4EVOA

Crystal structure of staphylococcal nuclease variant nviaga/e122g at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
124
Chain Sequence
b'LHKEPATLIKAIDGNTVKLMYKGQPMVFRLLLVDIPYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHGQHLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Local flexibility as a determinant of pKa values of surface ionizable groups in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 124
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4evoA00
5I9OA 3SK6A 4K5WA 2F0UA 3QB3A 5J39A 2KQ3A 4K6DA 2F0SA 4KY5A 2LKVA 4PNYA 2SNSA 4B9XA 1JOOA 5IGBA 2F0FA 4HMIA 3MEHA 1EY5A 4ID6A 4F8MA 2F0LA 1EY0A 2F0VA 5CV7A 5CV8A 2F3WA 1A3UA 1F2MA 4K14A 1JORA 1ENAA 1EY9A 2QDBA 3LX0A 1STGA 3EVQA 3E5SA 4RKBA 1A3TA 3SK8A 3D4DA 3S9WA 3DMUA 4N9PA 5C5MA 3RUZA 4YIJA 5I6YA 2EY2A 2RKSA 4DU9A 2OEOA 4HMJA 5F2DA 4IUNA 4NKLA 4K5VA 1A2TA 2SOBA 4IZ8A 4NDXA 4EVOA 1SYCA 3D6CA 3NQTA 4MIUA 3SXHA 4KV6A 4B9WA 3NXWA 5E1FA 1EYCA 3QOLA 3T13A 4K8JA 5C4HA 1RKNA 4KJOA 2EYJA 5IGFA 4F7XA 1STNA 4KY7A 1IHZA 2RDFA 1A3VA 3T16A 5I6WA 1U9RA 2F0WA 3EROA 3HZXA 4QMGA 5IGGA 1EQVA 3PMFA 1EY8A 5EKLA 5KYLA 1SYFA 3P75A 1SYEA 1NSNS 3QOJA 4N9TA 4RKLA 2PZWA 3TP6A 1F2ZA 2OF1A 3D8GA 5IGEA 3BDLA 3R3OA 5NUCA 2F0TA 2PQEA 3ITPA 5CV6A 4DFAA 3V2TA 5KRUA 3VA5A 5JOBA 1EY6A 1KABA 1TT2A 2F0JA 4G57A 4ZQ3A 4S3SA 2EYLA 2NUCA 3NHHA 3MXPA 4OL7A 4EQOA 5I9PA 4KJNA 5KEEA 3SK5A 1II3A 1EY7A 3C1FA 2EYPA 2F0NA 4ME5A 4PMCA 4TRDA 4KTAA 3C1EA 5EKKA 2EYHA 1KAAA 5KIXA 3HEJA 4PMBA 1STYA 5CV5A 2SNMA 5J1ZA 1EYDA 5C3XA 3DHQA 4IALA 4KD3A 2EY5A 4R8NA 4WORA 1TQOA 3MZ5A 1EZ6A 2F0DA 1TR5A 2F3VA 3BDCA 3OWFA 5CV9A 1AEXA 5HURA 1EY4A 1NUCA 2EYMA 1A2UA 1STHA 4ODGA 5EGTA 1SNQA 2KHSA 5J22A 3U9OA 5CR3A 2F0HA 2PW5A 4QB4A 4KD4A 2RBMA 2EYOA 5HGTA 1EYAA 1SNCA 5M9OA 2EXZA 3SR1A 4K5XA 2F0GA 3TP7A 5CGKA 2PZUA 3SHLA 2F0QA 5IOCA 5IODA 5C4ZA 2M00A 1F2YA 5CV4A 1EZ8A 2EYFA 4KHVA 3OMGA 3TP8A 4K2KA 4WRDA 3NP8A 3ERQA 5K5PA 4NP5A 3NK9A 2F0MA 1SYGA 2PZTA 2HQEA 4KY6A 5IIFA 1STAA 2F0EA 5C6AA 1JOKA 5E3FA 2O4XA 4DF7A 4DGZA 5CC4A 4J1MA 4QF4A 4ZUIA 4K2LA 1KDAA 5ISRA 2PYKA 1KDCA 5DAUA 3H6MA 4LAAA 5JAVA 1JOQA 4H7BA 1SYDA 5KGUA 4HTHA 2F0KA 5DEHA 2EY6A 3SK4A 3MHBA 1ENCA 2ENBA 4I65A 5IGCA 5KYIA 2PW7A 3TMEA 4EQNA 1KDBA 1SYBA 1SNDA 2F0OA 2F0IA 5C3WA 3D4WA 3MVVA 3OMCA 4J6HA 5IGDA 1SNMA 3NUCA 3EJIA 2WACA 3TP5A 4EQPA 2OXPA 4ZUJA 3P1HA 1STBA 1SNPA 5C5LA 2F0PA 4K8IA 1SNOA 3OSOA 4NMZA 4E6IA 2EY1A
chains in the Genus database with same CATH superfamily
1AE2A 2F0UA 3I4MG 1JJCB 1VQGA 1WD1A 4J8QA 2IHEA 3K0YA 4KY5A 3QJYA 4B9XA 3D3RA 2F0FA 4JW0A 3OIPA 2A73B 2E76C 4A3FH 5IY0A 4HCSA 5DM73 4Y7NH 3V05A 1I4HA 4CDCC 1M8AA 4CBVA 4DR2L 4FYDA 3UE1A 2J0TD 3GTKB 1RTNA 4GLXA 2UUBL 3A56A 4LF9L 2JA8B 3S17H 1KXLA 4C2MB 2NZHA 3BZCA 3QOLA 3MAQA 1QUQA 1ZEQX 1A3VA 4BBSH 1SDFA 3BVMA 1DYQA 4CDEC 1NSNS 1A62A 1TWCH 1H9RA 1G51A 1WTRA 3H09A 4R4QA 2E2HB 4XQQA 4DFAA 2JK8A 1PTOD 3M9BA 2H1EA 1ZXTA 2NUCA 4OWXB 2UUAQ 1PH8A 4JBJA 3AU7A 2B63G 3PO2G 3Q23A 3T1HL 1EYDA 4KD3A 4R8NA 2F0DA 2DY7A 2K05A 1A2UA 2UU9Q 2FMMA 4PG3A 4C1NI 5DNFA 1CKNA 4QB4A 1HNXL 3TP7A 1U4LA 2J4XA 5IODA 1Y1WG 5C0XI 1ILPA 1YNJC 4OWWB 3MFGA 2R93H 2JEBI 1L1OA 5K5PA 4PV1C 5EKIA 3U58A 2R92H 1U0LA 2O4XA 2WFWA 3MC0B 1TWHH 3HKZE 4UAIA 3L2PA 1DONA 1CUKA 1SLJA 3RLOA 5JAVA 3ZYYX 1JOQA 2EXDA 3E0JA 5CBEE 3S1MH 4JBWA 1N33L 1EFWA 1EL0A 1G8ZD 1SNDA 3OMCA 2MP1A 4RGTA 4DR2Q 3CD6A 4R4OA 1SFOB 5M5WH 3P1HA 2GN5A 2UUBQ 4IQZA 4LF9Q 1S5ED 2VXWA 3TRZA 1VQ8A 1J6QA 1DOLA 1EIYB 1NMGA 1TS2A 4K5WA 1I4QA 3GV3A 2KQ3A 2VUMG 3JAMc 2KVMA 1N9WA 4ID6A 5C0XH 1FD7D 5M5YB 4A3BH 2WKDA 1LLRD 3ONAB 5ELNA 1MSGA 2X6LA 5G3LF 2IJ0A 4EX5A 1VQCA 3WOFA 4XTCS 1S40A 4JK1C 2MFIA 4ZKBB 1B3AA 2BH2A 4GKKL 4GN5A 4NKLA 1PH4A 2L0CA 3GTJH 1AZQA 2Z6BA 5KNDA 4QCLA 1OXUA 3FPUB 4OELB 4XT1B 5E1FA 1RKNA 4HJ9A 4X66L 3T1HQ 3JAMi 3VYUA 1SMXA 2K04A 2DNEA 3BG3A 2F0WA 3EROA 4A3FB 1D8LA 2JA7G 4Y7NB 3RNUA 2D0PA 3P75A 2UXBL 3KUPA 4RKLA 1CM9A 5CBAE 1F2ZA 5D14A 4LF5L 2JN4A 3U9SA 1I94L 2ZM6L 4MNOA 1VQOA 3RLNA 1HNXQ 4F87A 2IPKD 1BUVT 2RDHA 5C4XH 3BYYB 3CU7A 2RQXA 4LFAL 5IYBG 4BBSB 1P16A 4ULLA 4DV3L 3K5MA 3HOUB 2B2TC 3HS0C 1IL8A 3HOYG 1TWCB 4GS3A 1UNSA 5JJLA 2F3VA 3K5NA 2B2UA 1FNVA 1AZPA 2Z6KA 4RMFA 3FKIG 2UXCL 2F0GA 4FXGC 1UE5A 3NTKA 3R2TA 2IX0A 4A3KH 2JP1A 2G9DA 1CKMA 1QJOA 3SE0A 4G7ZC 3EFXD 1JOKA 2JQOA 3DLLA 4V190 1Q12A 1S4ZA 2O2LD 1BF4A 4C3JG 5FO7B 2XVSA 4YCUA 3J81L 2K7VA 3BU2A 3WDNA 4PZ8A 2EDGA 3RN5A 5C44H 2R93B 4HJ8A 4BXXH 2R92B 2WACA 4GKKQ 3AQQA 2D2CC 4NXML 4JOIA 1TWHB 4LUZA 1FL0A 1YBYA 4ILWA 1IZ6A 4OGQC 4C3IH 1TWFH 4V0BA 5GADC 1BNZA 4X66Q 3F2DA 1GHJA 4HMIA 3MEHA 3S1MB 4F8MA 2F0LA 1JWUD 3CW2C 1SMYC 1A3UA 1KNEA 1X3PA 3CHBD 2UXBQ 4GN4B 1DJRD 1YITA 3D4DA 4IN3A 4LF5Q 2YTXA 5M5WB 1KRTA 2A6HC 5I6YA 4LFBL 1CTMA 5LL6X 5H1SE 4DKAC 2L4NA 3NSWA 4NDXA 4EVOA 1SYCA 1K3RA 4LFAQ 4B9WA 3F1ZA 4KJOA 5JVG3 4A3BB 5I6WA 1JMCA 3UI2A 3AB9A 1W6JA 1LYLA 2PZWA 1H9SB 1O7YA 4WJ4A 1X6OA 3R3OA 4B3SQ 1Q86C 2EVBA 2I5HA 2PQEA 2MJ8A 3GTJB 1JE5A 5BN4A 1VF7A 4ZQ3A 5FOBB 1MD2D 2KBNA 2DNCA 2FMCA 2UUCL 3G71A 1CFMA 4LMQD 1LO5D 3D0FA 4KTAA 2A6EC 2VNUD 4P75A 4IALA 1WOCA 1HPCA 2A5HA 1Q7YC 3MZ5A 3I4NH 3OWFA 5EBDA 1LTRD 1SNQA 1B50A 3W1GA 4XYQA 1YVCA 1HRJA 1QVCA 3HOZG 2R7ZB 1VCIA 2HT1A 2F0QA 2O5IC 4QY7A 3K6OA 2KEEA 3KLSX 4QUFA 2ZTEA 5C4XG 4K2KA 3NP8A 1PH9A 3PUXA 4NXMQ 1SYGA 1IBLL 3CCSA 4QGUA 1N36L 1K3BC 4WJ3M 4CDFC 4DNRB 4QF4A 3NPPA 2PYKA 1L1OC 2EJFC 1C0AA 1PTOF 5HGQA 4BY1G 4H7BA 1G91A 4HIMA 5A35A 2I46A 2RCFA 5KYIA 3TMEA 1A15A 2ASBA 4A3KB 5IGDA 2KHJA 