B 3KS0J 3LY6A 1YYLL 3GNMH 1QA9B 1QBAA 1SJEB 4NO0D 5TFSH 5IBLC 5GGTH 3GKWL 1N5AA 1ZLVK 4H88H 5C0IB 3I6LD 2VO5A 4MNQD 3O0RL 3BI9X 3KLAA 4PJ5A 3S34L 4Y5VA 3RI5F 4KTDH 5EORH 1MEXL 3LN4A 1Q9KB 3ARVA 2E9IA 4M5ZH 3BYYA 3MR9B 3ZYIA 4HH9A 1OAUL 1A1MB 1CL7L 1KCKA 1FQ9C 1GYAA 4OCYL 4XPFH 3A67L 1CICD 2F5BH 5GRXG 1DDHA 4EXKA 3CDCA 2Z9TA 1JNJA 5E8PA 2OJZH 4FZ8H 1CF8L 4GLRI 5CP7A 3FO0H 3TPUB 4MSWA 3VH8G 5JR1H 4NBZB 4NKOB 1CDYA 2XTLA 4XTRC 3ZDYE 4OV6F 2AV1B 5GSVB 3RNQB 1I8LA 3C6SB 4PJHE 4Z78A 4NJ9H 1OSZA 2ICWI 3KG5A 4L4VE 1TNNA 2WUBH 4TQEL 1UM5L 4FQLH 4AH2B 2R2BA 5F7UA 3G6JB 3MACL 5CJXA 5F6IB 1IFHH 4QRPA 2UY6A 1NGXB 4PJ8D 4NC1C 4ERSL 3D0LA 1N4XH 4EXPX 3HNSH 3I9GH 2E8ZA 4HIIB 3WFEL 2BJML 3X17A 1PFCA 4MS8D 3INUH 3WHXA 2P5WE 4PBVC 2FO1A 1F4XH 3EHBC 4X80H 2PTTB 3GM0A 2E7HA 2GFBB 1XGRB 1T5WB 3WJJA 2D0FA 1XF2A 4X9HA 3EYQC 1CGVA 3D39E 4LKCB 3MRJB 1AD0B 1F6AA 1G7PB 1YEGH 1ZA3B 3TBTA 2ADGB 2WLZA 4RZCB 3GGWA 2VZVA 1AXSA 2NY2D 5FUOH 3PWJB 1PSKH 3G5ZB 4ZPTB 3IDYB 1VEPA 1T89A 2J8OA 1JN6B 2AJ3B 4ZFFB 1FO0L 3BGMB 1IKNA 4WFED 3QIUD 1MIEL 2MWCA 1VGEH 1WBXA 2APBA 1ZTXH 3DXAE 2JJUA 3M17A 3KPMB 2DDQL 4GRWH 4PB0H 3WV0A 5KS9B 2N7AA 1A7QL 5KTEH 4P5TD 35C8H 3IDMB 3BMVA 5DRWA 3VWJA 4XPTL 4D9QE 4X99A 4ZS6C 4NQCA 3H3BC 2H32A 1YYMH 1TDQA 4WTWA 4URTB 4ODXA 4NGHH 5D2NC 3DI2B 3HFML 3VI3E 2IFFH 3FHQA 5DUBA 3SOBL 3BZFB 2H2PC 3BDYL 1MUJA 5D1XB 4LEOB 4B0MM 2X10A 4M1CD 3FN0L 4WW2A 3AREB 4KI5C 3EO1B 3C6LA 3DMMC 4P2RA 4Y5YC 4N1CA 1BWMA 2FIRT 1HHHA 3DRTB 4XPGH 3SJVB 4ODUA 1OGAB 2QKIA 1ZMYA 1CT8B 5AG8A 5HY9A 2OJEA 1OAKL 3FFDA 4YC2C 2O93L 3NCEB 1QKZL 3AMLA 4Z95L 1C16A 5TQ0H 1CLYL 5C2BL 2NLJB 4IOFC 3QNYB 1YUHA 1YPZE 1QFWH 4LCUA 4WI3A 5I1EH 4RCAA 4HGWB 3EYVB 1EZVX 2Y9RT 4M8QB 4MCZB 2OSLA 4F37K 5JW3H 3NZ8A 1C08A 3VFPA 4YDLC 5IVNA 4OTXL 2GJZA 2WUCH 4XP5H 1KC5L 5IBTH 1HSAB 4M1DL 4OT1L 1R3KA 2LTQB 3ZE2F 1G0DA 3UBXG 1E4XH 5BS0B 2EYSA 1UACH 3HG1D 3WIIH 4OF8A 4AIZA 4O5LL 2FEDD 2W0KA 5MI0C 5D1QC 3WNLA 1ZS8A 2P24A 2X4PB 4N0CD 2IH3A 3SQOH 4RNRA 5I6XB 1TCRA 4L29A 4X4ME 1MI5D 4WI7A 5GGSB 4ZUUA 4S1SL 2FECI 5E6IB 2BNRE 4HUVB 3QSKB 4KGJA 5E4EB 1NGYA 5SWQB 4NO5B 1MY5A 2UWEE 3AM8C 4QXGL 5DJ6A 2YKLH 2ESVE 3RWIA 2F8XC 4XMKH 5FKAA 4BUGA 4GXUM 3VRLE 3GMRB 3GI8H 3F58H 4P4RA 2BOCA 1FZOA 1KCUL 5C86A 1OB1A 1Y6MR 4LSRL 2CXGA 1ZGLM 5IVXB 3S36H 1KBGL 3QWQB 4Y4HB 5IWLA 4PJXA 1FZMB 4O2EA 1KIQB 3U9UA 3MOAL 3AUVA 4HKJB 3CPLA 4XAWH 2F5AH 5C0JA 1KIRA 5I76B 3L5IA 5KOMC 5SV4A 1ZT4A 3ARGA 2F74A 1LO3L 2H3NA 5F6IC 3ARXA 4QHLB 4LRIA 1JGDB 1FGVH 2CPCA 5TF1L 3UJTH 1A22B 2XACC 5F7LB 2OZ4L 2X7LB 5J89A 4X7SH 1D5XB 4XNYH 1DE4A 4KI5D 1BZ9B 4Z5RB 3DMMD 5IOPB 4BSWA 5MP6H 4ENED 1QBLH 5ADPH 2QBWA 2JCCF 3D85D 2X4UA 5IJVB 4X7TA 5C07E 3WN5B 1I3RA 4EDWL 4R4FL 4EN3B 3OKEB 4WEUD 4TUOA 3SDAA 4F15B 1NC2D 3C5ZB 3L5XH 2EICA 1FL3A 2QSTA 1OGTA 3OXRB 3PL6A 2EDHA 2DQUH 3WS6C 3MA9H 1D5MA 2IGFL 1K8IB 2EEAA 4WI5A 3IDYC 1X7QB 3DIFA 2RGSA 3QNXB 2FX7H 2PTUA 4QHMB 2W65A 1BF2A 2X9WA 3U0TA 3L7FB 4RMVA 5J6GA 5CCKH 1OW0A 1LP9B 4OZGA 2HA1A 5K93A 4Y89A 4OGAC 1RIUH 4WFFD 2YZ8A 1U8OB 1R3IL 5TE7H 1MCIA 3ETBF 3PWUB 4XT1C 5D1QD 4HLJA 4MMXC 1Z9MA 1VEMA 2NW2B 3RUGE 1LE9B 4X4XB 4JFXA 3UC0L 4ZG1A 4M4PA 4HX1B 5FCUH 5BQ7B 2B7DT 1IC4L 1ITCA 4JRYE 3GHBH 3S96B 1V3JA 4QOKD 1QUNA 5DQJB 4N68A 2DF3A 4CW1B 4G6KH 1T2JA 4NQEA 4TOYL 5ALBL 3W0WE 5LXGH 5HVHB 4K23H 1IC5L 5D1XC 1I1YB 4JG1H 5CLWA 2FX9L 4F9PC 5HHQA 1MCPL 4K7PX 5AZ2H 2YEZA 4A2LA 4GG8B 1A5FL 4LIQE 4RISL 3V4UL 1JNNH 4TVPD 4GW1A 3GSQB 4DJMA 3K4ZA 3EOYG 3LSOB 1GRWA 1HHGB 5SX5H 3DUUB 4PLJD 3CFCH 4O00A 1KT2A 2G5BA 5FEBA 2FH6A 3D9AL 3DV6A 5I66A 4JN2A 4G6AD 3C2SA 4MDIB 2GJ6B 5HVWA 3K81A 1YMMD 4ODWA 3DX8B 3P4OA 4OI8A 1I8KA 1XGYH 4L5FH 4PRHA 3PQYA 2LTQC 4O58H 3EOAB 2EDXA 1KJMA 2WLYA 4UQ2A 5EUOF 1N0LA 4LSTH 5I6XC 3TBSA 1AIFA 1D6VL 1OTTC 3VXUA 1I85C 1KENH 3WIFA 3BH9B 1ERNA 2BXYA 5E4EC 4LLQA 1XGTA 5C09B 4NJAL 3FB8A 4QNPF 3VFUB 3IF1A 4OGXH 1DUYB 3HNTL 2A9NH 3B2UC 4Y4FA 3HAEA 5FO8B 3PGFL 2ZPKL 2Y23A 5I8OH 1J87A 4FQXC 5ICZB 4K3JH 1NDGA 3G6AA 4YUEL 5AZEL 3KXFE 2I5YH 2YPLB 3IGAA 4I77H 4M5YL 4MXWL 2OR9L 3RVWD 1U93B 1HHJB 1NCAL 4ZQKB 4TPRL 3GIZL 4GXUN 1DEDA 4IMKA 3CFKB 4WO4C 5C6TL 3S37X 4PJDA 1XT5A 4Y0GA 2EDKA 5D5ME 1FL5A 1ZHNA 4Y4HC 1T03H 5FK9A 3QUZB 4D8PA 3D3VB 2IANB 1Q1JH 5FOJA 1LK3H 2AVGA 4NUJB 1L9NA 2WP3O 4G80A 4IOIB 3ZTNL 4KK9D 3V52H 3HN3A 3FQWB 5EZOH 3RWJB 2FRGP 2NY7L 4PJFF 5B39A 3KYAA 4JO4L 4J23A 3MV7B 4LLMB 2G60L 3QPXH 5TF0A 4DN4H 4IDJH 5I8EA 2VLKD 1F02I 3LS5L 1JGEA 3GB7A 3LEXA 2WQRA 1I8IA 3F7QA 1M05A 2FNBA 3VXRE 4EN3C 3GNML 2B1AL 3NN8B 4F15C 1LK2B 3C5ZC 5TFSL 5GGTL 1CFTA 2R9HD 3TBVA 2Q76B 