2N78A 3MVVA 4KKTA 2B2WC 3NENA 4LFBQ 2K4KA 4RCNA 2LSSA 2K6AA 3T4AC 3OSOA 1YJWA 3T53B 1SBBB 1F2LA 2BE5D 1JB7A 1FGBD 1ICFB 5IGBA 1S5FD 2QF7A 1JC7A 4NXNL 5C44B 1RF2D 3SK8A 2QDBA 2CW0D 1WCMH 4YCWA 2B2YA 3I4LA 4DUZL 2XRSD 1M1KC 3M3YH 4YCVA 1UEBA 4A3DH 4A76A 4C3IB 2XN9C 1TWFB 3X3NA 2EZVA 1ONLA 5FO8B 4CGYB 1Q46A 2UUCQ 2WAQG 2FINB 2A68D 5ELFA 3TS2A 1GUWA 3FP9A 1F9QA 4DV6L 3FRPB 5AFWA 2QGQA 1JWMD 4GNXB 2L9HA 1I5FA 1UAPA 4KN7C 5IGEA 3DUZA 1L0WA 3I4OA 3PUVA 4DR4Q 2F0TA 3K0XA 4R4TA 3V2TA 3RZOH 5ELCA 3VA5A 1KABA 4IPGA 3HOVG 4I7ZC 1V8QA 5BN3A 3CP0A 3TQYA 1EY7A 4YY3L 2LXJA 1GM5A 3VR2A 2VS1A 1IBLQ 3V96A 4DN4M 1N36Q 5C3XA 4CJ0B 2D62A 1K28A 4KHPL 1HZ9A 3R8BA 4WJWA 5EQ0A 3ND9A 1QZGA 1IL2A 2JA6G 2JA5H 1PRTC 3ULPA 4JPBW 5COYA 1SNCA 5M9OA 4DV7L 3GP7A 5IP9H 1OXVA 3SHLA 2DUDA 3Q8DA 4LWCA 2L5TA 5IE8A 5C4ZA 1J8IA 1F2YA 1D2BA 2EYFA 2Z6KC 2WP8J 1M90C 1LTBD 3I4NB 3R93A 3M7NA 3T1YL 2IL8A 5CC4A 1EIHA 1HXYD 2HCCA 2K32A 2JA9A 2KECA 5C3EG 3PQIA 2JEAI 2F0KA 3I7FA 4LW1A 1ENCA 2ENBA 2LY7A 2PW7A 2VQFL 1JWSD 4X6AH 2E74C 3PIOA 1LV9A 4DUZQ 2PCFB 2D5DA 5M3MH 3CCEA 5FJ8H 4NMZA 4A3LH 5I9OA 4GLAC 3PGZA 1VQMA 3HOXG 3JAML 4RHSA 2E8GA 4JOIC 4A3MG 4IJHA 4DV6Q 2JYOA 1VQ5A 4JYAL 4A3CH 3PV0A 2QILA 2SDFA 4R8IA 1EY9A 2AWNA 3G4SA 4A3GG 4HSPA 5FK9C 3CRKC 1Y8PB 1S5DD 1VQFA 1ZYRC 1KLGD 2EY2A 3CPWA 4M1UB 5J3BA 4H13C 1A2TA 2B8FA 1FNUA 5GAHC 1PFNA 1LACA 2ZT9C 4P71A 5E4XA 5IP7H 4MIUA 4KHZA 4YY3Q 1QUQB 3STBD 5FLXL 1I6VC 3JAME 1C7YA 5HY6A 4F7XA 3ICEA 2JXMB 4HAEA 3S16H 4OEMB 4C2MH 4R9WA 4KHPQ 4JC0A 1VQPA 1WCMB 2I5MX 4MHEA 1X3EA 2FFKB 2C35B 2N49A 5IYCG 3ITPA 3GTOH 2QEXA 4A3DB 2CQOA 2VY3A 1PTOH 4HSVA 1YJ9A 3H0GB 5I2YA 1FR3A 3LWUA 3MXPA 3GD7A 4DAPA 1NMFA 3I91A 3SK5A 2K5HA 1HTLD 3K5OA 3LWEA 4JG2A 5ELOA 3DM1A 4IOCA 3T1YQ 1EOVA 1LM0A 2ALYB 3HKSA 3PO3G 1EZ6A 2NZ1D 4DV4L 1NUCA 3RZOB 4Q0FA 3Q24A 4DR7L 1HA6A 4GNXA 4FXDA 3R2IA 2SEBD 2VQFQ 1B2TA 2M2LA 1W3SA 4TQUS 1HJPA 1I6HB 3TSSA 2QW7A 1Q90A 1VQNA 4OO1I 3HGBA 4DV0Q 3HOWB 3NK9A 2F0MA 2VZAA 3L9AX 4ZYSA 2Q2IA 4IFDJ 1CK1A 3RD4A 2CWAA 4J1MA 2B2VC 4B3RQ 2JA5B 4DK6C 2X69A 1SYDA 2R3ZA 4JYAQ 4TVAB 3I73A 1ESRA 1NAPA 3CCLA 1EEFD 4R1JA 2B3GA 4DR1L 4CJ1B 1YNNC 2BOSA 1PH2A 4ZUJA 1BDOA 1B9NA 2MQHA 1EQQA 3W1BA 5KNBA 4DR3L 1HZBA 4RCOA 3M4QA 3B6YA 4C56C 1QZHA 1RTOA 4X3UA 4JI3L 3UDGA 3FMCA 4UDUC 5LHY1 5CV8A 1DD2A 4U68A 3W5OA 4C3HH 4OO1H 4DK1A 1A6XA 2F4VL 1IW7C 1IBKQ 5M3MB 1K8AC 3KLRA 1UWVA 2HQLA 4RGMA 1O7LA 1XTCD 1N34L 2CCZA 2SOBA 4IZ8A 4K0KL 1TY0A 1K8GA 1IXRA 2HHHL 1VDZA 4DV5Q 1Y14B 3K7UC 4GOPA 3MXUA 3KJOA 4DV4Q 2G5DA 2LMCB 5NUCA 4DR7Q 2WB1E 4MN3A 4HJAA 1I4RA 5JOBA 4G57A 3K81C 4ABNA 5EJWA 3EBEA 3C1FA 3S16B 5EKKA 3L0OA 1HQRD 5KIXA 2RSNA 1WVLA 3BVZA 2JA8G 1VQLA 2YU9H 1TR5A 3A8KE 3BJUA 2GA4B 3KF8B 4TSSA 3GTOB 3HOUH 2F3IA 1PTOB 3U9OA 2F0HA 1O7ZA 4X3SA 3ER0A 1HNZQ 1GO3E 5CGKA 5IOCA 4G7OC 5CV4A 5ELEA 1KQSA 2AKWB 4H44C 3FEWX 1NBWA 3CPFA 4A75A 4DR3Q 2RCNA 3OHXC 2TMPA 5ISRA 3QR8A 3J7AF 2Z4HA 3QWNA 4JI3Q 1SJED 1BCPD 2XWBB 2Q8RE 3DXJC 3SK4A 4P74A 2F4VQ 3EN2A 1BR9A 2RVLA 3QG1A 1IBML 2ID0A 3NUCA 2BDNA 4FF3A 3GTMH 2KEDA 1N34Q 2L12A 3S1QB 3NWSA 4B3ML 3U4ZA 4E6IA 1VQKA 4K0KQ 2I07B 2L11A 3QB3A 1B44D 4DXFA 1I50B 2NVQH 4LF6L 2QCPX 4YWKA 2E5LL 2H4OA 1EY0A 2QEJC 3HG9A 5FLMH 1Z47A 4CJ2C 3MWYW 4FNFA 2WB1B 3LX0A 3H15A 1SE4A 4RKBA 1AFPA 3E9HA 2ES2A 1GHKA 1Y8NB 4FF1A 1VQDA 1XTDA 2P5ZX 4QIWE 5EBCA 4GN3B 2AQ2B 3C3LA 1NY4A 1W2BA 3D6CA 3SXHA 4LF8L 1EYCA 4AIMA 1DGSA 2AMCB 3T13A 4PZ7A 4KY7A 1IHZA 2A19A 1WI5A 4C3HB 2ZTDA 4EGVA 3PMFA 1EY8A 4A3EB 1PH7A 3MA2B 1SYEA 3HRZC 3TP6A 3T56B 1K73C 3OTOL 1PH1A 4L6TB 1GOZA 5IT9c 2RA4A 2FJ2A 1WTWA 3IFTA 4NW2A 1J5EL 5KEEA 5ELDA 2K1BA 2VW9A 5GROA 4ME5A 4PMCA 1E1OA 4FXKC 1AE3A 3KBXA 1KHIA 1YIJA 5FLXc 3VDYA 1EY4A 4A93H 3I70A 3KLWA 5CR3A 1A8VA 4OIJA 1MIUA 1RCVD 1Q3LA 1PXUA 4OHJA 4A3FG 1VQIA 4A3IH 3OW2A 4IUTA 4X64L 4IJLA 2H5XA 2Y0SB 2R7ZH 4HR7B 1B70B 1SE2A 2DGYA 2YU9B 5JJKA 5D65A 1Y1VB 4X3KA 4GLVB 4LNQA 3S1RH 2A69C 1BBUA 4LF6Q 2IT1A 1TXYA 4BBSG 3SGIA 2E5LQ 4IO9A 4IFDI 1PZKD 1I4PA 3NWTA 1HUMA 5E7NA 3HOUG 2CKZB 3HKZG 1BKBA 3KF8A 5K36H 2GVBA 5DEHA 4ZKCB 5C3WA 1KLUD 1N33Q 4QIWB 4JV5L 1SNPA 5JEAJ 2L15A 4LF8Q 5EAYA 4IPCA 4A4IA 3LGJA 4FVMA 4GKJL 3N6RA 1BXTA 1EEID 1C48A 1B4OA 1P8LA 3IAYA 4K14A 3IKJA 1J9OA 1FJGL 3GTMB 2FHTA 1BVSA 1JJ2A 1B8AA 2LFNA 2KOLA 2J7ZA 5A2QL 1N8RC 2O5JC 3MEFA 1IKMA 2HCIA 2NVQB 1EQRA 1J5EQ 4B3TL 4IFDH 1HUNA 2R93G 2E2DC 1CSQA 3DEPA 1CHQD 2R92G 1RODA 3CCJA 3CAMA 5JVH3 4LF7L 3QOJA 3J81E 5T1IA 2CVRA 1D6EC 2K5QA 3BDLA 2I0QA 1ILQA 2K14A 3ERSX 1E24A 1G2TA 1TT2A 5A2QE 3A5UA 5LMNW 1E3PA 1I94Q 2ZM6Q 1B1ZA 4X64Q 1PZID 2RSOA 3CC2A 1K8MA 1LTAD 1KAAA 1TS5A 1VQ4A 3L7ZC 4DV3Q 1XWEA 2KUMA 5LMNL 2CFMA 1X9NA 1FGUA 3ND8A 2F03A 2EYMA 1STHA 3H3VI 1C8CA 5C0XG 5J22A 4A3BG 4A3JH 3W2DA 2OWOA 1SSOA 1TWAH 5EPKA 4XQJA 1EQTA 2UXCQ 4JV5Q 3AMUA 1H95A 3AYHB 2PZTA 5I4DA 2MGSA 4A93B 4K2LA 4GKJQ 5DAUA 1R4QB 3VA7A 5AJ3L 1GKHA 4CKBA 2C5CA 4HTHA 4A3IB 1LTSD 4LF4L 4AYBE 1FJGQ 4OX9L 3CQZH 5GAGC 1E0BA 2XRQD 3EJIA 4M8AA 1JE4A 1STBA 5C5LA 3UDFA 3H3VH 2R7ZG 4JI1L 5KNCA 3S1RB 4B3TQ 2EY1A 1PA6A 1HR0W 1QNKA 1PYWD 3BS1A 1I4XA 2F0SA 3HOZB 1XPRA 1NJIC 1WTPA 1EIGA 5CV7A 2F3WA 4BWGB 2Z8LA 3DWAA 3S9WA 1VQJA 1YNJD 3KJPA 4LUOA 3VYTA 1SJHD 1TS4A 1PHJA 4ZK9B 4A3KG 1BCPF 1KIXA 2KA7A 4K8JA 2EYJA 4FP5D 1F9RA 1SE3A 1WTQA 2K33A 4BBRB 5KYLA 1D1KA 1SYFA 3I3CA 4OXPA 5CYUA 5M3FH 3F2UA 1ASYA 1U4PA 3MTSA 5LMUL 2ZXOA 3L3OC 2WV6D 3D4RA 3CC4A 2VQEL 3M4YA 1F9SA 1WTOA 5C4JB 5EPJA 5C44G 5FKAC 4BY7B 4BXXG 4S3SA 4MTNA 1X55A 2KENA 1UEAB 2QKIC 3TDQA 1T9HA 2R7FA 3F2BA 1DXMA 