4X9FA 1H0DA 4R96B 3SJVE 3V7MA 1INEH 1WFNA 4ZD3H 3GSNH 1TPXC 1NLBH 2DQFA 3VGBA 1FG2B 1QVOB 1S7TA 3T0XA 4LSUH 2MMXA 1U8PB 5CZVH 4JDZB 4XPFL 1CIDA 3Q6GL 1P4BH 1I7UB 2F5BL 5CEYA 3S6CA 4JHWH 4CKVX 2AJXL 1T0MB 2VZSA 2OJZL 3MGOB 4FZ8L 1RJZA 1VFBB 1P53A 5JR1L 3IJSA 4PRAA 3VFWA 5BS0E 3CLEH 4GRLA 3B2UD 1EBAA 2IMMA 1ACYL 3VU2A 5HVHC 1EH9A 4FG6C 1AGEA 1CXIA 1U91B 3H9SE 2PN5A 4OZ4B 4FQXD 2WUBL 3Q2CA 1FJ1A 5ICXA 5KW9L 1YN6B 4WU5A 4HHAA 5DJZB 4Z7WF 1HOCA 4U1IA 5A40E 4F7TB 1F11A 4O2CB 5HYJA 1EUTA 4YJZL 1IGCL 4TNVF 5EU7C 4QGTA 3V5HB 2N1KA 4WO4D 1GZQB 2ADIA 5CKAA 3UTTE 5DZOA 1OCWL 1KB9K 3U7AA 3JTTB 3PP4H 4NQXB 1WFTA 3S9DB 2DJSA 1IC7L 3HC0A 5I1HL 2PUQT 1G7HA 3RVXD 3C08L 5D2LB 4K9EH 5E4IA 3GJFA 3BMWA 3L95A 3V4VL 3BKCH 4JGUA 5IVXE 4U31A 3NH7H 4ZTOH 4PRID 1S5IL 4TN9A 4TTDC 2BFVH 4RIRA 5D7JB 3BPOB 2ADFL 4GUPA 4JGJA 4NHCH 5EO9B 4EKXA 3U4EB 5F7DB 4RAVA 5I15H 1TQCB 3HPJB 5C0AD 2GKIA 4BJLA 3BN3B 4MMZC 3U0WH 4PG2A 5T3ZE 4NZJA 4PJAA 1U8HB 3VCLB 3EYFA 3QP3A 4F58H 1JYXA 4Q9RH 4F7MB 1UWEH 2DQJL 1NUNB 4WCYL 4JY4B 4YEEA 2IFFL 5EH1A 3KS0H 4YHZL 1MCSA 3MLYL 1U95B 3BIBX 43C9B 3EFFB 1FORH 2BMKA 1C5CL 1A7RH 4AQOA 2CGRL 2AXGA 1A6VL 4JFFD 3BSZL 1AGBB 1BOGA 1FAKT 4Z7UB 5K9KB 1X4YA 1KXVC 1YNTA 3KPOB 4JKWA 1EJ6A 3CSBA 1I1FB 2AK1H 2QL1A 1QO3A 4TSCL 3VXME 4DCQB 1Q72H 5CWSA 3EFDH 4K3GA 5GS0H 3QUZC 4NO0A 2D0HA 5IG7B 3B8YA 1WAAF 4UQ3B 1X5KA 2YUWA 5DJAA 2MKWA 4MNQA 3TT3H 1LP9E 4ISVA 5AG9A 1I3VA 5DUPL 4JVWA 5EU6B 1ODAA 3RAJH 1MFCH 1JCKA 1L0XA 1NBZA 2GUOA 4WFGD 1AD9B 4XXCC 3RQ3A 4XP5L 3M8OH 4OLZH 4CNIB 1JBJA 5JNYA 4NNPH 2OMBA 1CICA 3EYUH 1XR8B 1UACL 4LDOB 3HUJF 1WEJH 5D7SL 2YUXA 1JWUB 3LKRA 5IFJB 2AQ2A 3QDJB 4HKXB 2BRQA 1SYVA 1WISA 3QFDA 1D3CA 3ARDB 3C8DA 4NZRH 3O4LA 3BZ4B 3UTZB 3CK0H 2M2DA 3SDCB 3T1FA 2GAZB 4PS4H 5DFTA 1T21B 1A14H 1XF4B 1Q9LB 3GI8L 5DHVB 5ESVB 2UZIL 4Z0BL 5GS3A 2XN9D 5C0BB 4PRNA 4OCNC 5MEQA 2GJ6E 4HS6A 1T1YA 3QBTB 4JE4B 4PJGE 3BIKA 4GKNA 4DZBB 3S36L 1BGXH 1NUFA 3ZLQC 3KWWA 3ZYOA 3L3IB 2DQTH 2HT3D 1I75A 5BW7C 1HCVA 3D2UB 3LIZL 3DURB 4HZLA 3D48R 1S9YA 2JLLA 4LAQH 2P5EB 3GBNH 2F5AL 4ELKB 3H2WA 2VXSH 1FCCA 3TCLA 2DTSA 4U05A 2FDBP 4U7MA 4RA3A 5INDB 3SE4A 5C09E 4XVUC 1MHCA 3RHWF 4FHBD 4KV5E 1T66D 4HUNB 2F58L 5TDNA 4I0PD 3B3IB 4Y2OA 1KJ3H 5JDSB 4PV9A 1DZBA 4ZODA 3JTSB 5D70L 3FMGH 3BESR 4NYLB 4Y1AD 1VCAA 1LO0L 4RGNE 3IU4H 5SWSA 5FYJD 1MVUB 3OJ2C 1JP5A 3LMJH 2DMBA 5DR5L 1A21A 1KTKE 4OZHA 3U36A 1XIWB 1CFNB 3Q48A 4YBLB 5ALCL 1HKFA 3LPWA 2MCPL 1UB6B 1TTFA 4XPHL 3QULA 2MQCA 2KBGA 1CBVH 4XBPA 1H3UA 5D7JC 4ZUVB 4P23B 3BPOC 1X4XA 1JPST 5JHLH 1B0WA 2IANE 2HN7B 3PWVA 3OAYH 2CRIA 3QIWC 1TQCC 3EOTL 5FXCH 3ECBB 3MLVH 1UCBH 2GT9A 5D9SA 3QUYB 1LO2H 2RQ8A 2XY1A 4OQTA 5FCUL 2VH5H 2OK0H 4H20L 3UYPA 3VH8A 5FGCB 4AJ0A 3B5GA 3GHBL 1A6ZA 4X5XB 5ISZE 1P4IH 4JRWA 2YD8A 1JRHI 1EFXD 5IFHH 1NBQA 3PUCA 3UDWC 2A6DB 5I19H 3ARFB 1VA9A 3GIVB 4K3DL 1NC4D 3G5XB 2BDNH 2BSSB 4RRPA 3PV6B 4NBYB 1GGIL 1DVFB 3LEYL 5AZ2L 4OF3A 1MCRA 1DN2A 4F7CA 4Q6IA 2YMXL 4NKQB 4B50A 2EKJA 3H7LA 1MJ7L 5AAWA 1JFQH 4FQCH 5CINH 5FDWA 1IAKA 3QRFM 1MWAH 3AY4C 2RIKA 3I75A 5INCB 1CLCA 5F1NA 3T65B 3V5DB 5DEFA 4O9HL 4QHKJ 3UTPD 3TT1H 5E5RB 1G7IA 1H8OA 4K07A 4HEME 1UGNA 4P3WA 2EKSB 1CDIA 4NO2B 2AJYH 5E8NB 4N5UA 4X6FA 1A4KB 2NNAB 3MFFA 1R5VB 4HUUA 2XWBA 4L5FL 1YEHH 5GGQH 4L9LB 1GOGA 4O58L 1L9MA 4PJBE 2DWEA 2MPAH 5H35A 1DQDH 1QP1A 4MJ6B 4BFGA 4TRPL 1ZVHA 2E8YA 4DZ8A 2MJWA 4DGIH 4LSTL 4Y5XB 2EDEA 1KIUA 4HS8L 1HH9B 4F37F 1NAKL 3ARDC 5FO9A 2A9NL 2VDKH 3DNKA 5D2NA 2HT2C 2R1YB 4OGZA 4QLRA 3SDCC 1KCVH 4K3JL 4CN6A 1U8MA 4E41B 3REVA 3ZE1E 1K5NB 1WUNT 1X5FA 2X1OA 1PKQB 3DMMA 4XC1H 1KTLA 5MERA 1DFBH 5SWZD 4KRPB 4H5SB 3QIWD 2JK5A 4I48B 3VXQB 4PJ9C 1V7ML 3CFIC 1VFUA 2NXYC 1RUKH 1J18A 4PJ7F 3QEQA 4O51B 3N50A 1NC2A 3B5HA 1HYRC 4U1NA 2RJMA 1LK3L 3QQ9C 4UT7H 4QCIA 4G6MH 1IRAY 4X6CA 1FNEB 2HTLC 3RGVB 3CFDA 3I85A 3FO2A 1J8HB 4XWGL 3OKNA 4AYFA 2P45B 3UBXA 2G9HB 5D1QA 4YHNB 1ED3A 2FJFB 2J5LB 1U92A 4M7JL 4Q9QH 3KPSD 1QA9A 1SJEA 4IIQB 2XA8H 4PYGA 5D8JL 4Q2ZB 4MLSA 4RAUB 1CD0A 2X70B 1XIWC 2JB5L 1SEBB 4YBLC 2H2SD 3AM8A 1J0JA 1FCGA 1U6AH 4Z7UE 3AROA 1ONQB 1IQDB 4JPWH 2WINA 4J3XA 5TQ2L 1T3FB 4UINL 5IKCB 4ODVH 1INEL 5AEAA 2P46B 1Q9KA 2HJKB 4P23C 3GSNL 4HWBH 2FR4B 3NACL 2J4WH 1IT9H 1NLBL 2VDMH 2AABH 1A1MA 4MNHB 5LGHH 5AD0A 1T04B 5GS0D 4KKCD 3WUZA 3ULUL 4B7IA 2EDNA 4FTVE 2NY0C 4Y16B 2Z31B 3ELAT 1JZ6A 4PJGF 3MRKB 3CVHB 3QUYC 5DLML 1T7ZA 4JHWL 2HLAB 5GGRY 3V6ZA 1PQZA 1MCBA 2AXFB 4U3CA 1GHFL 1AE6H 1YC8A 1NFKA 3R06B 3CLEL 3MV9E 4YHKL 5EUKB 3G6JA 4GQPH 3QO0B 3LPGA 4ODTL 4G7YH 1JPGB 3ARFC 4MGXA 5TDOA 2YXMA 4IRJD 5HD8C 4E0RB 