1KL9A 3H0GH 3HEJA 5TSSA 1MGSA 4C3IG 1HFNA 1DCZA 1TQOA 5FO9B 1AEXA 4YHHL 1N32L 5AJ3Q 1WFQA 3VR4A 1WTVA 2CQAA 4AYBB 2E2IH 3TREA 1MJCA 3SVMA 1G291 2D0OA 1VQHA 4OX9Q 1XPOA 3PF5A 4FO2A 1HZAA 1Z7TA 4IUPA 3I55A 2NVYB 2MNAA 4JI1Q 1NCVA 2IW3A 1U4RA 3S1NH 3NEMA 1I6HH 5IYDH 4CKCA 4A3JB 3HOWH 4POFA 1TWAB 1GUNA 4X3TA 2VB2X 3CCMA 1HH2P 4B08A 3M4OH 1KNAA 4EQNA 2K52A 4XT3B 4L5QA 1VMPA 2F0IA 2B2UC 1ICWA 4CDDC 3A54A 3A8IE 3TP5A 2NN6I 1ASZA 2OXPA 4RGNA 1PTOC 4JI8L 4IPDA 3CRLC 1O78A 1QG7A 3MFYA 3KLSA 1R9TB 1XNQL 5D3IB 1BOSA 2LS01 4UY8C 1X65A 3I4NG 3CQZB 1F2MA 1HNWL 1V1QA 4NXNQ 1K83H 2QDLA 5LMUQ 3CCRA 2DY8A 3J7A5 2VQEQ 3OIQA 1K0RA 1NE3A 2PI2E 5F2DA 3Q6SA 4RFBA 2OCEA 4JI7L 4DXGA 1CI3M 3NXWA 1L2FA 1S5BD 2K28A 3K80C 3DWQA 3NBHB 4BA1I 4GOPB 2NN6H 1LTLA 2KHIA 1N32Q 3G48A 3NBIA 2YV5A 4JI6L 2L55A 2IX3A 4DUYL 2AUKA 2CWPA 2K50A 5IT9L 1S5CD 5JEAH 1LTID 4EQ5A 3X3MA 5I9PA 5DM63 2XNAC 4X62L 1PH3A 2EE1A 3I4MH 3TEHB 1HZCA 1X3QA 3J80L 4L63B 2VB3X 1GUTA 5M3FB 4WORA 1SMYD 2VL6A 1RIPA 1BO0A 4POGA 3K5LA 3BDOA 3E0EA 3GTPB 1XYIA 1HCZA 2A6HD 2Z1CA 4DR6L 4ZCKA 2Q8TA 4CHTB 1R4PB 3DM3A 1WCMG 1CHPD 4DV7Q 4LFCL 2EQSA 2LXKA 4O0AA 3S2DH 1TWGH 3FDTA 2R61A 4A3DG 4JI8Q 1O7IA 3CMAA 3H0GG 5FLXE 4KY6A 4KLKA 1IKLA 2E75C 4RG1A 1VQBA 2GVAA 1XNQQ 4DGZA 4AQYL 1JB3A 3FPPA 2E2IB 2PPBC 1JICA 1HA5A 1PLFA 4BS9A 4BA2I 3MHBA 5IGCA 1HNWQ 1GUGA 2AWOA 1LTGD 2UXDL 1PFSA 1SYBA 2R6GA 2RHSB 5BN5A 2X6GA 4K6LA 1SNMA 4LK1C 4Z9CB 1EOTA 3QO2A 3S1NB 3UDIA 1B3QA 2A6ED 4WFN3 4N8X1 2F0PA 2B63H 4LUVA 3PO2H 4JI4L 1TY2A 1EIFA 1QB5D 1X3GA 1SXTA 4H02A 3EIVA 3S1QH 3UDXA 3M4OB 1GUSA 2CH4W 3HOWG 1EY5A 3J81j 4O2DA 3C2PA 3KK7A 3I8ZA 1I50H 2JE6I 1PH5A 2MUYA 2FXQA 1VQEA 1XPUA 2L1BA 4NB3A 3I2ZA 2JA5G 4UP9A 1Y1WH 1CA5A 4HIOA 4DUYQ 2CHBD 1IYJB 2YTYA 5IP9G 1G2SA 2B2TA 3M4PA 3MXNA 4H0LC 4DAVA 3M85A 2DJFC 4K5VA 2Q2UA 2B29A 2PO4A 4I7AA 4X62Q 1CZWA 2YTVA 2PMZE 1JCKB 1QE6A 1LT5D 3A55A 2BCOA 3HZXA 4QMGA 3J7YW 1K83B 1Q82C 1XNRL 4N9TA 3CCVA 4NPSA 4A3EH 1U4MA 4DR6Q 1M4VA 1GVPA 2F0JA 4EQOA 3CF5A 1PVOA 5M3MG 2B2YC 3AEVA 3KF6B 5FJ8G 4A3LG 5L37A 3ULLA 2VUMH 2Q2TA 4DV1L 1CT1D 4JI2L 3IFDA 3P20A 5HURA 2OQKA 3NBHA 3HFZB 1B7YB 2KCNA 2NN6G 5EGTA 3IL8A 2KHSA 1QVFA 4A3CG 3S24A 1HFGA 3NQIA 1UE7A 1LT3D 3SR1A 1MSHA 2UXDQ 2M00A 3I4MB 4R4CA 1EZ8A 3TP8A 4NP5A 4YWLA 5IP7G 3S14H 1A63A 3D6WA 4JI4Q 4DF7A 2QA4A 2JA7H 3GQBA 3NELA 2IHFA 1Y1VH 4HCEA 3GV6A 1YJNA 1LT6D 3K58A 1C4QA 3S2DB 1TWGB 3A74A 2HIVA 4XYOA 4EQPA 2XSCA 5IYBH 4DR1Q 1GUOA 2ZJQA 4JVZA 3CCUA 1LABA 1PRTB 2PMZB 1BCPB 1EWCA 4KKSA 3HOYH 2N88A 5IWAL 5J39A 1Y8OB 3ULJA 4PNYA 4ZAIA 5JPNC 3BVGA 1PRTD 3VYRA 1S72A 1XNRQ 3FKIH 1GXDC 1A3TA 4N9PA 1I4GA 1DOKA 5BR8L 1VQ6A 2B63B 3PO2B 1E2VA 2PI2A 1OXSC 2Y0SE 4KV6A 5C4HA 4HIDA 4IUVA 1JQYD 4C3JH 1MBYA 4RH6A 4DV1Q 4JI2Q 3G7LA 2BA1A 2HHHQ 1EWIA 1Y1WB 2NWGA 2OF1A 3PSIA 3SDZA 3KBGA 2AQ3B 4PQXA 2R7DA 3A8JE 4QJFA 3AFQA 3FVQA 4DK3C 3G6EA 1T5EA 3KOJA 3NHHA 2WB1G 1B53A 1KAWA 3K8AA 2BH8A 1H9MA 1SRUA 4JBMA 3NTIA 2BDOA 5CV5A 2SNMA 1TKWB 3DHQA 2A74C 2BE5C 2HUGA 3CCQA 3BDCA 3VR5A 2ICEC 4UPAA 4ODGA 2WINB 1SE8A 1I3QH 2B2WA 1HHVA 1QVGA 1U5KA 4KD4A 4C3HG 1ZYRD 1XMOL 3I72A 4OO1G 2EXZA 4A3EG 2F1MA 3AFPA 2CW0C 5T1GA 2OTJA 4C1NK 3D31A 3J7AV 3HP3A 3S2HH 5EPLA 1DOMA 1T5XD 2VUMB 1E2ZA 4HEDA 1PFBA 2NB0A 5IIFA 4G7HC 3KF6A 3N52A 5JJZA 5IWAQ 1KDAA 3J80c 2A68C 2WIIB 4HN7A 4LAAA 1EYGA 1X56A 1ET6A 1ZKOA 1NR2A 3K7AH 1KDBA 1SEBD 1YHBA 3QIAA 1EU3A 1K9MC 1G6PA 4J6HA 1RL2A 5BR8Q 4X65L 3S14B 4HIKA 1IBMQ 1VQ9A 4GNXC 1SNOA 2JA7B 1JT8A 2JSOA 3LNNA 2JJQA 3SK6A 3GO5A 4JI5L 5I2XA 1AW7A 4B3MQ 3J80i 3KDFB 4DNTB 2PNRC 2LKVA 2Y0SG 3GDEA 3PIP3 1V43A 4DR5L 1Y1VG 3HOZH 1Q8IA 3S17B 3RUZA 2EIFA 2OQ0A 4DU9A 2Z0SA 1D5ZC 1VQAA 3HOYB 1H9JA 3GTQH 1QNUA 3HKZB 1E1TA 3T16A 1U9RA 4BY1H 5IGGA 3FKIB 5EKLA 3RZDH 2AUJD 4B3SL 3C46A 5DLQE 4KN4C 4XDXA 5LL6S 4BBRH 1YNND 5CV6A 1XMOQ 5KRUA 2ICIA 3OTOQ 5CMDA 2XIWA 3S15H 2CH4A 1KD1C 1CSPA 1AP0A 4RAUC 2HIXA 5C4JH 5CORA 4TRDA 3C1EA 4C3JB 1PV4A 4BY7H 1FYCA 3H3VC 5J1ZA 1YI2A 4FDBA 3NTHA 2EY5A 4DV2L 3U50C 4MZ9A 4DPGA 1D5MC 1IW7D 5FLMG 3E9IA 3RLFA 2RF4A 1YHAA 2RBMA 2EYOA 4K5XA 3OW7A 1E7ZA 4GOPC 1NR4A 3OMGA 4X65Q 4WRDA 1EUJA 3J7ZC 2ZJRA 1TU2B 2F0EA 2NYZD 1V1PB 2K5DA 3DWPA 2Q8IB 5C6AA 4JI5Q 3STBC 1I3QB 1QCBD 2ATWA 1E2WA 2HDMA 1KRSA 2NVYH 1HQMC 4F88A 1SR3A 1KTKA 2RHQB 2YYZA 4DR5Q 1DZ1A 2EJMA 4I65A 2I5LX 4QQBX 1EWHA 3HOVH 3S2HB 1WTXA 4IURA 4KMUC 3TBIB 1KC8C 3RMHA 2MO0A 3H94A 1XXGA 2K5VA 1PYBA 3P7JA 3K7AB 1R9TH 4JBKA 1O80A 2JA6H 1QILA 1LUZA 1JORA 4A93G 4U673 3EVQA 1RJTA 3RN2A 1OTCA 4DAYB 1Z9FA 2NTSA 1JJGA 2RKSA 2WAQE 3PIPA 2IWHA 4A3IG 5ELBA 2V1CC 4XIGS 3GTLH 4P2CB 3NQTA 1WYDA 4LJZC 5IGFA 1STNA 5C3EH 3KDFA 1EQVA 4ME3A 4LF7Q 4DV2Q 1OXXK 2ZXPA 3E3XA 1XJVA 4DR4L 2NVTH 2ZXRA 4CKEA 1VMCA 1XX8A 5K36G 2N3SA 5C4XB 3MXGA 1LT4D 1HR0L 3GTQB 1YEZA 2EYLA 1JR0D 2B2VA 4IPHA 3K59A 1PRTF 1YNXA 2ZTCA 2OTLA 4BY1B 4IUQA 2KJXA 3HOXH 4PMBA 2KCCA 1WJJA 1H9KA 4A3MH 1Z6HA 2DJGC 3RZDB 3PIO3 3DEOA 4FF2A 3UE0A 5CV9A 1MHWC 3A7AB 5LMNQ 4A3GH 2PW5A 2K5WA 1MKHA 3K57A 3S15B 5HGTA 4KKUA 4BBRG 4JI0L 4OIKA 2PZUA 1FVIA 4AH6A 3GTPH 3PUYA 2C9OA 3U4VA 1AN8A 3E6ZX 1ML0D 2EPBA 4IFDG 4BY7G 5JPMC 2MO1A 2G9HD 2KCTA 1F9PA 1KDCA 1OXTA 2OT2A 4XXEA 2AHOB 1L0YB 4APVA 5IYCH 3CXCA 3H91A 4PZ6A 1TIID 3OWEB 1D1IA 4LF4Q 3I56A 2WAQB 3A5ZB 3D4WA 1UE1A 5E4WC 3Q0AA 1NTGA 4AYBG 3NE5B 2DN8A 3PCOB 3WWVA 4K8IA 2M9VA 1V9PA 1LTTD 2A8VA 3O13A 3PO3H 4RHRA 1IYVA 2SNSA 1V1PA 1JOOA 3PUZA 4DK0A 4P73A 2NZOA 2PNHA 2NVXH 3HOVB 1C9OA 1UE6A 1MJEA 3M7GA 4A3JG 4L5RC 2N55A 4QUCA 1FNWA 4YIJA 3BZDB 1F77A 2Z9HA 1HR0Q 3MXNB 4IUNA 4UP7A 3RR5A 3EA6A 3VYSA 4RA8A 3TZDA 2A69D 2JA6B 1VS0A 1PFMA 3T51B 4JCVE 1L0XB 4HJ5A 2PQAB 3BZKA 1PYSB 1BCPC 1H9SA 3D8GA 2K03A 3WOEA 1CA6A 4R4IA 3A0JA 1UUPA 1EY6A 2A1AA 4JI0Q 3GTLB 2NBFA 4DAYA 4KJNA 2EYPA 2F0NA 2EYHA 5C3EB 3VR6A 2KCMA 4TKOB 1STYA 4RGOS 3W3AA 5M5XH 2N8NA 2NVTB 1SN8A 3CC7A 4UP8A 5JJIA 1CKOA 4OWTB 3F8TA 1GJXA 3PUWA 1BQQT 4J15A 2D9UA 3BYTB 4YHHQ 1CZGA 5C0XJ 2V4DA 2RDGA 4IOAA 1EU4A 2K01A 3IRBA 2E2JH 4PMWA 4L5TA 2Q2HA 4DV0L 3HOXB 4ZRZA 4A3MB 3VR3A 3EQLC 5G3LD 3ERQA 1YHQA 1Q8KA 2F52A 3GTGH 4B3RL 5E3FA 1ET9A 2HDLA 4O1NA 4DAMA 1XMQL 4A3GB 3CMEA 1W6KA 3TS0A 4L5SA 1QOHA 4HJ7A 1V1OA 3J81c 2EY6A 5GAEC 5M3FG 1A0IA 4QL5A 5IT9E 1PZJD 3SEBA 1IYUA 1SROA 1NNXA 4Q5VA 1ESFA 4KI0A 1QWYA 3Q22A 1VQ7A 3GTKH 1PH6A 3KFUA 2NTTA 3J80E 2JA8H 1X32A 4K6DA 4UHVA 4IUUA 2WKCA 1WD0A 2XTIA 3CKIB 2AQ1B 2IX1A 3F2CA 5D3DA 1WTHA 2F0VA 3J81i 1TVXA 1IBKL 3M3YB 1ENAA 1STGA 3E5SA 2BA0A 3DMUA 1G6ZA 5C5MA 2MHVA 2OEOA 1HTPA 2E2HH 4HMJA 3OYYA 4FF4A 1K8OA 3OPOA 3PO3B 1PMRA 3JC66 1RD9D 2F4IA 1ENFA 1TS3A 4JI7Q 1BBWA 2B8GA 4DV5L 2RDFA 5IYDG 2NVXB 4Y52H 1GD7A 1D5XC 4DNIA 1YZ6A 1Q81C 5GQOA 1CKNB 3PF4A 1AH9A 4XQNA 1CQFA 1Q1EA 1BBXC 1D7QA 2EJGC 2ZJPA 2K75A 3A7LA 2XGTA 3KYHC 3TZUA 4JI6Q 2TSSA 3TN2A 4RWSC 1L1OB 4OL7A 1X54A 4N8FA 1E22A 1II3A 1OO9B 2HD3A 1SAPA 2XWJB 1B9MA 4OONA 4L8JA 1XMQQ 1S3OA 3G6JB 1HNZL 2EOTA 2PQAA 1EYAA 1RHPA 4ALPA 4ZLTF 3ZJYC 4KHVA 4DA2A 2UUAL 1K0SA 1VF5C 4O42A 2B39A 3OOCA 4LFCQ 5M5XB 1SFOH 2HQEA 1STAA 4ZUIA 1X3FA 4MTKA 3URYA 2Z4IA 4AQYQ 3H6MA 2MPMA 2UU9L 1MI2A 5KGUA 3FHWA 2K5NA 1PDQA 2E2JB 5M5YH 2IY5B 2F0OA 1EFID 4YWMA 1STEA 1RDPD 1DM0B 5JEAG 4GZYC 3GTGB 1Q1BA 3I90A 1CQVA 4KK7A 4G4KA 4P72A 1Y69U
chains in the Genus database with same CATH topology
2F0UA 1WD1A 4J8QA 3K0YA 4KY5A 3QJYA 4B9XA 3D3RA 2F0FA 3OIPA 2A73B 2E76C 4HCSA 5DM73 3V05A 1I4HA 1M8AA 4CBVA 4FYDA 2J0TD 3GTKB 1RTNA 3A56A 2JA8B 4C2MB 3QOLA 3MAQA 1ZEQX 1A3VA 1SDFA 3BVMA 1DYQA 1NSNS 1H9RA 1WTRA 3H09A 2E2HB 4XQQA 4DFAA 1PTOD 2H1EA 1ZXTA 2NUCA 3AU7A 3Q23A 1EYDA 4KD3A 4R8NA 2F0DA 2DY7A 2K05A 1A2UA 2FMMA 4C1NI 5DNFA 4QB4A 3TP7A 1U4LA 2J4XA 5IODA 5C0XI 1ILPA 1YNJC 3MFGA 2JEBI 5K5PA 4PV1C 5EKIA 2O4XA 3MC0B 4UAIA 1DONA 5JAVA 3ZYYX 1JOQA 3E0JA 5CBEE 4JBWA 1EL0A 1G8ZD 1SNDA 3OMCA 2MP1A 4RGTA 1SFOB 3P1HA 4IQZA 1S5ED 2VXWA 1DOLA 1TS2A 4K5WA 1I4QA 3GV3A 2KQ3A 2KVMA 4ID6A 5C0XH 1FD7D 5M5YB 2WKDA 1LLRD 3ONAB 1MSGA 2X6LA 5G3LF 2IJ0A 3WOFA 4XTCS 4JK1C 4ZKBB 1B3AA 4NKLA 2L0CA 1AZQA 5KNDA 4QCLA 1OXUA 3FPUB 4XT1B 5E1FA 1RKNA 3VYUA 3BG3A 2K04A 2DNEA 3EROA 2F0WA 4A3FB 4Y7NB 3P75A 3KUPA 4RKLA 1CM9A 5CBAE 1F2ZA 5D14A 3U9SA 4F87A 2IPKD 1BUVT 2RDHA 3BYYB 3CU7A 2RQXA 4BBSB 4ULLA 3K5MA 3HOUB 2B2TC 3HS0C 1IL8A 1TWCB 1UNSA 2F3VA 3K5NA 2B2UA 1FNVA 1AZPA 2F0GA 4FXGC 3NTKA 3R2TA 2IX0A 2JP1A 2G9DA 1QJOA 3SE0A 4G7ZC 3EFXD 1JOKA 4V190 1Q12A 1S4ZA 2O2LD 1BF4A 4C3JG 5FO7B 2XVSA 3J81L 2K7VA 3WDNA 2EDGA 2R93B 2R92B 2WACA 2D2CC 1TWHB 4ILWA 4OGQC 4V0BA 1BNZA 1GHJA 4HMIA 3MEHA 3S1MB 4F8MA 2F0LA 1JWUD 1SMYC 1A3UA 1KNEA 1X3PA 3CHBD 1DJRD 3D4DA 4IN3A 5M5WB 2A6HC 5I6YA 1CTMA 5LL6X 2L4NA 3NSWA 4NDXA 4EVOA 1SYCA 4B9WA 4KJOA 5JVG3 4A3BB 5I6WA 3UI2A 3AB9A 1W6JA 2PZWA 1H9SB 1O7YA 3R3OA 2EVBA 2PQEA 2MJ8A 3GTJB 5BN4A 1VF7A 4ZQ3A 5FOBB 1MD2D 2DNCA 2FMCA 1CFMA 4LMQD 1LO5D 4KTAA 2A6EC 2VNUD 4IALA 2A5HA 1HPCA 3MZ5A 3OWFA 5EBDA 1LTRD 1SNQA 1B50A 4XYQA 1HRJA 2R7ZB 1VCIA 2F0QA 2O5IC 3K6OA 2KEEA 3KLSX 4QUFA 4K2KA 3NP8A 3PUXA 1SYGA 4DNRB 4QF4A 3NPPA 2PYKA 2EJFC 1PTOF 4H7BA 1G91A 5A35A 2I46A 5KYIA 3TMEA 1A15A 4A3KB 5IGDA 3MVVA 4KKTA 2B2WC 4RCNA 2K6AA 3T4AC 3OSOA 3T53B 1SBBB 1F2LA 2BE5D 1FGBD 5IGBA 1S5FD 2QF7A 1JC7A 5C44B 1RF2D 3SK8A 2QDBA 2CW0D 2B2YA 3I4LA 2XRSD 4C3IB 2XN9C 1TWFB 3X3NA 2EZVA 1ONLA 5FO8B 4CGYB 2FINB 2A68D 5ELFA 1GUWA 1F9QA 3FRPB 5AFWA 1JWMD 2L9HA 1UAPA 4KN7C 5IGEA 3DUZA 3PUVA 2F0TA 3V2TA 5ELCA 3VA5A 1KABA 4I7ZC 1V8QA 5BN3A 1EY7A 3VR2A 3V96A 4DN4M 5C3XA 4CJ0B 2D62A 3R8BA 4WJWA 5EQ0A 3ND9A 1PRTC 5COYA 1SNCA 5M9OA 3GP7A 1OXVA 3SHLA 2L5TA 5C4ZA 1J8IA 1F2YA 1D2BA 2EYFA 2WP8J 1LTBD 3I4NB 3R93A 3M7NA 2IL8A 5CC4A 1EIHA 1HXYD 2HCCA 2K32A 2KECA 2JEAI 2F0KA 1ENCA 2ENBA 2LY7A 2PW7A 1JWSD 2E74C 1LV9A 2PCFB 2D5DA 4NMZA 5I9OA 3JAML 4RHSA 2JYOA 3PV0A 2QILA 2SDFA 4R8IA 1EY9A 2AWNA 4HSPA 5FK9C 3CRKC 1Y8PB 1S5DD 1ZYRC 2EY2A 1KLGD 4M1UB 4H13C 1A2TA 2B8FA 1FNUA 1PFNA 1LACA 2ZT9C 5E4XA 4MIUA 4KHZA 5FLXL 1I6VC 3JAME 4F7XA 2JXMB 4HAEA 4R9WA 1WCMB 4MHEA 2FFKB 3ITPA 4A3DB 4HSVA 1PTOH 3H0GB 5I2YA 1FR3A 3LWUA 3MXPA 3GD7A 4DAPA 3I91A 3SK5A 1HTLD 3K5OA 3LWEA 3DM1A 1EZ6A 2NZ1D 1NUCA 3RZOB 4Q0FA 3Q24A 1HA6A 4FXDA 3R2IA 2SEBD 1B2TA 2M2LA 4TQUS 1I6HB 3TSSA 1Q90A 4OO1I 3HGBA 3HOWB 3NK9A 2F0MA 3L9AX 4ZYSA 4IFDJ 1CK1A 3RD4A 4J1MA 2B2VC 2JA5B 2X69A 1SYDA 2R3ZA 3I73A 1ESRA 1NAPA 1EEFD 4CJ1B 1YNNC 2BOSA 4ZUJA 1BDOA 1B9NA 5KNBA 4RCOA 4C56C 1RTOA 4X3UA 3FMCA 4UDUC 5LHY1 5CV8A 1DD2A 4U68A 4OO1H 4DK1A 1A6XA 1IW7C 5M3MB 3KLRA 4RGMA 1O7LA 1XTCD 2SOBA 4IZ8A 1TY0A 1VDZA 3MXUA 2LMCB 5NUCA 4MN3A 1I4RA 5JOBA 4G57A 4ABNA 5EJWA 3C1FA 3S16B 5EKKA 1HQRD 5KIXA 2RSNA 1WVLA 3BVZA 1TR5A 3A8KE 2GA4B 4TSSA 3GTOB 1PTOB 3U9OA 2F0HA 1O7ZA 4X3SA 5CGKA 5IOCA 4G7OC 5CV4A 5ELEA 4H44C 3FEWX 3OHXC 2TMPA 5ISRA 3J7AF 2Z4HA 3QWNA 1SJED 1BCPD 2XWBB 2Q8RE 3DXJC 3SK4A 1BR9A 2RVLA 3QG1A 2ID0A 3NUCA 2BDNA 4FF3A 2KEDA 2L12A 3S1QB 3NWSA 4E6IA 2I07B 2L11A 3QB3A 1B44D 4DXFA 1I50B 2QCPX 2H4OA 1EY0A 2QEJC 3HG9A 1Z47A 4CJ2C 3MWYW 4FNFA 2WB1B 3LX0A 1SE4A 4RKBA 1AFPA 1GHKA 1Y8NB 4FF1A 5EBCA 2AQ2B 3C3LA 3D6CA 3SXHA 1EYCA 3T13A 4KY7A 1IHZA 