3HCVB 1DVFC 4HF5L 4AG4H 4CU8A 1BVZA 3DYOA 3WS3B 4RMRA 2H9GB 4KXZI 4PP1C 4H0GA 1WFOA 1XZ0B 3MZTA 4LSDA 1MLCA 4P2QD 4QHKI 1PAMA 3IFOB 3LAFA 2PTTA 4GG6E 1Q0YH 2A6KB 2GFBA 1XGRA 4PJ9D 4CAGA 1T5WA 5DQDH 4YWGL 2XZAH 4MJIB 3JWDL 2NXYD 5H94B 1CDJA 3PJSB 5IQ9A 3LZFL 3MRJA 1X6NA 3JV5A 1ZHKB 4AT6B 1ZA3A 4WHCA 4C56B 2ADGA 4I5BB 4NZUH 4RZCA 3GO1H 3TVMB 5C0BE 2EO1A 2M1KA 2VTFA 3SBWC 4J4PC 3WS6A 1FVDB 3UJJH 2P8MB 2HRPH 3G5ZA 1YEKH 4ZPTA 2EIEA 2VLJB 3W9EB 1K4DA 3VFGH 1OAXH 1JN6A 3RA7H 5E03A 2HTLD 4L9LC 5L8JB 2F9BT 1NGQL 2BFVL 4HEPG 3SKOA 5IFAL 2XYCA 1NFDA 4EI6B 3KPMA 4Y5XC 3BZDA 5KS9A 4LIQH 1K9TA 3GK8L 3JSSA 3C60D 3EO0A 2CR3A 3EDJA 4HK0A 5IB1A 4FP8H 4MJ5B 2NR6C 2RFXA 4UB0L 4G9FD 1HK6A 4XP9H 1OAYH 1K85A 2EDBA 3MMEA 4XMPL 2EO9A 3TA3D 2IQAA 3QUMB 4ZUWB 4F58L 3NZHL 4Q9RL 3FB7A 3BZFA 4R97B 2VXQH 5D1XA 5C0GB 5IGXL 1A4JB 4JO3H 2YUVA 2DM4A 4F9PA 3BDXA 4YK4B 1A7BA 4J3OC 3HR6A 2CLVB 1Y6NR 3EO1A 2XWTB 3BW9B 1AC6A 4NQVB 4JPKL 4TULL 2Y7QA 1KB9J 5EWIH 2Z92B 1DR9A 4OF6A 1OGAA 3WO4B 4KRPC 5MEND 5JW4M 1CT8A 3T77A 1KG0B 1DBBH 2NY0D 1Q72L 4UNUA 5IQ7H 3B8SA 4RGMB 2NLJA 5ANMB 3QJFA 3KPPB 3QNYA 1VKXB 2W9DH 3UMTA 4HGWA 1QSEB 3DJ9A 3EYVA 3MRBB 1GH7A 4A6YA 3ARWA 5LBSL 5IBUB 4JQVA 1V05A 3CMGA 3TT3L 5I1GL 2R1WB 4L4VD 4POZD 2DQGH 7FABH 3RGVC 1F4WH 4BZ1L 2MHAA 1HSAA 1MFCL 5D7IE 2VXUH 3P9MA 2B4CL 4BH8A 5HD8D 5L2KB 1YN7B 4PJBF 4TSBL 1JPFA 5CSZA 3Q0HA 1KGCE 4HPOH 3CH8A 2P5WD 3HC4H 3KPNA 2J5LC 4NRZB 1I85A 4YBHA 3W2DH 1WEJL 5HJ3B 3MLSH 5GGSA 4S1DD 3X11B 4IIQC 2PW1B 3D87B 3UTSB 4HUVA 3QCVH 5SWQA 3O41A 4UT9H 3D39D 4HXBH 3FN3A 2APVA 2ZJSH 4WI6A 2VQTA 4KC3B 4W4NA 1BFOA 5EN2B 3BT2H 3LN5B 4KTEH 4FQXA 1MHPH 4LSQH 1CTOA 2WK2A 3BD5A 4ETQB 1H5BB 4MXQC 4WIQA 5FCSH 1RZ7H 1KXQE 5DD3H 4ZYKB 3ARYA 1ADQA 4WO4A 2BERA 5LJYH 2Y07L 3QIBB 4Y16C 2Z31C 3DXAD 2NZ9C 4N0UB 4U3HA 1X44A 3MLUH 5EFIB 4Y4HA 1EDQA 4AEEA 1FZMA 5E0QA 1X4ZA 4MXVE 5I1KH 4F8TA 3OB0H 1H15B 1CS6A 1JVKA 4NCC2 1IMHC 3QT2A 3T08A 3TIEA 4XP6L 2X1XR 43CAB 4PRIA 2DLHA 3DVGB 3DHMA 1JGDA 2DYPB 2DTMH 2X7LA 3K1KC 2IPKB 1F13A 3UPCA 1D5XA 5DEZA 1X3DA 4Z5RA 4M61A 5IOPA 1A47A 1RZKC 4G9DB 5IV2A 4F7EA 3QQ3A 5F1KC 3QXAB 5C0AA 1AGCA 4WUKL 5IJVA 5JIHA 1A3LL 1BWWA 1MFEL 2VR9A 3HA0A 5E00A 2X4NB 4EN3A 3QWOA 3OKEA 3C5ZA 5SX4I 1PKQE 3OXRA 4UNTA 2EXYC 5KSAB 1QPXA 4NP4H 4Q6YA 1RHHB 3VXPB 4NKIH 4APQB 2I24N 2AK4B 4R90H 5HDBE 3QNXA 1A3RL 5F97E 3ULVF 1JMZA 4QHMA 1ND0A 4JFFA 3J8F7 3L7FA 5CP3A 4CVWA 1CBVL 4X5WB 1U3JA 1P6AB 4WV1B 5IIEA 1SM3H 1E4WH 4MAUL 1NAMB 4GMSL 5I18H 5JLZB 5KSVA 1U8OA 1QACA 2C4FU 3LKQA 3LN9A 3PWUA 4KUCD 3DUSB 5KVDH 2NW2A 3U9PL 4NHUA 5DVNA 3VGAB 4P2OB 5F8QC 3L3KB 4HX1A 5BVPH 3VDCA 1UCBL 1I9JL 2XV6B 5C8JA 2BNRD 5FO7B 1GAFH 3S96A 1V3LA 1J8HE 5DQJA 4C83A 1K8DB 4CW1A 1JZ8A 1DJSA 5HPOA 2G5RA 2ESVD 4P3CL 4JFOA 1QFHA 1P4IL 1K6QH 1KELL 3DRQB 4CU7A 4KQ4H 4R97C 3SCMB 2VERN 5L88L 1I1YA 4GXVH 4RSVA 4YK4C 1JI1A 4QRSB 4GG8A 2P8LB 2BDNL 1N7ML 3ARBB 3GSQA 5FOBA 2C1PB 4OB5H 1HHGA 3IXTB 5CILH 2ICES 2NZ9D 1CU4H 4RGMC 3FOMA 3IDNB 3BAEL 3PE9A 3UEZA 1ZGLA 5IBUG 2AW2A 3T8XA 5E9DE 5D6CA 1EAPB 2CRMA 1DLHB 5EZIH 1UZ6E 2R0ZH 2EDDA 1ZLUH 1J0ZA 5I9QB 3KLHC 2CXKA 3DX8A 4H0IA 5T3ZH 4F8QA 1FDLL 4L8DB 4MQ7B 2QV2A 1P7QD 4U1SB 3EOAA 4AM0A 4PRPB 4O4YH 1BQLH 3BPCB 1YEHL 5GGQL 4HBCL 1BECA 1UWXK 4LLYB 4N5EC 3KPRE 1T2XA 4XPBL 2DWDA 3V79C 2ATPB 1MCEA 3A6BH 3BH9A 3CH1B 5EU4A 1IGIH 4G7VH 3E3QC 5CJQH 1D5ZA 4OUUB 2V2WB 1NBYB 5C07D 4KY1L 2K7PA 4BQ6A 3OJDB 1KB5H 1AI1H 1JJUA 3OGCB 3C8HA 2EXYD 2VDKL 3F5WB 3CFJB 4HKZB 3EGSA 3SKNA 1BIIB 2XZCH 2YPLA 3BEVB 1H5BC 4HWZB 3ZL4H 1HHJA 3MV8E 4MJIE 4H25A 5F9OL 3GM8A 3S36X 4I0PA 4GAGL 4C56E 1UXSB 2C3XA 2EYTA 3CFKA 4LASH 3QIBC 3CXHK 2J88H 2R29L 4YDVB 1U8LB 3HMWH 4OQTL 2NX5E 3QUZA 2VLJE 4KKAD 5T5NF 4HUMB 3D3VA 3NMEA 5I30L 1PDKA 2B1HL 2UUDK 2XG4A 5E1AB 2VQ1B 4JRYD 1F3DJ 2CKBB 5AYUL 1TZHA 2A6IA 1TJIL 1JGVL 4MX7B 3HRPA 5KVGL 3FOLB 5JPMB 2LU7A 1UC6A 3JVGC 4ODHL 5C3LD 3FQWA 3CMOL 4OM1H 1R5IB 1X5LA 1EGJH 2ZSWA 3NCJH 2E27H 4UT7L 1I3GL 3VXSD 1YDPA 5F9JB 4XXCA 5DD0L 5D7IF 3WHE0 3VA6A 2MFNA 4L4TB 1AKJD 4FZEL 3WSQH 4JZNA 4KVNL 1HDMB 1ETZB 4FABL 3SO3B 1UCTA 5JHDE 2DI9A 4Z7QE 1I7ZA 3WL9B 4KJPD 1TMCB 4YXLH 4M6NH 5I1LA 3BZEB 3RDTC 1ZWIB 4UV4H 4QO1A 2EDWA 1JTPA 1JZ5A 3ES6B 1HCFX 2Q6WA 4R96A 5KSAC 4K71B 1CFSB 1EFXA 5IK3B 1OQXA 2P7TB 4OLWH 4TTGA 5DWUH 4APQC 4YX2H 4K3HA 3U6RB 1CCZA 4P4KD 3N0PB 2VN7A 4GH7B 3FL7A 1FG2A 1QVOA 3EJZD 4R4NC 1QSEE 1PD6A 2EDTA 3AU1B 4NWTL 1U8PA 2RCSL 3MCKA 2VLME 1AFVH 2XXMB 2X41A 4M7ZB 2P8PB 3BFOA 4BKLB 1U3HD 1HZHL 3VGAC 3MJ9H 4P2OC 3E6HA 4XCYA 4LSSH 4ZMAT 5JOPE 2ICWA 1T0MA 4LGSB 1FIEA 1SY6H 1VFBA 5BW7A 