4C3HB 4EGVA 3PMFA 1EY8A 4A3EB 3MA2B 1SYEA 3HRZC 3TP6A 3T56B 4L6TB 1GOZA 2RA4A 2FJ2A 1WTWA 3IFTA 4NW2A 5KEEA 5ELDA 2K1BA 4ME5A 4PMCA 4FXKC 3KBXA 1EY4A 3I70A 5CR3A 4OIJA 1RCVD 1Q3LA 1PXUA 4OHJA 4IUTA 2Y0SB 4HR7B 1SE2A 2YU9B 5D65A 1Y1VB 4X3KA 2A69C 2IT1A 4IFDI 1PZKD 1I4PA 3NWTA 1HUMA 5K36H 3KF8A 5DEHA 4ZKCB 5C3WA 1KLUD 4QIWB 1SNPA 5JEAJ 4FVMA 3N6RA 1BXTA 1EEID 1C48A 1B4OA 3IAYA 4K14A 3IKJA 1J9OA 3GTMB 2FHTA 2LFNA 2KOLA 2J7ZA 5A2QL 2O5JC 1IKMA 2HCIA 2NVQB 4IFDH 1HUNA 2E2DC 3DEPA 1CHQD 1RODA 5JVH3 3QOJA 3J81E 5T1IA 2CVRA 1D6EC 2K5QA 3BDLA 1ILQA 1G2TA 1TT2A 5A2QE 1B1ZA 1PZID 2RSOA 1K8MA 1LTAD 1KAAA 1TS5A 3L7ZC 1XWEA 2KUMA 3ND8A 2F03A 2EYMA 1STHA 1C8CA 5C0XG 5J22A 3W2DA 1SSOA 5EPKA 4XQJA 1EQTA 3AMUA 2PZTA 5I4DA 2MGSA 4A93B 4K2LA 5DAUA 1R4QB 3VA7A 4CKBA 2C5CA 4HTHA 4A3IB 1LTSD 1E0BA 2XRQD 3EJIA 4M8AA 1JE4A 1STBA 5C5LA 3S1RB 5KNCA 2EY1A 1QNKA 1PYWD 3BS1A 1I4XA 2F0SA 3HOZB 1WTPA 1EIGA 5CV7A 2F3WA 4BWGB 2Z8LA 3DWAA 3S9WA 1YNJD 3VYTA 1SJHD 1TS4A 4ZK9B 1BCPF 2KA7A 4K8JA 2EYJA 4FP5D 1F9RA 1SE3A 1WTQA 2K33A 4BBRB 5KYLA 1D1KA 1SYFA 3I3CA 5CYUA 3F2UA 1U4PA 3MTSA 2ZXOA 3L3OC 2WV6D 3D4RA 3M4YA 1F9SA 1WTOA 5C4JB 5EPJA 5FKAC 4BY7B 4S3SA 2QKIC 1UEAB 3TDQA 1DXMA 3HEJA 5TSSA 1MGSA 4C3IG 1HFNA 1DCZA 1TQOA 5FO9B 1AEXA 3VR4A 1WTVA 2CQAA 4AYBB 3SVMA 1G291 4FO2A 1Z7TA 4IUPA 2NVYB 1NCVA 2IW3A 1U4RA 4CKCA 4A3JB 1TWAB 1GUNA 4X3TA 2VB2X 4B08A 1KNAA 4EQNA 4XT3B 1VMPA 2F0IA 2B2UC 1ICWA 3A54A 3A8IE 3TP5A 2NN6I 2OXPA 4RGNA 1PTOC 3CRLC 1O78A 1QG7A 3MFYA 3KLSA 1R9TB 5D3IB 1BOSA 2LS01 3CQZB 1F2MA 2DY8A 3OIQA 5F2DA 3Q6SA 4RFBA 4DXGA 1CI3M 3NXWA 1S5BD 2K28A 3DWQA 4BA1I 2NN6H 3NBIA 2L55A 2IX3A 2AUKA 5IT9L 1S5CD 5JEAH 1LTID 3X3MA 5I9PA 5DM63 2XNAC 2EE1A 1X3QA 3J80L 4L63B 2VB3X 1GUTA 5M3FB 4WORA 1SMYD 1BO0A 3K5LA 3BDOA 3GTPB 1XYIA 1HCZA 2A6HD 2Z1CA 2Q8TA 4CHTB 1R4PB 1CHPD 3FDTA 2R61A 5FLXE 4KY6A 1IKLA 2E75C 4DGZA 1JB3A 3FPPA 2E2IB 2PPBC 1JICA 1HA5A 1PLFA 4BS9A 4BA2I 3MHBA 5IGCA 1GUGA 2AWOA 1LTGD 1SYBA 2R6GA 5BN5A 2X6GA 4K6LA 1SNMA 4LK1C 4Z9CB 1EOTA 3QO2A 3S1NB 2A6ED 4WFN3 2F0PA 1TY2A 1QB5D 1SXTA 3M4OB 1GUSA 1EY5A 3C2PA 3I8ZA 3KK7A 2JE6I 2MUYA 2L1BA 1CA5A 2CHBD 1G2SA 2B2TA 3MXNA 4H0LC 4DAVA 3M85A 4K5VA 2PO4A 1CZWA 1JCKB 1QE6A 1LT5D 3A55A 2BCOA 3HZXA 4QMGA 3J7YW 1K83B 4N9TA 1U4MA 1M4VA 2F0JA 4EQOA 2B2YC 1CT1D 3IFDA 3P20A 5HURA 3NBHA 2NN6G 2KCNA 5EGTA 3IL8A 2KHSA 1HFGA 3NQIA 1LT3D 3SR1A 1MSHA 2M00A 3I4MB 1EZ8A 3TP8A 4NP5A 3D6WA 4DF7A 3GQBA 4HCEA 3GV6A 1LT6D 3K58A 1C4QA 3S2DB 1TWGB 4XYOA 4EQPA 2XSCA 1GUOA 1LABA 1PRTB 2PMZB 1BCPB 1EWCA 4KKSA 2N88A 5J39A 1Y8OB 4PNYA 4ZAIA 5JPNC 3BVGA 1PRTD 3VYRA 1GXDC 1A3TA 4N9PA 1I4GA 1DOKA 2B63B 3PO2B 1E2VA 1OXSC 4KV6A 5C4HA 4IUVA 1JQYD 1MBYA 4RH6A 3G7LA 2BA1A 1Y1WB 2NWGA 2OF1A 3SDZA 3KBGA 2AQ3B 4PQXA 3A8JE 3FVQA 1T5EA 3NHHA 1B53A 1H9MA 3NTIA 2BDOA 5CV5A 2SNMA 1TKWB 3DHQA 2A74C 2BE5C 2HUGA 3BDCA 3VR5A 2ICEC 4ODGA 2WINB 2B2WA 1HHVA 4C3HG 4KD4A 1ZYRD 4OO1G 3I72A 2EXZA 2F1MA 2CW0C 5T1GA 4C1NK 3D31A 3J7AV 3HP3A 2VUMB 5EPLA 1DOMA 1T5XD 1E2ZA 4HEDA 1PFBA 2NB0A 5IIFA 4G7HC 5JJZA 3N52A 1KDAA 2A68C 2WIIB 4HN7A 4LAAA 1ET6A 1ZKOA 1NR2A 1KDBA 1SEBD 3QIAA 1EU3A 4J6HA 3S14B 1SNOA 2JA7B 2JSOA 3LNNA 3SK6A 3GO5A 5I2XA 1AW7A 4DNTB 2PNRC 2LKVA 3PIP3 1V43A 1Q8IA 3S17B 3RUZA 4DU9A 1D5ZC 3HOYB 1H9JA 1QNUA 3HKZB 3T16A 1U9RA 5IGGA 3FKIB 5EKLA 2AUJD 3C46A 4KN4C 4XDXA 5LL6S 1YNND 5CV6A 5KRUA 2ICIA 5CMDA 2XIWA 1AP0A 4RAUC 5CORA 4TRDA 3C1EA 4C3JB 1FYCA 3H3VC 5J1ZA 3NTHA 2EY5A 1D5MC 1IW7D 3RLFA 2RBMA 2EYOA 4K5XA 3OW7A 1NR4A 3OMGA 4WRDA 1TU2B 2F0EA 2NYZD 1V1PB 2K5DA 3DWPA 2Q8IB 5C6AA 1I3QB 1QCBD 1E2WA 2HDMA 1HQMC 4F88A 1KTKA 2YYZA 1DZ1A 2EJMA 4I65A 1EWHA 3S2HB 1WTXA 4IURA 4KMUC 3TBIB 3RMHA 3H94A 1XXGA 3P7JA 3K7AB 1O80A 1QILA 1JORA 4U673 3EVQA 1RJTA 2NTSA 2RKSA 2IWHA 5ELBA 4XIGS 4P2CB 3NQTA 4LJZC 5IGFA 1STNA 1EQVA 1OXXK 2ZXPA 2ZXRA 4CKEA 1VMCA 1XX8A 5K36G 5C4XB 3MXGA 1LT4D 3GTQB 2EYLA 1JR0D 2B2VA 3K59A 1PRTF 4BY1B 4IUQA 2KJXA 4PMBA 2KCCA 1H9KA 1Z6HA 3RZDB 3PIO3 3DEOA 4FF2A 5CV9A 3A7AB 2PW5A 2K5WA 3K57A 3S15B 5HGTA 4KKUA 4OIKA 2PZUA 3PUYA 2C9OA 1AN8A 3E6ZX 1ML0D 2EPBA 4IFDG 5JPMC 2G9HD 1F9PA 1KDCA 1OXTA 2OT2A 4XXEA 1L0YB 3H91A 1TIID 3OWEB 1D1IA 2WAQB 3D4WA 5E4WC 3Q0AA 3NE5B 2DN8A 4K8IA 2M9VA 1LTTD 3O13A 4RHRA 1IYVA 2SNSA 1V1PA 1JOOA 3PUZA 4DK0A 3HOVB 3M7GA 2N55A 4QUCA 1FNWA 4YIJA 3BZDB 1F77A 4IUNA 3EA6A 3VYSA 4RA8A 3TZDA 2A69D 2JA6B 1PFMA 3T51B 1L0XB 1BCPC 1H9SA 3D8GA 2K03A 3WOEA 1CA6A 1UUPA 1EY6A 3GTLB 2NBFA 4DAYA 4KJNA 2EYPA 2F0NA 2EYHA 5C3EB 3VR6A 4TKOB 1STYA 4RGOS 3W3AA 2NVTB 1GJXA 3PUWA 1BQQT 2D9UA 3BYTB 1CZGA 5C0XJ 2V4DA 2RDGA 1EU4A 2K01A 4PMWA 3HOXB 4ZRZA 4A3MB 3VR3A 3EQLC 5G3LD 3ERQA 5E3FA 1ET9A 2HDLA 4O1NA 4A3GB 1W6KA 1QOHA 1V1OA 2EY6A 5IT9E 1PZJD 3SEBA 1IYUA 4Q5VA 1ESFA 4KI0A 1QWYA 3Q22A 2NTTA 3J80E 1X32A 4K6DA 4IUUA 2WKCA 1WD0A 3CKIB 2AQ1B 2IX1A 5D3DA 2F0VA 1TVXA 3M3YB 1ENAA 1STGA 3E5SA 2BA0A 3DMUA 1G6ZA 5C5MA 2MHVA 2OEOA 1HTPA 4HMJA 4FF4A 1K8OA 3OPOA 3PO3B 1PMRA 1RD9D 2F4IA 1ENFA 1TS3A 2B8GA 2RDFA 2NVXB 1D5XC 4XQNA 1CQFA 1Q1EA 1BBXC 2EJGC 3A7LA 3TZUA 2TSSA 3TN2A 4RWSC 4OL7A 1II3A 1OO9B 1SAPA 2XWJB 1B9MA 4L8JA 3G6JB 2EOTA 1EYAA 1RHPA 4ZLTF 4KHVA 4DA2A 1VF5C 4O42A 2B39A 3OOCA 5M5XB 2HQEA 1STAA 4ZUIA 3URYA 2Z4IA 3H6MA 2MPMA 1MI2A 5KGUA 1PDQA 2E2JB 2F0OA 1EFID 1STEA 1RDPD 1DM0B 5JEAG 4GZYC 3GTGB 1Q1BA 3I90A 1CQVA 4KK7A 4G4KA 1Y69U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I9O A;  3SK6 A;  4K5W A;  2F0U A;  3QB3 A;  5J39 A;  2KQ3 A;  4K6D A;  2F0S A;  4KY5 A;  2LKV A;  4PNY A;  2SNS A;  4B9X A;  1JOO A;  5IGB A;  2F0F A;  4HMI A;  3MEH A;  1EY5 A;  4ID6 A;  4F8M A;  2F0L A;  1EY0 A;  2F0V A;  5CV7 A;  5CV8 A;  2F3W A;  1A3U A;  1F2M A;  4K14 A;  1JOR A;  1ENA A;  1EY9 A;  2QDB A;  3LX0 A;  1STG A;  3EVQ A;  3E5S A;  4RKB A;  1A3T A;  3SK8 A;  3D4D A;  3S9W A;  3DMU A;  4N9P A;  5C5M A;  3RUZ A;  4YIJ A;  5I6Y A;  2EY2 A;  2RKS A;  4DU9 A;  2OEO A;  4HMJ A;  5F2D A;  4IUN A;  4NKL A;  4K5V A;  1A2T A;  2SOB A;  4IZ8 A;  4NDX A;  4EVO A;  1SYC A;  3D6C A;  3NQT A;  4MIU A;  3SXH A;  4KV6 A;  4B9W A;  3NXW A;  5E1F A;  1EYC A;  3QOL A;  3T13 A;  4K8J A;  5C4H A;  1RKN A;  4KJO A;  2EYJ A;  5IGF A;  4F7X A;  1STN A;  4KY7 A;  1IHZ A;  2RDF A;  1A3V A;  3T16 A;  5I6W A;  1U9R A;  2F0W A;  3ERO A;  3HZX A;  4QMG A;  5IGG A;  1EQV A;  3PMF A;  1EY8 A;  5EKL A;  5KYL A;  1SYF A;  3P75 A;  1SYE A;  1NSN S;  3QOJ A;  4N9T A;  4RKL A;  2PZW A;  3TP6 A;  1F2Z A;  2OF1 A;  3D8G A;  5IGE A;  3BDL A;  3R3O A;  5NUC A;  2F0T A;  2PQE A;  3ITP A;  5CV6 A;  4DFA A;  3V2T A;  5KRU A;  3VA5 A;  5JOB A;  1EY6 A;  1KAB A;  1TT2 A;  2F0J A;  4G57 A;  4ZQ3 A;  4S3S A;  2EYL A;  2NUC A;  3NHH A;  3MXP A;  4OL7 A;  4EQO A;  5I9P A;  4KJN A;  5KEE A;  3SK5 A;  1II3 A;  1EY7 A;  3C1F A;  2EYP A;  2F0N A;  4ME5 A;  4PMC A;  4TRD A;  4KTA A;  3C1E A;  5EKK A;  2EYH A;  1KAA A;  5KIX A;  3HEJ A;  4PMB A;  1STY A;  5CV5 A;  2SNM A;  5J1Z A;  1EYD A;  5C3X A;  3DHQ A;  4IAL A;  4KD3 A;  2EY5 A;  4R8N A;  4WOR A;  1TQO A;  3MZ5 A;  1EZ6 A;  2F0D A;  1TR5 A;  2F3V A;  3BDC A;  3OWF A;  5CV9 A;  1AEX A;  5HUR A;  1EY4 A;  1NUC A;  2EYM A;  1A2U A;  1STH A;  4ODG A;  5EGT A;  1SNQ A;  2KHS A;  5J22 A;  3U9O A;  5CR3 A;  2F0H A;  2PW5 A;  4QB4 A;  4KD4 A;  2RBM A;  2EYO A;  5HGT A;  1EYA A;  1SNC A;  5M9O A;  2EXZ A;  3SR1 A;  4K5X A;  2F0G A;  3TP7 A;  5CGK A;  2PZU A;  3SHL A;  2F0Q A;  5IOC A;  5IOD A;  5C4Z A;  2M00 A;  1F2Y A;  5CV4 A;  1EZ8 A;  2EYF A;  4KHV A;  3OMG A;  3TP8 A;  4K2K A;  4WRD A;  3NP8 A;  3ERQ A;  5K5P A;  4NP5 A;  3NK9 A;  2F0M A;  1SYG A;  2PZT A;  2HQE A;  4KY6 A;  5IIF A;  1STA A;  2F0E A;  5C6A A;  1JOK A;  5E3F A;  2O4X A;  4DF7 A;  4DGZ A;  5CC4 A;  4J1M A;  4QF4 A;  4ZUI A;  4K2L A;  1KDA A;  5ISR A;  2PYK A;  1KDC A;  5DAU A;  3H6M A;  4LAA A;  5JAV A;  1JOQ A;  4H7B A;  1SYD A;  5KGU A;  4HTH A;  2F0K A;  5DEH A;  2EY6 A;  3SK4 A;  3MHB A;  1ENC A;  2ENB A;  4I65 A;  5IGC A;  5KYI A;  2PW7 A;  3TME A;  4EQN A;  1KDB A;  1SYB A;  1SND A;  2F0O A;  2F0I A;  5C3W A;  3D4W A;  3MVV A;  3OMC A;  4J6H A;  5IGD A;  1SNM A;  3NUC A;  3EJI A;  2WAC A;  3TP5 A;  4EQP A;  2OXP A;  4ZUJ A;  3P1H A;  1STB A;  1SNP A;  5C5L A;  2F0P A;  4K8I A;  1SNO A;  3OSO A;  4NMZ A;  4E6I A;  2EY1 A; 
#chains in the Genus database with same CATH topology
 1AE2 A;  2F0U A;  3I4M G;  1JJC B;  1VQG A;  1WD1 A;  4J8Q A;  2IHE A;  3K0Y A;  4KY5 A;  3QJY A;  4B9X A;  3D3R A;  2F0F A;  4JW0 A;  3OIP A;  2A73 B;  2E76 C;  4A3F H;  5IY0 A;  4HCS A;  5DM7 3;  4Y7N H;  3V05 A;  1I4H A;  4CDC C;  1M8A A;  4CBV A;  4DR2 L;  4FYD A;  3UE1 A;  2J0T D;  3GTK B;  1RTN A;  4GLX A;  2UUB L;  3A56 A;  4LF9 L;  2JA8 B;  3S17 H;  1KXL A;  4C2M B;  2NZH A;  3BZC A;  3QOL A;  3MAQ A;  1QUQ A;  1ZEQ X;  1A3V A;  4BBS H;  1SDF A;  3BVM A;  1DYQ A;  4CDE C;  1NSN S;  1A62 A;  1TWC H;  1H9R A;  1G51 A;  1WTR A;  3H09 A;  4R4Q A;  2E2H B;  4XQQ A;  4DFA A;  2JK8 A;  1PTO D;  3M9B A;  2H1E A;  1ZXT A;  2NUC A;  4OWX B;  2UUA Q;  1PH8 A;  4JBJ A;  3AU7 A;  2B63 G;  3PO2 G;  3Q23 A;  3T1H L;  1EYD A;  4KD3 A;  4R8N A;  2F0D A;  2DY7 A;  2K05 A;  1A2U A;  2UU9 Q;  2FMM A;  4PG3 A;  4C1N I;  5DNF A;  1CKN A;  4QB4 A;  1HNX L;  3TP7 A;  1U4L A;  2J4X A;  5IOD A;  1Y1W G;  5C0X I;  1ILP A;  1YNJ C;  4OWW B;  3MFG A;  2R93 H;  2JEB I;  1L1O A;  5K5P A;  4PV1 C;  5EKI A;  3U58 A;  2R92 H;  1U0L A;  2O4X A;  2WFW A;  3MC0 B;  1TWH H;  3HKZ E;  4UAI A;  3L2P A;  1DON A;  1CUK A;  1SLJ A;  3RLO A;  5JAV A;  3ZYY X;  1JOQ A;  2EXD A;  3E0J A;  5CBE E;  3S1M H;  4JBW A;  1N33 L;  1EFW A;  1EL0 A;  1G8Z D;  1SND A;  3OMC A;  2MP1 A;  4RGT A;  4DR2 Q;  3CD6 A;  4R4O A;  1SFO B;  5M5W H;  3P1H A;  2GN5 A;  2UUB Q;  4IQZ A;  4LF9 Q;  1S5E D;  2VXW A;  3TRZ A;  1VQ8 A;  1J6Q A;  1DOL A;  1EIY B;  1NMG A;  1TS2 A;  4K5W A;  1I4Q A;  3GV3 A;  2KQ3 A;  2VUM G;  3JAM c;  2KVM A;  1N9W A;  4ID6 A;  5C0X H;  1FD7 D;  5M5Y B;  4A3B H;  2WKD A;  1LLR D;  3ONA B;  5ELN A;  1MSG A;  2X6L A;  5G3L F;  2IJ0 A;  4EX5 A;  1VQC A;  3WOF A;  4XTC S;  1S40 A;  4JK1 C;  2MFI A;  4ZKB B;  1B3A A;  2BH2 A;  4GKK L;  4GN5 A;  4NKL A;  1PH4 A;  2L0C A;  3GTJ H;  1AZQ A;  2Z6B A;  5KND A;  4QCL A;  1OXU A;  3FPU B;  4OEL B;  4XT1 B;  5E1F A;  1RKN A;  4HJ9 A;  4X66 L;  3T1H Q;  3JAM i;  3VYU A;  1SMX A;  2K04 A;  2DNE A;  3BG3 A;  2F0W A;  3ERO A;  4A3F B;  1D8L A;  2JA7 G;  4Y7N B;  3RNU A;  2D0P A;  3P75 A;  2UXB L;  3KUP A;  4RKL A;  1CM9 A;  5CBA E;  1F2Z A;  5D14 A;  4LF5 L;  2JN4 A;  3U9S A;  1I94 L;  2ZM6 L;  4MNO A;  1VQO A;  3RLN A;  1HNX Q;  4F87 A;  2IPK D;  1BUV T;  2RDH A;  5C4X H;  3BYY B;  3CU7 A;  2RQX A;  4LFA L;  5IYB G;  4BBS B;  1P16 A;  4ULL A;  4DV3 L;  3K5M A;  3HOU B;  2B2T C;  3HS0 C;  1IL8 A;  3HOY G;  1TWC B;  4GS3 A;  1UNS A;  5JJL A;  2F3V A;  3K5N A;  2B2U A;  1FNV A;  1AZP A;  2Z6K A;  4RMF A;  3FKI G;  2UXC L;  2F0G A;  4FXG C;  1UE5 A;  3NTK A;  3R2T A;  2IX0 A;  4A3K H;  2JP1 A;  2G9D A;  1CKM A;  1QJO A;  