3B9KB 3SGEH 1F3JB 1B2WL 2R8SH 1FRGH 3BP6B 5I1CL 2I26N 4Y19B 5EZLA 4RFEB 1U91A 1GGCH 4OZ4A 3SCMC 1S9VB 5DO2D 1T2QL 3BKJL 1YN6A 1JWMB 3QAZB 3KXFD 4G7YL 1FBIL 4F7TA 1FHGA 3T3MF 3ARBC 2YPVH 2OP4H 1M7DB 2AJVL 1K4CB 3O2DA 2A9ML 1QRKA 2X09A 3FQRB 3MYJB 4HCRL 3JTTA 2VITA 5EC1B 3P77B 5DQDL 2WAHA 4AL8H 5FYKE 3LQMA 3P4MB 5D2LA 4R8WL 4FFWD 5I9QC 1BD2E 1ZLSL 4NZUL 3GO1L 5HI5C 4CBPA 4PGCB 3OX8B 4XCCH 5I17A 4N0UE 4UT6H 3L7EB 1R5WB 3VFGL 5D7JA 3ALWA 4MA7H 4LF3B 5EO9A 3OG4B 3PHQA 4KPHH 3BP5B 3U4EA 5F7DA 1X5GA 3MRFB 1CK0H 2YD2A 3DI3B 5SWZA 4MWFB 3QIWA 3RNKB 4LBEB 4IJ3B 4LIQL 4XPAH 4Z7VB 1TZIA 3VFMB 3VXRD 1EO5A 3EAKA 3RDTD 2HYMA 4L3CB 5E5MB 3BOVA 1FNSL 4PFEA 3BN9C 3VCLA 1NGPH 2QLVB 4XP9L 1OAYL 2JJWA 2QADD 3CVIH 3OAZK 4F7MA 1OWRM 2WM0A 5GRVL 4WEBL 4DWHA 3NIFE 4JY4A 1U2HA 1AGFA 1U95A 5KJRH 3EFFA 2ICEB 3PHSA 3DO7B 4KRLB 5HGDA 4TVPL 2ED7A 4OF5A 2GTWB 2F53B 1OM3H 3RVTD 1P6FA 2CK0H 3IDJB 1XAUA 4L3ED 1I1FA 2QQLL 2A74B 4XVSH 4KK5C 3AY4A 3BKYH 4JFQB 5JUEH 2VDRL 2GIYA 1ZSDB 2D7OA 4XAKE 2AK4E 1DBBL 4YO0B 1VHPA 1Z0NA 3VWKB 2APTA 4AENB 4UQ3A 5F96L 1OQOA 4FRWA 2F19H 4WUUE 3WJLC 3IFPB 4XP1L 3OBAA 2D7TH 5EU6A 5BMFL 2NCMA 1JE6A 2BNQB 3H9SD 5DMGC 1A6PA 2DQGL 4MQSB 1AD9A 2X2YA 3IDXH 2HTKD 4UAOB 4NWUL 2JB6A 2PXYB 5DA0B 1I1AB 25C8H 4KRMB 4ZFOB 1XR8A 5TDPB 2HFTA 5E8EB 5IVZA 5IFJA 3O6KH 1IM3B 1ZA6A 3WLBB 5DI8B 1CLOH 3QDJA 3GMLB 4HKXA 3UTTD 4DQOH 2GCYA 1S7XB 1S8DB 1W0VA 3QHFH 1JHLH 3O3DB 1L7TL 2KUTA 3ARDA 4K71C 4UT9L 4HXBL 1C1EL 2VE6B 3UTZA 1ZOXA 2DL2A 3VRIA 1LNUB 5HI5D 3RWDB 4P57A 3SDCA 3CNKA 4IRJA 2GAZA 12E8H 4NDMB 2FYYA 1T21A 1XF4A 1Q9LA 2FO4A 3QISA 5F7MC 5GRUH 5DHVA 4M7KL 2Q3AA 1JV5B 1DBKH 1JNLL 4M7ZC 1P1ZB 3S35H 1RY7B 4MAYB 4QHUA 3WDHA 1Z6JT 4OBRA 4PJ9A 4DZBA 4YBQD 3L3IA 3MLUL 1DBMH 1M1SA 3B9KC 4OD1L 2CIKA 4XNXL 5IMLB 1C8PA 4JRXE 1UENA 3DURA 5CKGA 4DK6A 5M94B 4YHIB 5I16A 4R26L 1XCTA 1INQB 2P5EA 1CGSL 4ZTPL 4ZFGH 4FNLH 2Q7YA 1W72H 1CYGA 4MA3B 4OM0H 3QAZC 5KSBF 2VLLB 4YHLH 5HHNB 4FFZL 4UOW1 3TNMB 2DTML 2EE3A 1MLBB 3UAJD 4DKDC 3B3IA 5DMKA 4M6OH 1Z0MA 3BE1L 1J86A 2I9LA 3JTSA 1R6VA 2JCCA 5E56A 3VXMD 1MFNA 1E6JH 1FYTD 3EKCA 1MVUA 3W11C 2LFGA 5ADOL 4EUPA 4ONHB 3MOBL 4LCCB 4G9FA 1XIWA 1CFNA 2YSSB 2FX8H 5F1IA 5ECJE 3RGHA 3TA3A 2Z8SA 4P2CG 1UB6A 3PDDA 2FB4L 1M7XA 1Z2KA 3M07A 4BZ2L 3QDHA 4YHPB 1UA6H 3U0PA 3MRCA 4N0YH 4NP4L 3KLSA 5HBBA 1JGLH 4YQXH 4ZUVA 4P23A 3FQXB 4J8RB 1FNGB 4R90L 4S0TD 2R2HA 2HN7A 3MBED 4JFEB 3V4PL 2X89D 5I1DB 4O02H 1JGUH 5MENA 3QA3B 2Y06H 2DN7A 4NQUA 1SJXA 1SM3L 1E4WL 1IAIH 1RIVH 4IJ3C 2A0LD 3EOBA 1G9NH 3B5TA 1LEIB 3ZKND 4K3EL 2VC2H 5J0BA 5DJ0B 1CR9H 2L0DA 2CO7B 5L0QB 4DKAA 1QBML 3GRWA 4XX1E 4H8WH 3BGFB 1CZ8L 1E4KA 1FLTX 1RK0B 1P9MC 5B3JF 1IQWL 1RVFH 3LHPL 2HVKB 3BJLA 5T1KD 1QSFB 4U6XB 3RX5A 3QUXD 4G8GD 3BXNB 3DYMA 2A6DA 4KQ4L 1FLRH 3ARFA 3BKML 2FATH 3GIVA 3G5XA 3A6CH 1TJHL 3LKNA 3O4OB 3B43A 2KDGA 1X5XA 1ADQL 5D71L 4JG0H 4DVRL 1EEQA 4IRSD 1I3UA 2O26U 4U1MB 1HWHB 1ZVSB 1IKFH 4HIEB 4NZTL 1CD1A 2HFFB 3QO1B 1CU4L 3VWKC 3LV3B 4PGZA 5HYSG 4OLYL 1T4KB 2DKUA 4IBLT 3MJ6A 5EZIL 1XH3A 2Y25A 1HE7A 2EKSA 4NO2A 3BO8B 1HILB 3SKMB 3SBWA 4J4PA 3RFZC 5E8NA 5JW5A 1WBZA 4EDXB 4OI7A 3S97C 5T3ZL 1MJJB 3M45A 4JKPL 1A4KA 2NNAA 5D7KE 4KFZC 2NXZD 1TITA 3F65A 5DD6A 3MRLB 4L9LA 3LRSB 1I1AC 5EUOA 4O4YL 3QQ4B 2E6PA 1Z9SA 2SEBB 4Z77B 2E9JA 5DSCB 1BVLA 4Y19E 1XR9B 3HE7B 4Y5XA 2UVEA 3OPZH 4RGND 5EZJA 4PJCF 3A6BL 5CEZD 4G7VL 5F9WB 5CJQL 3RPIB 5C0RL 3NCCB 1HH9A 1N5AB 3KHQA 1H3PL 3RY6C 1I1RA 4PLOB 2DOCA 3MUGA 3FT4A 4YGVA 2R1YA 1EVTC 4E41A 4S2SA 3LN4B 1VFAA 3WFHB 1OY3B 4IMLA 2ZUTA 3ZL4L 1S7RB 4YNYA 3O6MH 4KUZH 2IAMD 4ZAKD 4H5SA 1XF1A 2W59A 4JY5L 4I48A 3VXQA 5JO5B 4HKBB 4WWID 3MODH 2M8XA 2E3VA 1VERA 5CP7B 4O51A 3REWA 2QQKH 4DW2H 5FM8A 1IEBA 1RPQA 2GY5A 4LVNB 3H7BB 3IJHB 4W4OC 2LVEA 4Z78B 1OSZB 3SDXF 5ISZD 2NQCA 3QI9B 2HT4C 3HE6D 4X7CC 2R2BB 4LPTA 3MLZL 1EHLL 4PJFA 1FNEA 2D9CA 2VXVL 4QRPB 2E27L 2LQRA 4S1QH 4NN6B 2X1QA 4M02A 2JJSC 3VGGA 3MRMB 4M6ML 3WSQL 5I74B 4YHNA 1KEGL 2CKNA 2FJFA 3U2SB 1W8OA 1J0KA 5GISH 4HQQH 2VLRD 4IIQA 4BSVB 1X5YA 4LDLB 4RAUA 4LCCC 4U0QB 1XF2B 5EB9A 3N1PC 5DDHB 1SEBA 1LO4H 2HP4A 4RX4D 2JIXD 1ES0B 1RZJH 1ONQA 1IQDA 1MCLA 2BHYA 4G5ZL 1EMTL 3SE9H 4C54A 1OOAA 1AXSB 4PREB 1G9MC 4Q9BA 5IKCA 5C6PB 4LU5H 2ZCLL 3CXHJ 2XQYG 4Y2DB 4MNHA 5J3HC 1HQRA 4KDTC 5E2UH 1CFVH 1IM9D 2OS7A 3MGTB 4Y16A 1NCCH 2O5YL 2VUOA 2KH2B 3ZMRA 3MJ9L 4OKVA 3MRHA 4Z0XB 5DRWB 3CLFH 5KBNC 5L0QC 4NQCB 3BGFC 2H32B 2FL5B 4NRXB 4ODXB 2J8UE 2WIMA 3QO0A 5DUBB 1JPGA 1P7QA 1OSPH 1MUJB 4Z7WA 3RVUC 3HCVA 3BP4B 5SX5K 4ZO7A 3RTQD 3WS3A 2H9GA 4UILH 3RU8H 3QDME 4K2UL 1HXYB 4MCYB 3QCUH 2YPVL 4OZIE 4ODUB 3SY0A 5HY9B 3HMXA 2A6KA 3CX2A 4OLXL 3F7RA 1C16B 3FO9B 5H94A 1WCBB 2X4TA 1JZ7A 5L6YL 1YUHB 2P4AB 2J7LA 4S0SD 4AT6A 1G6RA 3P11H 2OSLB 4I5BA 1C08B 5F93C 3VFPB 1FVDA 4NSKB 1IAOA 3MBXL 3W9EA 2D9QB 5BO1H 4XCCL 2I9TA 1PG7H 5DFWH 4MDJA 2OTUA 4XNUL 1FN4A 5K59E 4UUJB 1F3DH 3QB7C 1BEYL 3P40A 1UVQA 4HFUL 5JOEA 1ZS8B 2IH3B 1FZKB 3H3PH 5CHNA 5F9WC 2PTVA 1RJCA 4FXLA 3ZZ1A 4OJFH 3T0AA 3RKPA 1XF5B 1NGPL 2EH8L 3T0WA 4QGYA 1MJUL 1QEWB 5C0GA 3QWRA 5ENWA 1A4JA 3VXSA 2PNDA 1MY7A 3ULVD 1YC7A 1TJGL 2CLVA 4PY8I 2BOCB 5KJRL 2XWTA 3BW9A 4NQVA 4WGWB 5GPRA 2DI7A 3LS4H 2Z92A 4K8RH 3C5SA 3CVHH 1WGOA 5IMMA 3C8KA 4FTVD 5ANMA 4PJXB 2VQUA 4O2EB 3JBG7 5B3NA 4MQXC 3CPLB 3VFTA 1WAAA 5A2IH 1S3KL 2ERJB 4XCEB 4JFEE 4HUKB 4LVNC 1ACZA 4LCIH 2FWOB 3DBXA 1KIRB 3DVFA 1TVBB 4LLUA 3QI9C 2R1WA 3MV11 1ZT4B 3G04A 3QDGB 4M6AA 5JA8B 2D7MA 2F74B 3MV9D 3NTCH 2H3NB 5IEKA 5EO1B 4XC3H 4P4KA 4EI5B 4ZNCD 5MEOB 3SGKA 5FGSA 2R4RL 1INDL 4X9GA 5F6HI 5L2KA 3HI6H 1YN7A 1DE4B 2YZ1A 1OP5K 1U2CA 3O2DL 4BSWB 5I74C 3HUJA 25C8L 2DBJA 4NRZA 4PBWD 1KN2H 2PW1A 3O6KL 1P7KB 3UTSA 1CLOL 2MQ0A 2CDGB 1I3RB 4DQOL 2BY1A 3OKOB 3SDAB 4TUOB 1XFPA 1FL3B 3OXSA 1JHLL 1OGTB 2FIKA 5EN2A 4OLUL 1UM4L 3LN5A 3K46A 2R2EB 1MCWW 1DEEA 3ZE0F 1CXHA 3T3PE 4G42B 3FTGB 4JKKA 4DK3A 1T6VN 4Y2DC 12E8L 1Z3GL 5K9JL 3KYNB 1IKNC 4OF7A 5J6GB 2QSVA 5GGVH 4OZGB 1U3YA 1J1OH 3S5LA 3SKJH 3QIBA 1RZFH 2WQ8A 2B8OT 4WU7A 5EFIA 2V5SA 1OHQA 4U6VL 1RUAH 2E7MA 3E8UH 2VRAA 4XNMB 1DBML 1YECH 3QUMH 4NKDA 1H15A 5BRZE 1A6UH 5CD5D 1G7QB 3VD3A 1AGDA 4ACPA 1KYOK 1EK3A 3DVGA 1EERB 3JVGA 1KCLA 3G9AB 4GSDH 4XZUA 5EA0L 1H9VA 5LCVH 5KSBB 3CFEA 4OD3L 4OM0L 2W1NA 3WXVL 5HHQB 2IPKA 2YEZB 4QYOB 3KGRA 4NPYA 5FUZH 2LU3A 4GW1B 5HI3C 1GOHA 3QXAA 4PJ5E 3L3DA 4Q97A 1E6JL 4LEXH 3MRIA 4N90D 3RDTA 1FZJB 1I7TB 1FNHA 1LGVA 4YDIL 1H3XA 4M1GL 1BM3L 5BV7B 5KSAA 1RHHA 1BX2A 1C5BH 1I8KB 4Y88A 3ARQA 1C5DB 2FECL 3PQYB 4PRHB 3HTLX 2C3HA 4X5WA 1CQKA 1GC1H 4YQXL 1JYWA 1CQYA 4UQ2B 1LEGB 1DL7L 1DQJB 1NAMA 4L3EA 3IAGC 2ZP0T 4O02L 1JGUL 2Y36H 3BRGC 1KGCD 3ESVF 3DUSA 2Y06L 3VXUB 5DJXA 1IAIL 2D31B 3WIFB 2VAAB 4OFKA 4P99A 5GXBB 1G9NL 1B0GB 3ZDZF 1V3MA 4QRPE 1XGTB 3I50L 4NQDD 3FB8B 2IQ9H 4RGOL 1ZE3C 4NCC1 5DHYB 2V9TA 4FQ1L 3DRQA 5FYKH 1NDGB 3A6OA 3G6AB 4XI5C 3RVVD 4MNGB 4QRSA 4R3SA 3MSPA 2DD8L 1KCSH 5EULV 5IP4A 1RMFH 2ZOLB 5T1LD 4WWKD 1YEEH 4LHUB 1K3IA 4PJDB 1W8NA 4TNWK 3IDNA 1IKFL 4G6FB 3THML 1F97A 1CFQA 1HQ4A 3RWCB 4LSVH 2Z8RA 3T0BA 3O8XC 1KJVA 5CUSL 4HW6A 2IPTL 4EI5C 4MQ7A 1P69B 4PRPA 1Q94B 3OAUH 4OCRH 5ILTL 4NQCE 2AEQL 1PX4A 4BH7B 1J12A 2R0KH 2N56A 3KDMB 3C87A 5GGSY 5I8EB 1MHHB 4NZDA 1TZGL 3GJFK 2GEEA 3CH1A 3RIFF 1JGEB 3GB7B 3LEXB 3G6DL 2C5DC 2OTPA 3HZMA 4NM4H 3GKWH 4OUUA 5HGBB 1M05B 4LVHB 3EZJB 1KXTB 4U1LB 3O0RH 3WXWL 5ETUB 5BZWA 1CFTB 1OT2A 4P2RE 3S34H 3TBVB 5BZDA 3OJDA 4J6RL 1H0DB 3OGCA 1D7FA 3F5WA 2UVFA 1BIIA 1R24A 3BEVA 5DD1L 2I25N 3NVQA 1BFVL 4MB4A 3IJYB 1CL7H 3CU7A 2DQFB 5D72H 1J0YA 2BC4B 3A67H 5A43C 2G75A 5J13B 4Y4KB 4IDLA 4AEIL 2PYFB 3HZVB 1AO7D 1FYTA 3O6ML 2CJUL 4LPXA 3DPBA 3Q5YA 3R8BB 4PJ7A 4RDQF 1DQLL 5DF0A 3PGCB 3GRWL 2GSIB 1IGFL 5E1AA 2CKBA 3VD7A 3OMZA 4PRAB 4RMSA 3VFWB 1R3LB 4TQEH 3FOLA 1UM5H 4GRLB 5JPMA 4Z76B 3MACH 1AGEB 4H1LA 1R5IA 2X4OA 1FJ1B 4ERSH 3MPCA 3FQNA 4WU5B 5F9JA 3WFEH 1D5BB 1HOCB 2BJMH 2X89A 4L4TA 4U1IB 3T0EB 1K2DA 4BFEA 1HDMA 4MLIA 3AVEA 3WL9A 4WRLA 1RJYA 1BJ1H 1A1NA 2ADIB 3I3DA 3IVKB 5GISL 5HHOD 3HB3C 1WBYA 4PGDB 5F88B 2AERT 5HVGB 5E9DD 1SHMA 3GSWB 3HC0B 5DRNA 2A77H 5HI4C 4PD4K 5F1OB 5BV7C 1CFSA 1MCDA 5IK3A 3O8XD 1GJIA 3QUXA 4G8GA 4EIGB 1EHNA 2XT1B 3SE9L 2HKHH 3U6RA 1F00I 1ZHLB 3T3PF 1VPOL 1FO0H 4AY0A 4PJXE 3OF6D 4UIKL 3RZWA 1I7RA 1MIEH 4RIRB 2VDQL 3AU1A 1MVFA 2DDQH 3KPRD 2W92A 4BKLA 2M26A 3VGHA 4XPTH 1U8QB 3ZHDA 4ZOEA 2FHCA 4AZ8A 1NJ9A 3TZVD 3SE8H 1VACA 5I8CB 5A2KH 3CLFL 3ILQC 2C3GA 3NFSH 1Y18B 4PJAB 3HFMH 4EOWH 3BP6A 3EYFB 2L7UA 3IDIA 3SOBH 1R0AL 1S9VA 1JWMA 3IU3A 1IC1A 1OSPL 2BMKB 2PF6A 3MV8D 4GRWF 5CGYC 3ZTJG 4LHUG 3EJYC 4IMKC 1J11A 1MAML 2QHLA 1YNTB 1K4CA 5F9DC 1OAKH 2NY4D 1QKZH 1QO3B 4Z95H 4LLDB 3RWHB 3MX0A 4GJTB 4K94C 3FQRA 2EDRA 4JZJB 15C8L 2NX5D 4NO0B 2ZCHH 5EC1A 1U0QA 2VDLH 1RSFA 4MNQB 3KPLA 5F3BB 5B4MC 3HKFA 4OZGE 3GSRA 4OTXH 3OX8A 5B39G 4HUXB 1KC5H 3VJ6B 1RK1B 3L7EA 4M1DH 4OT1H 4JM4L 1R5WA 3CSGA 3NCMA 2HKFH 2ENYA 4O5LH 2AEWA 4JFDD 3MRFA 4YH6A 5CIPH 1YEJL 2BX5A 1CICB 3UXFA 3RNKA 4NQEE 1GGBL 4ORZC 4S1SH 5JHDD 3STBA 3V0WH 1UWXH 4HD9A 4CRPA 5C0CD 4Z7VA 2KQNA 4LVHC 3VFMA 1SYVB 2AXJA 3EIFA 2NY3D 3OR6B 4QXGH 2R4SL 3U79A 3VD4A 3QFDB 1ULVA 2VL5A 5E5MA 3WFBL 1QFWI 4OJFL 4ONFH 1QFUH 3RKDC 