3SE0 A;  4G7Z C;  3EFX D;  1JOK A;  2JQO A;  3DLL A;  4V19 0;  1Q12 A;  1S4Z A;  2O2L D;  1BF4 A;  4C3J G;  5FO7 B;  2XVS A;  4YCU A;  3J81 L;  2K7V A;  3BU2 A;  3WDN A;  4PZ8 A;  2EDG A;  3RN5 A;  5C44 H;  2R93 B;  4HJ8 A;  4BXX H;  2R92 B;  2WAC A;  4GKK Q;  3AQQ A;  2D2C C;  4NXM L;  4JOI A;  1TWH B;  4LUZ A;  1FL0 A;  1YBY A;  4ILW A;  1IZ6 A;  4OGQ C;  4C3I H;  1TWF H;  4V0B A;  5GAD C;  1BNZ A;  4X66 Q;  3F2D A;  1GHJ A;  4HMI A;  3MEH A;  3S1M B;  4F8M A;  2F0L A;  1JWU D;  3CW2 C;  1SMY C;  1A3U A;  1KNE A;  1X3P A;  3CHB D;  2UXB Q;  4GN4 B;  1DJR D;  1YIT A;  3D4D A;  4IN3 A;  4LF5 Q;  2YTX A;  5M5W B;  1KRT A;  2A6H C;  5I6Y A;  4LFB L;  1CTM A;  5LL6 X;  5H1S E;  4DKA C;  2L4N A;  3NSW A;  4NDX A;  4EVO A;  1SYC A;  1K3R A;  4LFA Q;  4B9W A;  3F1Z A;  4KJO A;  5JVG 3;  4A3B B;  5I6W A;  1JMC A;  3UI2 A;  3AB9 A;  1W6J A;  1LYL A;  2PZW A;  1H9S B;  1O7Y A;  4WJ4 A;  1X6O A;  3R3O A;  4B3S Q;  1Q86 C;  2EVB A;  2I5H A;  2PQE A;  2MJ8 A;  3GTJ B;  1JE5 A;  5BN4 A;  1VF7 A;  4ZQ3 A;  5FOB B;  1MD2 D;  2KBN A;  2DNC A;  2FMC A;  2UUC L;  3G71 A;  1CFM A;  4LMQ D;  1LO5 D;  3D0F A;  4KTA A;  2A6E C;  2VNU D;  4P75 A;  4IAL A;  1WOC A;  1HPC A;  2A5H A;  1Q7Y C;  3MZ5 A;  3I4N H;  3OWF A;  5EBD A;  1LTR D;  1SNQ A;  1B50 A;  3W1G A;  4XYQ A;  1YVC A;  1HRJ A;  1QVC A;  3HOZ G;  2R7Z B;  1VCI A;  2HT1 A;  2F0Q A;  2O5I C;  4QY7 A;  3K6O A;  2KEE A;  3KLS X;  4QUF A;  2ZTE A;  5C4X G;  4K2K A;  3NP8 A;  1PH9 A;  3PUX A;  4NXM Q;  1SYG A;  1IBL L;  3CCS A;  4QGU A;  1N36 L;  1K3B C;  4WJ3 M;  4CDF C;  4DNR B;  4QF4 A;  3NPP A;  2PYK A;  1L1O C;  2EJF C;  1C0A A;  1PTO F;  5HGQ A;  4BY1 G;  4H7B A;  1G91 A;  4HIM A;  5A35 A;  2I46 A;  2RCF A;  5KYI A;  3TME A;  1A15 A;  2ASB A;  4A3K B;  5IGD A;  2KHJ A;  2N78 A;  3MVV A;  4KKT A;  2B2W C;  3NEN A;  4LFB Q;  2K4K A;  4RCN A;  2LSS A;  2K6A A;  3T4A C;  3OSO A;  1YJW A;  3T53 B;  1SBB B;  1F2L A;  2BE5 D;  1JB7 A;  1FGB D;  1ICF B;  5IGB A;  1S5F D;  2QF7 A;  1JC7 A;  4NXN L;  5C44 B;  1RF2 D;  3SK8 A;  2QDB A;  2CW0 D;  1WCM H;  4YCW A;  2B2Y A;  3I4L A;  4DUZ L;  2XRS D;  1M1K C;  3M3Y H;  4YCV A;  1UEB A;  4A3D H;  4A76 A;  4C3I B;  2XN9 C;  1TWF B;  3X3N A;  2EZV A;  1ONL A;  5FO8 B;  4CGY B;  1Q46 A;  2UUC Q;  2WAQ G;  2FIN B;  2A68 D;  5ELF A;  3TS2 A;  1GUW A;  3FP9 A;  1F9Q A;  4DV6 L;  3FRP B;  5AFW A;  2QGQ A;  1JWM D;  4GNX B;  2L9H A;  1I5F A;  1UAP A;  4KN7 C;  5IGE A;  3DUZ A;  1L0W A;  3I4O A;  3PUV A;  4DR4 Q;  2F0T A;  3K0X A;  4R4T A;  3V2T A;  3RZO H;  5ELC A;  3VA5 A;  1KAB A;  4IPG A;  3HOV G;  4I7Z C;  1V8Q A;  5BN3 A;  3CP0 A;  3TQY A;  1EY7 A;  4YY3 L;  2LXJ A;  1GM5 A;  3VR2 A;  2VS1 A;  1IBL Q;  3V96 A;  4DN4 M;  1N36 Q;  5C3X A;  4CJ0 B;  2D62 A;  1K28 A;  4KHP L;  1HZ9 A;  3R8B A;  4WJW A;  5EQ0 A;  3ND9 A;  1QZG A;  1IL2 A;  2JA6 G;  2JA5 H;  1PRT C;  3ULP A;  4JPB W;  5COY A;  1SNC A;  5M9O A;  4DV7 L;  3GP7 A;  5IP9 H;  1OXV A;  3SHL A;  2DUD A;  3Q8D A;  4LWC A;  2L5T A;  5IE8 A;  5C4Z A;  1J8I A;  1F2Y A;  1D2B A;  2EYF A;  2Z6K C;  2WP8 J;  1M90 C;  1LTB D;  3I4N B;  3R93 A;  3M7N A;  3T1Y L;  2IL8 A;  5CC4 A;  1EIH A;  1HXY D;  2HCC A;  2K32 A;  2JA9 A;  2KEC A;  5C3E G;  3PQI A;  2JEA I;  2F0K A;  3I7F A;  4LW1 A;  1ENC A;  2ENB A;  2LY7 A;  2PW7 A;  2VQF L;  1JWS D;  4X6A H;  2E74 C;  3PIO A;  1LV9 A;  4DUZ Q;  2PCF B;  2D5D A;  5M3M H;  3CCE A;  5FJ8 H;  4NMZ A;  4A3L H;  5I9O A;  4GLA C;  3PGZ A;  1VQM A;  3HOX G;  3JAM L;  4RHS A;  2E8G A;  4JOI C;  4A3M G;  4IJH A;  4DV6 Q;  2JYO A;  1VQ5 A;  4JYA L;  4A3C H;  3PV0 A;  2QIL A;  2SDF A;  4R8I A;  1EY9 A;  2AWN A;  3G4S A;  4A3G G;  4HSP A;  5FK9 C;  3CRK C;  1Y8P B;  1S5D D;  1VQF A;  1ZYR C;  1KLG D;  2EY2 A;  3CPW A;  4M1U B;  5J3B A;  4H13 C;  1A2T A;  2B8F A;  1FNU A;  5GAH C;  1PFN A;  1LAC A;  2ZT9 C;  4P71 A;  5E4X A;  5IP7 H;  4MIU A;  4KHZ A;  4YY3 Q;  1QUQ B;  3STB D;  5FLX L;  1I6V C;  3JAM E;  1C7Y A;  5HY6 A;  4F7X A;  3ICE A;  2JXM B;  4HAE A;  3S16 H;  4OEM B;  4C2M H;  4R9W A;  4KHP Q;  4JC0 A;  1VQP A;  1WCM B;  2I5M X;  4MHE A;  1X3E A;  2FFK B;  2C35 B;  2N49 A;  5IYC G;  3ITP A;  3GTO H;  2QEX A;  4A3D B;  2CQO A;  2VY3 A;  1PTO H;  4HSV A;  1YJ9 A;  3H0G B;  5I2Y A;  1FR3 A;  3LWU A;  3MXP A;  3GD7 A;  4DAP A;  1NMF A;  3I91 A;  3SK5 A;  2K5H A;  1HTL D;  3K5O A;  3LWE A;  4JG2 A;  5ELO A;  3DM1 A;  4IOC A;  3T1Y Q;  1EOV A;  1LM0 A;  2ALY B;  3HKS A;  3PO3 G;  1EZ6 A;  2NZ1 D;  4DV4 L;  1NUC A;  3RZO B;  4Q0F A;  3Q24 A;  4DR7 L;  1HA6 A;  4GNX A;  4FXD A;  3R2I A;  2SEB D;  2VQF Q;  1B2T A;  2M2L A;  1W3S A;  4TQU S;  1HJP A;  1I6H B;  3TSS A;  2QW7 A;  1Q90 A;  1VQN A;  4OO1 I;  3HGB A;  4DV0 Q;  3HOW B;  3NK9 A;  2F0M A;  2VZA A;  3L9A X;  4ZYS A;  2Q2I A;  4IFD J;  1CK1 A;  3RD4 A;  2CWA A;  4J1M A;  2B2V C;  4B3R Q;  2JA5 B;  4DK6 C;  2X69 A;  1SYD A;  2R3Z A;  4JYA Q;  4TVA B;  3I73 A;  1ESR A;  1NAP A;  3CCL A;  1EEF D;  4R1J A;  2B3G A;  4DR1 L;  4CJ1 B;  1YNN C;  2BOS A;  1PH2 A;  4ZUJ A;  1BDO A;  1B9N A;  2MQH A;  1EQQ A;  3W1B A;  5KNB A;  4DR3 L;  1HZB A;  4RCO A;  3M4Q A;  3B6Y A;  4C56 C;  1QZH A;  1RTO A;  4X3U A;  4JI3 L;  3UDG A;  3FMC A;  4UDU C;  5LHY 1;  5CV8 A;  1DD2 A;  4U68 A;  3W5O A;  4C3H H;  4OO1 H;  4DK1 A;  1A6X A;  2F4V L;  1IW7 C;  1IBK Q;  5M3M B;  1K8A C;  3KLR A;  1UWV A;  2HQL A;  4RGM A;  1O7L A;  1XTC D;  1N34 L;  2CCZ A;  2SOB A;  4IZ8 A;  4K0K L;  1TY0 A;  1K8G