2BY3A 4PJ8B 2GK0B 3LKSA 2ICEA 3DO7A 1M71A 4MZ3A 2QSCL 2GTWA 2F53A 5J13C 4Y4KC 4L8SB 5EOCL 1E4XI 1KBGH 4PRNB 3CVHL 2A74A 1T1YB 4PJIF 2VLRA 3X14B 3MOAH 5GZOC 1UEMA 4NT6A 1ZSDA 4YO0A 4NKMB 3KWWB 3KPTA 5JXEC 3VWKA 4PRDA 3T0DA 4LOUC 3O11A 5DC4B 4KI1A 1G7LB 4FMKA 3O45B 2JIXA 4HZLB 2DL9A 3ILQD 1M4KA 2VZTA 3IFPA 4QRRD 1FFRA 2NY2B 2W9LA 2KZWA 2DLIA 1F6LL 2UUDH 3VXUE 2BNQA 3QZWA 1A6WL 5TF1H 2CK2A 3ULUE 2OZ4H 3NTCL 3HNVL 5C08D 2EIZB 3MA7B 5EU5A 3T0EC 1RZKL 3QIUB 1I1AA 1MHCB 4ZFOA 5TDNB 3HI6L 4X83A 5TDPA 4M7LH 1IM9A 1JMXA 4C55A 5ID0B 3HMXL 4PV9B 1J8KA 2DM7A 1KJ2B 2YOCA 3UTOA 5FB8B 3VGFA 1IM3A 1QSVA 4WI8A 4P5TB 3GMLA 4EDWH 3VDAA 5GJSL 1BREA 1S7XA 3NIGF 5FYKD 1D5IH 3RY6A 4XB7A 4KJWD 2IGFH 2VE6A 1BD2D 1LNUA 5H37G 1REIA 3FQUA 3OJVC 3NCYS 3RWDA 4PJDE 4NDMA 4PJEF 4HXAL 3SO5A 4UTAL 4NN7B 3RTQA 3MJ8A 2EXWC 1JF5A 1VENA 2BCKA 1P1ZA 1R3IH 3VG0L 1TNMA 4DKEL 3UC0H 2Q8BL 3A0OA 3SKJL 1RZFL 2C26A 2C1OA 1BZ7A 1IC4H 1GPOH 5IMLA 2CDEB 1RUAL 4CADB 4ESKA 1HHIA 4YHIA 4TOYH 5ALBH 1INQA 3OZ9L 2CR6A 4DOHB 4W4OA 4FS0A 4OZFA 1IC5H 4GOSA 3S4SA 4D2NA 3SDYH 2MNUA 4OCXL 2FX9H 2BY2A 4FN0A 4ZNEA 5HHNA 1MCPH 2CUIA 3OR7B 4WNQA 1A5FH 4KMQA 5ID1A 1MLBA 3HG1B 4F7CB 5JMRA 4Q6IB 3FONB 3V6BR 3TFKC 5FUZL 1MI5B 2Q1EA 1IAKB 4JZJC 3T4YB 4I3SL 3NA9H 4ONHA 5GZOD 5C6WH 3FN9A 4LCCA 4XAKD 3MLTA 4LEXL 4PP2B 4LVOC 4OLVH 1UH3A 4LOUD 2VAJA 4WHYG 1IAMA 2ZG1A 1RUPL 3T04D 1G7IB 1SYSA 4WUUD 3TV3L 5F89B 3R4DA 4OFVA 5TGBB 2ATKB 1T20B 3KNBB 3ORJA 4J8RA 1C5BL 1FNGA 2XWBB 5I1DA 1WJ3A 5CSBA 1HYSD 3GI9H 2WBJD 3P9LB 2FBOJ 1D6VH 1CICC 3D18B 3QXUA 2YD3A 2Y36L 3SDDD 5GJTL 5DYOB 1P5UA 4LRNL 4ZXBD 5EBLA 4XBGA 2XY2A 5GRVK 4NJAH 3T2NH 1S7SA 1NCUA 3HNTH 2CMRH 1KYOJ 2Z8WC 5HYJE 4WI9A 3PGFH 2R1XB 3HZYB 3KPQA 4GKOA 1QSFA 4U6XA 1FIGL 4YFEA 4HUWB 2OR9H 2IMNA 4PJ8C 4P46C 1NH6A 2VZOA 3UYOD 1NCAH 4TPRH 1KOAA 3GIZH 2HFGH 3UJIL 1J1XL 2F8OA 1UYWL 4L8SC 4MS8C 3DMMB 4ALAH 1KTLB 5C6TH 5MERB 2V2TB 1NCBL 1AQKL 5ACZA 4B41A 1SVCP 3MXVH 3D85B 1RZIB 2JK5B 5HYQA 1KFAL 3F12A 2ZZUT 2HFFA 5FUCC 3QO1A 3LV3A 1OTSD 2JE8A 1NC2B 4JRXD 2D3VA 1A6TA 4S11A 4WTXA 3LEVL 3ZTNH 4U1NB 2NY2C 1F4HA 1U8JA 1HHKB 1HILA 5T3XL 3SKMA 3Q1SL 2NY7H 2VDPH 4LGRB 1MJJA 5K33A 2G60H 1I4FA 3WFZA 4GW5A 3CFDB 2H41A 2W60A 3QIUC 2KPNA 3FO2B 1RURH 4M93B 4KRNA 1EEYA 2FCBA 3QH3B 3EZ8A 5I1IL 4PJAE 3LS5H 4HGMA 3FT2B 5D1QB 5CD3B 1ED3B 2AKRA 4P5TC 5DJCB 2B1AH 1M6OA 3RPIA 5DRXA 4NM4L 2J6EH 4QOKB 1MCCA 3EJJX 3MUY1 3EW3B 1FH5L 2WINB 4BQ8A 4HBQA 3L5WA 4P59H 2C4XA 1BFTA 4QTIH 4ETYA 3WFHA 4M1CC 3E6FA 4E5XA 3MOQA 4NN7C 3S35X 1NAML 1S7RA 3DX6B 3MRGB 5C0ND 2P49B 1F90L 4I18A 3I6LE 4WDIB 5D72L 5AD0B 3Q6GH 4MNQE 1CE1H 1NCNA 4HKBA 5JO5A 2AJXH 1CN4A 3OB0K 3ARZA 4FQIL 2P47B 3V7AG 2PO6D 1FV1A 2GYSA 1SMOA 1DP0A 1E4JA 3S88H 3V6ZB 1PVHA 3D6GA 1PQZB 4CMMB 5F7NC 3WIHH 3H7BA 1ACYH 3IJHA 3KLDA 2D03H 3GMMB 3ZT7A 1YMMB 3QI9A 1CXLA 5E2WH 5KW9H 1XEDA 5ERWB 5DK2A 1B90A 4RRPG 5E5UB 2MQ3A 5TDOB 3X12A 2LAGB 4P46D 5TPWL 5K9QG 1IGCH 1I9IL 1EHXA 1QFWM 1LE5A 2QSQA 1OF2B 2FEDC 3LKPB 1KF9B 4KZDL 2R23B 4Q6IC 3MRMA 4OKDA 2Q7NA 4N0CC 1MLCB 1YQ2A 3N85L 2I60L 3U2SA 5IHUL 1OCWH 3O4LE 5CAYB 5FKPA 4BSVA 3PNWB 4NQDA 5GSRB 1IC7H 2AGJL 2BVPA 4D9RE 5HSFA 5I1HH 4XWOD 5IQ9B 3UYRL 5DDHA 3C08H 1TXKA 1ES0A 1JTTA 3V4VH 3RIAK 3KVQA 2A77L 4G8IA 2V6HA 4PREA 1S5IH 1K4DB 3PP3H 2HKHL 1ORSA 4JM2D 2ADFH 5D7KD 4Y2DA 1YQVL 3D69A 2EECA 3MJ7B 1G1YA 3IFNL 4I3RL 1DANT 3SKOB 3G5YB 5T1LA 3NPSB 3GSXB 4CN4A 1ROWA 1UZ8A 1NFDB 2ORBL 3MGTA 5ITFB 1LILA 5GIRB 2HJLA 2DKMA 5EPMB 4YFLF 3EO0B 4HK0B 4Z0XA 2LE9A 1N6QL 5IB1B 1ZHBB 1IEHA 3TBYB 2RFXB 5GS1B 3SE8L 4WFEE 3F7VB 2FL5A 4NRXA 4P9HC 2QEJA 2V17L 4EIZC 4EZMA 2DQJH 3NFSL 4Q0XL 4WCYH 4YFLI 3MMEB 5CBEA 4EOWL 1QRND 2IQAB 4YHZH 3MLYH 3FB7B 1NL0H 5SWSE 1C5CH 2VWEC 2DQCH 3AMKA 2CGRH 1A6VH 3BSZH 4NNYA 3BP4A 2VJXA 3S98A 4OZHE 4GRWB 1VESA 4ENEC 2GSGA 3UP1A 1HXYA 4MCYA 3MXWL 2Y7QB 4TSCH 2HWZL 2VLKB 4LAJH 1BBJA 2LAAA 4PY7A 3DX7A 3T77B 2CIIA 4YLQT 3QXVA 3DVIA 3FO9A 4PD4J 1ZLUK 3PIQA 1N6UA 2XZQL 1S9WA 1F8TH 1WCBA 3QJFB 2CKBL 2A38A 4KHTL 2ZCHL 4A6YB 2XRAH 3M1BB 5DUPH 4NO3B 1LQSR 2DKSA 3WDIA 2VDLL 5CZXD 3TO4D 4W68A 4NSKA 5JXAL 1VSCA 1OARH 1OD7A 2V7HA 3IFLL 5GS2H 2MHAB 2XICA 5DC9B 3P9MB 4M93C 4BH8B 4UUJA 1BF8A 2ZNXA 3FCTB 3I02A 4X6DF 1JPFB 2HKFL 5D7SH 1AO7A 1FL6B 5CSZB 5BOZG 4PLNC 4ELMF 4DN3L 3KPNB 1FZKA 2WIIB 5M95B 4TNWF 4V1DD 4LPYA 2VYRE 3O6LH 3ZSSA 3V0WL 1YEIL 4Y8DC 4RWYL 4NC1E 2OCFD 3O41B 1BQHB 5H8DA 1XF5A 3MRQB 3TYGL 3U46A 1IBGH 1BFOB 3OTTA 4FQXB 4OIIL 1QEWA 5L2JB 2ZWLT 4ONFL 1S9KC 2BRRL 1QFUL 1B6DA 2BVTA 2UZIH 1N5YH 4M00A 4Z0BH 2DMCA 5JA9A 1OVZA 3MLXL 1U8KA 5IB4B 3HS0B 4WO4B 4PLJC 4PJIB 5FHBH 2ZKHL 5HHOA 2R39A 2ICCA 3DARA 3LIZH 2H32H 4HG4K 3STLB 1JTOA 1KN4L 4XCEA 5C3TA 4G6AC 4R7NA 3MROA 2FWOA 3U4BL 3VXOB 1TVBA 3O8XA 3MYZA 3SHSA 1WZLA 3TIEB 3QDGA 4KJQD 4FA8A 5BXFA 4LP4A 4U2ZA 4PRIB 5EO1A 3LKOA 4EI5A 5MEOA 1X5HA 3OF6A 2BVUA 5EBWB 4HV8A 4QF1B 4HWEH 2F58H 2OL3A 4M61B 2Y6SD 5D70H 3QDMD 5IV2B 1LO0H 2EEDA 2EZ0D 3KYMB 4F7EB 3QQ3B 4M7LL 2VL4A 4LFHD 2XFXB 5D2NE 5CEZL 5C0AB 3MC0A 1AGCB 5DR5H 5F71A 1ZEAL 1P7KA 4QKXB 3WEXB 5DXWA 5GRYA 2CDGA 5SV3A 5E00B 2VWEE 3QWOB 3OKOA 2VKXA 2C7UA 2YD6A 5HDLA 5ALCH 2GTZA 4KI5E 2NZIA 1NGWA 1OP3H 2MCPH 1A3QA 1OPGL 1D5IL 2FGZA 5JIPA 5E7BA 2R2EA 2V5RA 4XPHH 4JKMA 3RVWC 4G42A 3FTGA 1EAJA 1TPXB 4F7PA 4QXTB 1ND0B 3KYNA 4JFFB 3QEQE 4NUGL 3NPSC 5IIEB 3TH4T 3QEGL 3RBSA 5KSVB 1TQBB 1WWBX 3EOTH 3LKQB 4I13B 2DJUA 4NHUB 5ABDE 2OR7A 1BVKB 1QBBA 5FF6B 4X6CE 4H20H 5IHZB 4XNMA 5C8JB 5GS1C 3RPKA 4X8JB 3ARUA 4HIJB 1GPOL 2IPUK 5HDQH 4LPUA 3ZDYF 4WEMB 4C83B 4N0FA 1G7QA 3DOSA 3MJGX 4KK9C 4PJHF 5GRZA 4JFOB 3TWCH 4OCSL 5KSBA 2GQHA 4K3DH 3SDYL 4F80A 5KVFL 1GGIH 5FGRA 3LEYH 2PCPA 4KQ3L 4JFDA 5IB3A 2YA0A 1A2YB 4HC1A 4QYOA 2YMXH 4R7DB 5E99H 1WITA 1MJ7H 5FOBB 3P0GB 3V95A 2LV4A 3HHRB 1DBJL 5C0CA 3FOMB 4JO1L 1U41A 1ZGLB 4O9HH 3NA9L 2HMID 3T8XB 2R9HC 5D6CB 4AEFA 4GKSB 1FZJA 1I7TA 4HIHA 4GMTL 4JQVC 3TGXA 4OLVL 4TVPE 2YC1B 3TH2T 5DVKA 2Q86A 4HWUA 1PG7X 1G7JB 3QEUB 4LLVB 3WUWB 1C5DA 2HJFA 1ZK9A 4AM0B 1IVLA 4ZFOL 3DVNB 1LEGA 1DQJA 3ZT5A 2XN9B 4TRPH 1CGUA 3GI9L 1QLRB 3L3GB 3BP7B 5KN5B 2DWDB 4MD5A 5C71A 4GBXD 4LQ1A 2CDFB 2D31A 2IBZY 2VAAA 5EU4B 2YD4A 3G6JE 1B0GA 1D5ZB 4HS8H 5F72S 3VA2C 5CEXB 1BQHG 1NAKH 3T2NL 4U1GB 2W0LA 1WZMA 2CMRL 4QRRA 5HGGS 5DHYA 3VI3F 2W07A 2WWMC 3SKNB 3EGSB 2AV7B 3QNZB 4MNGA 1JWSB 5C08A 1Y0LA 5MEPB 3IKCA 3PHOA 4H25B 3QXDA 2HFGL 4OZHF 4I0PB 2ZOLA 4ALAL 1A9EB 2EYTB 4LHUA 2DJ4A 4Y1AB 1V7MH 3BWUC 3ALPA 3MXVL 4FFVC 1PEZA 3VFVB 3RWCA 1YPZF 4HLZH 3RVXC 5GZND 3VFOA 3BEWB 3DETD 2MCG1 5JQHC 3CXDL 5BRZD 1TZHB 2A6IB 2BOBA 3QG6B 1NFDE 1QPPA 2JELL 4JR9L 1G0YR 5KS9E 3O9WD 2ZSWB 2VDPL 2I27N 5AAMA 3UX9B 3WHE1 1Q94A 4QXUL 1YDPB 1MAKA 2J3SA 3BQUC 3FFCD 4XWGH 3FQTA 3U83A 1DSFL 1CG9B 4JZNB 2XKUA 1QLEH 4D9LL 5C0DA 1RURL 4BH7A 3KDMA 5EO0A 1MHHA 4KUCF 4M7JH 5I1AA 5DURD 1I7ZB 4PJ5D 4PJCA 1OP5H 5D8JH 5HGBA 1LDSA 1IGTB 1T80A 2JTDA 3ISWA 4Z6AT 2JB5H 2HLFD 5I1LB 4XXDB 4U1LA 3AAZA 5ETUA 2J6EL 3GKZA 2DBLH 2UWEF 4J3SA 2Q6WB 5TQ2H 3MRDA 1G9ML 3NCFB 1OGAE 1EFXB 4UINH 3WMSA 1FFQA 1B4RA 1J7VR 5D1ZC 4P59L 3NACH 4QTIL 1IJ9A 1NC4B 3VRLF 1T7XA 2ADJB 4UBDD 3IJYA 2Z4QA 2H26B 4HJJH 2BC4A 5EIQA 1EBPA 4Y4KA 2PYFA 3MCKB 1HKLL 5ESQA 1TQBC 3HZVA 3ULUH 1F6FB 4KAQH 1CE1L 3E6HB 4XCYB 5DLMH 2ICWB 4Z7OE 3IETA 1F5WA 2N7BA 2EYRB 3RX7A 3QYCA 5JXEA 3PGCA 3HAEH 4OCMC 2GSIA 4PTUB 1GHFH 1AR1D 1B4JL 3S88L 4OV5A 1R3LA 3WIHL 3SDXA 4Z76A 4YHKH 5EZLB 2D03L 5FM5M 4JO2L 4ODTH 3NIDE 3QCTL 1FC2D 5E2WL 5IB5B 2WWMD 4HF5H 1D5BA 4K7FA 3LRGA 4KKNA 2CSPA 1O5DT 3T0EA 4MVBD 3SDDA 4HDIB 5HVFB 32C2B 4XCFL 4YWGH 3I6GB 1RAMA 3JWDH 3IVKA 4FFVD 1OAZL 4MD0B 4PGDA 5F88A 3LZFH 2VITB 1S7QA 3BRFA 3GSWA 4OIBA 3RY5A 3GSUA 5IJKA 3ZKQD 2D0GA 4KROD 1NMCC 2CLRB 1ZHLA 5I17B 5LVEA 2Q8AL 2BP3A 1S7VA 3DROA 1NGQH 5IFAH 4KK6D 3VWJD 3BQUD 1KACB 3PHQB 4YR6A 1JPTL 5SWZB 5GRWA 1QHPA 3QIWB 4YZFE 3GK8H 4EBQL 2YN3A 3RUGF 1U8QA 2HT3C 4PRIE 5HDOA 4UB0H 1MHEA 4MA1B 5I8CA 1TZIB 4U1GC 1LO5B 2PR4L 1Y18A 4XMPH 3OL2A 2DIJA 1ZXQA 2VDNL 3C6LD 4P2RD 3OKYA 5HHVL 3NZHH 1WICA 1TETL 5IGXH 5IMKA 5C0AE 2XI9A 4FQJL 4PB9L 1AGFB 1PJ9A 1NL0L 5D1ZD 4JPKH 3SGJC 2DQCL 5HGDB 4KWUA 5KZCD 4TULH 1T66C 3C2AL 4I0PC 1QG3A 1HXMA 1MQ8A 3SKUD 4LLDA 3RWHA 4JQXA 3KPSB 4JZJA 5FAAA 4V2CB 4D3CL 4JFHE 5LBSH 1F8TL 4OQ1A 4JFFE 1AQDB 5F3BA 3X3FH 5I1GH 2XRAL 4IRZL 2EDYA 1N0XL 4HUXA 3VJ6A 1N59A 5J6HB 1J05A 3MZGB 4X7DC 5D7LD 1RK1A 4HFWB 4BZ1H 1KEML 2IFGA 3V0VA 1JF1B 1OARL 2B4CH 2YK1H 4TSBH 2DLFL 5F7EL 5EU3B 1EA9C 2JB6B 4X6DB 2WSKA 4YFDB 1I9EA 4ELMB 1GGYA 5IVZB 1ZA6B 2PO6A 3IS1X 3R1GH 3O6FD 4WFGE 1E0OB 3OR6A 3O6LL 4PLKD 1G9EA 2GCYB 3GJFH 3PWPD 3QRGL 3TN0D 1RIHH 1W0VB 5LWYL 5H2BA 4ZSOB 5EU7E 5H37H 1IBGL 3VRIB 1F58L 1CXKA 4P57B 4PJ8A 2GK0A 4P46A 4IRJB 5FA4A 2FYYB 5AWNL 1KPRA 2FO4B 4WHTA 4L8SA 1N5YL 1SBSH 1T0NB 4P2QB 3UZEA 2J8HA 2Y07H 2FJHB 5CGTA 5CGMA 4QHUB 3X14A 5D5MF 1C7TA 4PJ9B 3SE3C 3O3EB 4FXGA 1JK8A 2X4RA 3ARGD 4NKMA 2IALB 2NXYB 3U1SL 5FHBL 4BSJA 2CIKB 2AXHA 4PUBH 1G7LA 7CGTA 3O45A 3VI4E 2DRUA 5I16B 2WWKT 4XP6H 1XCTB 3U4AA 5C7XL 2VUYA 4HJGB 2EEBA 2Q7YB 5EOQH 2EIZA 1CIUA 2F54D 3MA7A 1T1WB 3QIUA 5CSGA 1T83C 1UQSA 4HWEL 5ID0A 5DMKB 2OX5A 3O2WH 4WUKH 2I9LB 5JTWA 1KJ2A 5FB8A 2JCCB 5I0DA 3PL6D 1A3LH 3WNPA 3IDUA 1WTLA 1MFEH 3C60B 4JLRA 4P5TA 1CLZH 2EDJA 1Z5LB 1RJLB 2DQIL 4EUPB 4XRCB 1S78D 2YPLE 4JAMB 2YHGA 1NMAL 4G9FB 4JHAL 1EJOL 4WJ5B 1X5IA 5F1IB 3BRDA 3TA3B 1IGJB 1QRNA 2P1YA 1RZGA 2ITDB 4K7PL 1A3RH 5FYJE 1DBAL 3U0PB 3MRCB 2FGWL 1XF3B 3D3VE 5HPMB 2R2HB 4JFZH 4MAUH 4GMSH 3CCHA 1MJ8L 5MENB 2EIBA 4HG4J 3U9PH 4QRQB 5HGHA 2DIAA 2FSEB 3CDGB 4NQED 3BHBB 2NY0B 3EOBB 1I9JH 3MFGB 1JNHA 4WTZA 3L1OH 2NY1D 4K9EC 4MA8L 4MA1C 1SQ2N 2CDEA 4CADA 3VDBA 3MV7E 4UI2A 5E6YA 3L9RA 4P3CH 3TO4A 5HDQL 3RIAF 1KELH 4KKLC 3FZUD 2FZ3A 3WNMA 4L4VB 5L88H 3MUZ1 3TWCL 1MREL 3GDBA 5JQ6L 3OR7A 4L8BA 2HAZA 4X6BA 1N7MH 3LKNB 1NCDL 3HG1A 1SBBA 4CGTA 4I2XA 3FONA 4GQ9L 2CLZB 5DJYA 5C2UB 1GIGL 2P5WB 5E99L 8FABB 1NMBL 1MI5A 3MUHL 4V1DA 3T4YA 3BAEH 3D1MC 5FGBC 1CD1B 3LB6D 1BLNB 4PP2A 2NW3B 2VXTL 4ZDHB 5JZ7C 3D39B 2H2SC 3KJ4C 4F33B 1FE8L 1F2QA 3QFJD 1J5OL 4OSUL 1XH3B 5F89A 5TGBA 1FDLH 2ATKA 5JW5B 5IVXF 1T20A 1WBZB 3EDKA 1N26A 1RU9L 3KNBA 3TJEL 3TJHD 1ZV5A 3ULUD 2OL3L 2PYED 2V9QA 5DD6B 2XTJC 4HBCH 2VSDA 3S37L 4NN5C 5GS0C 2A1WL 3P9LA 4KKCC 1MWAB 3NFNB 5EUOB 4XPBH 3UTPE 1TVHA 1R3HB 2ZUVA 3CIQA 3KJ6L 3D18A 4Y4FD 1BVLB 1IGMH 3DXAB 1D9KD 5DYOA 4JANB 5IB2A 4U7SA 5EZJB 3B6SB 3MLRL 5DUMH 3UCRA 5T1DH 2CUHA 3X13A 4KY1H 1J1PH 5BOPA 2R1XA 4DUVA 2EH7L 1BJ8A 3HZYA 1LWRA 1NCWL 1FPTL 4DVBB 3MUGB 2YRZA 3FT4B 4YGVB 4HUWA 4OGYL 4IRJC 1AY1H 3GUTB 4S2SB 5F9OH 4KH2A 4KDWA 1VFAB 1A8JH 4FQHA 4GAGH 3QPQD 4IMLB 5CJ5A 2R0WL 4DUWA 5EOTA 2V2TA 4XCNA 2R29H 4YNYB 3OJMB 5D2LE 3VW3L 3PWLB 5LQBL 4LCYB 3D85A 2IJ0C 4OQTH 1BAFH 1RZIA 1FYHB 4I4WB 4LPVA 5I30H 2HG5B 4JHBA 1V7NL 3WLWC 3VFNB 2B1HH 5BCAA 4ODBD 1YPZB 3REWB 5AYUH 4KKBD 1TJIH 1IEBB 1JGVH 1IZKA 5KVGH 3FO1B 2YD5A 3HI1B 1TLKA 1HHKA 1DUZA 1LP9F 3CJJA 4I0KA 4R2GD 4ODHH 4TNVK 5SWZE 3CMOH 4MB3A 4KKLD 1I3GH 2NY5C 1TTUA 4R0LA 5D6DC 1MRCH 4PJFB 1B9ZA 2QHRL 5DD0H 3LDBB 5DJ2A 1FFOA 1LEKA 4HC1L 4JQIH 3V6OC 4FZEH 3C09B 4KVNH 4FABH 3QH3A 2AI0L 3FT2A 1EEZA 4OF0A 1QLEL 3DGGB 3RWEA 5CD3A 5JIIA 1ITBB 4EUPG 2YN5A 3C60C 4LNRB 5DJCA 5GRJL 5F7YC 2BNRB 1S9XA 4QOKA 5IHBA 5BV7L 4BQ9A 4UOW0 4RFOL 5JZ7D 3TA3C 2NY6D 2ESVB 2DBLL 3H3KA 4U1JB 5A2JH 3ZYJA 1KIPB 1X5AA 3B9DA 5F7HA 5A3ID 4NWTH 1I8MA 3DX6A 2RCSH 3MRGA 2C9AA 2XTJD 4HJJL 4WDIA 4WGVB 1HQRB 1HZHH 1J9CT 3Q3GA 3N1FC 2A83B 5GGTA 3VG9C 5EU6E 3RY4A 3W9DA 4KAQL 4QT5B 6FABL 4OKVB 3MRHB 1B2WH 4F57H 3ZE2E 4CMMA 4BYHA 2X4SB 1MH5A 4I8DA 5I1CH 2XA3A 5HYJD 1E4KC 3GMMA 1YMMA 1WV7T 3H42L 1T2QH 1I1CA 3BKJH 4POZC 4LKXB 5ERWA 1TENA 1O7SA 3B9EA 4H0HB 1FBIH 1P7QB 4Z7WB 3QDJE 4ZS7L 4AMKH 4X4YA 3NCYP 1AP2B 5FYLL 1OF2A 3LKPA 2R23A 2AJVH 3E2HB 5C9JA 4KV5F 2A9MH 5EBMB 1RUMH 1ORQA 1FP5A 3NAAL 4K94L 3SY0B 4S1DC 4HCRH 2HRLA 4CDGC 3RZCD 2VDOL 3PNWA 5A16B 5GSRA 4PIRF 4OCLC 2B39A 4NM8L 2X4TB 5C07B 3ULSA 3WLWD 2R69L 1RUQL 4R8WH 1G6RB 3SGEI 5B8CA 1ZLSH 4UTBL 5HHMD 1H3TA 1O7VA 5M7QA 1T5XA 3HPLB 4LCWD 3B2VL 1IAOB 3MUJA 1NEZB 2XWJA 3DHJA 3T2QA 2I9TB 4MDJB 3JUZA 2OTUB 3MJ7A 5JW4R 4L4JA 5J12B 1FN4B 4ZUSB 3G5YA 2VZ3A 3GSXA 5DJDB 3L3OB 5KVEH 2BSTA 1UVQB 2P5EE 5ITFA 3JUYA 5GIRA 1AXTH 5EPMA 3IYLW 4N8CH 3RUGB 5CHNB 1ZHBA 1XMWA 5C0EB 3TBYA 1WZ1L 4BQCA 1FNSH 5GS1A 1AC0A 3D25B 4JRYB 3F7VA 4YPJA 2DLEA 4X0KA 5FA3A 4WEBH 1MFBL 4BQBA 3VMOA 4RFNB 2JCCE 4PPTA 3O9WA 3DWTA 5DQ9A 3R0NA 4QWWD 5ENWB 4TVPH 3VXSB 3FFCA 1AJ7L 2AJSL 3VE0A 1AKJB 1IZJA 3AGVA 4G9FE 1F4YL 3C5SB 2QQLH 1FFNA 2VLKA 4FQ2L 2BHZA 1UKQA 3AS0A 2ZOKA 5IMMB 3C8KB 3QXWA 2VDRH 2BY0A 1OLLA 2DQHL 3VRJA 2AEIT 4RMQA 3NOIA 5F96H 1CGWA 1P7HL 2Z91B 1UB5B 3VFTB 4I9WE 3M1BA 4XP1H 3RHWK 4Y8AA 4NO3A 3OKKA 1TVDA 3LQAC 4K55A 3DBXB 5BMFH 5E2VL 3OKLB 5MENE 1BPVA 3X3FL 3JXAA 3IRZA 4LLUB 1WSST 2EC9U 1CXEA 3G04B 5DZLA 2XG5A 2APXA 5FYKU 2AQ3A 5IEKB 3FKUS 3LDBC 4P4KB 2YS4A 3GMOB 4JREB 4NWUH 5HXMA 3C09C 4YXKL 1IEAA 3FCTA 2YK1L 4WI2A 5FGCE 4RQQA 1UJ3A 5IEHA 1F42A 1FL6A 5T5FL 3HUJB 4HWNA 2VZ1A 2O61A 1U3HB 2QJDA 2WIIA 5E2TL 4B7LA 3O4LD 3IRPX 1EZVY 1BP3B 4ZPVB 4YHML 4GKZA 5CS7A 4W6XB 4D9RD 3R1GL 1L7TH 2YR3A 1BQHA 1C1EH 3VD9A 3MRQA 3OXSB 1RIHL 5DK0B 2FIKB 5DJ8A 5L2JA 3FB5A 1NANH 1DEEB 3KXFB 3ZE1F 1QNZL 4M7KH 1G6VK 2ZUYA 2ID5A 1JNLH 3ZKMC 1T22A 2VISA 1Q0XL 1OAQL 5IB4A 1SBSL 5D2LF 3HS0A 3S5LB 4PJIA 1VADA 5D5MB 4WU7B 5FHAL 4PR5B 4OD1H 3KYKL 4XNXH 1VGKA 3STLA 3R8QA 4D9QD 4R26H 5J57B 1CGSH 4NKDB 4W6WB 4ZTPH 4PUBL 5EUOE 3VXOA 4JFYA 2VKWA 4IM8A 1AGDB 1HI6B 1YMHA 4XZUB 3GMQB 4FFZH 1BJMA 1MRDL 2DQDH 3CFEB 5EBWA 5EOQL 5SWSD 4QF1A 4C4KT 4MYWB 2DS4A 2EC8A 3BQUA 1BQUA 4P5MA 5HHPB 3E2HC 3BE1H 4QNPE 5IBLD 4NPYB 3KYMA 5LGJA 2XFXA 3O2WL 2D7QA 5ADOH 2YA2A 3L3DB 3MOBH 4UIMB 4QRTA 3WEXA 4A6YH 1CLZL 4E41E 3MRIB