A;  1IXR A;  2HHH L;  1VDZ A;  4DV5 Q;  1Y14 B;  3K7U C;  4GOP A;  3MXU A;  3KJO A;  4DV4 Q;  2G5D A;  2LMC B;  5NUC A;  4DR7 Q;  2WB1 E;  4MN3 A;  4HJA A;  1I4R A;  5JOB A;  4G57 A;  3K81 C;  4ABN A;  5EJW A;  3EBE A;  3C1F A;  3S16 B;  5EKK A;  3L0O A;  1HQR D;  5KIX A;  2RSN A;  1WVL A;  3BVZ A;  2JA8 G;  1VQL A;  2YU9 H;  1TR5 A;  3A8K E;  3BJU A;  2GA4 B;  3KF8 B;  4TSS A;  3GTO B;  3HOU H;  2F3I A;  1PTO B;  3U9O A;  2F0H A;  1O7Z A;  4X3S A;  3ER0 A;  1HNZ Q;  1GO3 E;  5CGK A;  5IOC A;  4G7O C;  5CV4 A;  5ELE A;  1KQS A;  2AKW B;  4H44 C;  3FEW X;  1NBW A;  3CPF A;  4A75 A;  4DR3 Q;  2RCN A;  3OHX C;  2TMP A;  5ISR A;  3QR8 A;  3J7A F;  2Z4H A;  3QWN A;  4JI3 Q;  1SJE D;  1BCP D;  2XWB B;  2Q8R E;  3DXJ C;  3SK4 A;  4P74 A;  2F4V Q;  3EN2 A;  1BR9 A;  2RVL A;  3QG1 A;  1IBM L;  2ID0 A;  3NUC A;  2BDN A;  4FF3 A;  3GTM H;  2KED A;  1N34 Q;  2L12 A;  3S1Q B;  3NWS A;  4B3M L;  3U4Z A;  4E6I A;  1VQK A;  4K0K Q;  2I07 B;  2L11 A;  3QB3 A;  1B44 D;  4DXF A;  1I50 B;  2NVQ H;  4LF6 L;  2QCP X;  4YWK A;  2E5L L;  2H4O A;  1EY0 A;  2QEJ C;  3HG9 A;  5FLM H;  1Z47 A;  4CJ2 C;  3MWY W;  4FNF A;  2WB1 B;  3LX0 A;  3H15 A;  1SE4 A;  4RKB A;  1AFP A;  3E9H A;  2ES2 A;  1GHK A;  1Y8N B;  4FF1 A;  1VQD A;  1XTD A;  2P5Z X;  4QIW E;  5EBC A;  4GN3 B;  2AQ2 B;  3C3L A;  1NY4 A;  1W2B A;  3D6C A;  3SXH A;  4LF8 L;  1EYC A;  4AIM A;  1DGS A;  2AMC B;  3T13 A;  4PZ7 A;  4KY7 A;  1IHZ A;  2A19 A;  1WI5 A;  4C3H B;  2ZTD A;  4EGV A;  3PMF A;  1EY8 A;  4A3E B;  1PH7 A;  3MA2 B;  1SYE A;  3HRZ C;  3TP6 A;  3T56 B;  1K73 C;  3OTO L;  1PH1 A;  4L6T B;  1GOZ A;  5IT9 c;  2RA4 A;  2FJ2 A;  1WTW A;  3IFT A;  4NW2 A;  1J5E L;  5KEE A;  5ELD A;  2K1B A;  2VW9 A;  5GRO A;  4ME5 A;  4PMC A;  1E1O A;  4FXK C;  1AE3 A;  3KBX A;  1KHI A;  1YIJ A;  5FLX c;  3VDY A;  1EY4 A;  4A93 H;  3I70 A;  3KLW A;  5CR3 A;  1A8V A;  4OIJ A;  1MIU A;  1RCV D;  1Q3L A;  1PXU A;  4OHJ A;  4A3F G;  1VQI A;  4A3I H;  3OW2 A;  4IUT A;  4X64 L;  4IJL A;  2H5X A;  2Y0S B;  2R7Z H;  4HR7 B;  1B70 B;  1SE2 A;  2DGY A;  2YU9 B;  5JJK A;  5D65 A;  1Y1V B;  4X3K A;  4GLV B;  4LNQ A;  3S1R H;  2A69 C;  1BBU A;  4LF6 Q;  2IT1 A;  1TXY A;  4BBS G;  3SGI A;  2E5L Q;  4IO9 A;  4IFD I;  1PZK D;  1I4P A;  3NWT A;  1HUM A;  5E7N A;  3HOU G;  2CKZ B;  3HKZ G;  1BKB A;  3KF8 A;  5K36 H;  2GVB A;  5DEH A;  4ZKC B;  5C3W A;  1KLU D;  1N33 Q;  4QIW B;  4JV5 L;  1SNP A;  5JEA J;  2L15 A;  4LF8 Q;  5EAY A;  4IPC A;  4A4I A;  3LGJ A;  4FVM A;  4GKJ L;  3N6R A;  1BXT A;  1EEI D;  1C48 A;  1B4O A;  1P8L A;  3IAY A;  4K14 A;  3IKJ A;  1J9O A;  1FJG L;  3GTM B;  2FHT A;  1BVS A;  1JJ2 A;  1B8A A;  2LFN A;  2KOL A;  2J7Z A;  5A2Q L;  1N8R C;  2O5J C;  3MEF A;  1IKM A;  2HCI A;  2NVQ B;  1EQR A;  1J5E Q;  4B3T L;  4IFD H;  1HUN A;  2R93 G;  2E2D C;  1CSQ A;  3DEP A;  1CHQ D;  2R92 G;  1ROD A;  3CCJ A;  3CAM A;  5JVH 3;  4LF7 L;  3QOJ A;  3J81 E;  5T1I A;  2CVR A;  1D6E C;  2K5Q A;  3BDL A;  2I0Q A;  1ILQ A;  2K14 A;  3ERS X;  1E24 A;  1G2T A;  1TT2 A;  5A2Q E;  3A5U A;  5LMN W;  1E3P A;  1I94 Q;  2ZM6 Q;  1B1Z A;  4X64 Q;  1PZI D;  2RSO A;  3CC2 A;  1K8M A;  1LTA D;  1KAA A;  1TS5 A;  1VQ4 A;  3L7Z C;  4DV3 Q;  1XWE A;  2KUM A;  5LMN L;  2CFM A;  1X9N A;  1FGU A;  3ND8 A;  2F03 A;  2EYM A;  1STH A;  3H3V I;  1C8C A;  5C0X G;  5J22 A;  4A3B G;  4A3J H;  3W2D A;  2OWO A;  1SSO A;  1TWA H;  5EPK A;  4XQJ A;  1EQT A;  2UXC Q;  4JV5 Q;  3AMU A;  1H95 A;  3AYH B;  2PZT A;  5I4D A;  2MGS A;  4A93 B;  4K2L A;  4GKJ Q;  5DAU A;  1R4Q B;  3VA7 A;  5AJ3 L;  1GKH A;  4CKB A;  2C5C A;  4HTH A;  4A3I B;  1LTS D;  4LF4 L;  4AYB E;  1FJG Q;  4OX9 L;  3CQZ H;  5GAG C;  1E0B A;  2XRQ D;  3EJI A;  4M8A A;  1JE4 A;  1STB A;  5C5L A;  3UDF A;  3H3V H;  2R7Z G;  4JI1 L;  5KNC A;  3S1R B;  4B3T Q;  2EY1 A;  1PA6 A;  1HR0 W;  1QNK A;  1PYW D;  3BS1 A;  1I4X A;  2F0S A;  3HOZ B;  1XPR A;  1NJI C;  1WTP A;  1EIG A;  5CV7 A;  2F3W A;  4BWG B;  2Z8L A;  3DWA A;  3S9W A;  1VQJ A;  1YNJ D;  3KJP A;  4LUO A;  3VYT A;  1SJH D;  1TS4 A;  1PHJ A;  4ZK9 B;  4A3K G;  1BCP F;  1KIX A;  2KA7 A;  4K8J A;  2EYJ A;  4FP5 D;  1F9R A;  1SE3 A;  1WTQ A;  2K33 A;  4BBR B;  5KYL A;  1D1K A;  1SYF A;  3I3C A;  4OXP A;  5CYU A;  5M3F H;  3F2U A;  1ASY A;  1U4P A;  3MTS A;  5LMU L;  2ZXO A;  3L3O C;  2WV6 D;  3D4R A;  3CC4 A;  2VQE L;  3M4Y A;  1F9S A;  1WTO A;  5C4J B;  5EPJ A;  5C44 G;  5FKA C;  4BY7 B;  4BXX G;  4S3S A;  4MTN A;  1X55 A;  2KEN A;  1UEA B;  2QKI C;  3TDQ A;  1T9H A;  2R7F A;  3F2B A;  1DXM A;  1KL9 A;  3H0G H;  3HEJ A;  5TSS A;  1MGS A;  4C3I G;  1HFN A;  1DCZ A;  1TQO A;  5FO9 B;  1AEX A;  4YHH L;  1N32 L;  5AJ3 Q;  1WFQ A;  3VR4 A;  1WTV A;  2CQA A;  4AYB B;  2E2I H;  3TRE A;  1MJC A;  3SVM A;  1G29 1;  2D0O A;  1VQH A;  4OX9 Q;  1XPO A;  3PF5 A;  4FO2 A;  1HZA A;  1Z7T A;  4IUP A;  3I55 A;  2NVY B;  2MNA A;  4JI1 Q;  1NCV A;  2IW3 A;  1U4R A;  3S1N H;  3NEM A;  1I6H H;  5IYD H;  4CKC A;  4A3J B;  3HOW H;  4POF A;  1TWA B;  1GUN A;  4X3T A;  2VB2 X;  3CCM A;  1HH2 P;  4B08 A;  3M4O H;  1KNA A;  4EQN A;  2K52 A;  4XT3 B;  4L5Q A;  1VMP A;  2F0I A;  2B2U C;  1ICW A;  4CDD C;  3A54 A;  3A8I E;  3TP5 A;  2NN6 I;  1ASZ A;  2OXP A;  4RGN A;  1PTO C;  4JI8 L;  4IPD A;  3CRL C;  1O78 A;  1QG7 A;  3MFY A;  3KLS A;  1R9T B;  1XNQ L;  5D3I B;  1BOS A;  2LS0 1;  4UY8 C;  1X65 A;  3I4N G;  3CQZ B;  1F2M A;  1HNW L;  1V1Q A;  4NXN Q;  1K83 H;  2QDL A;  5LMU Q;  3CCR A;  2DY8 A;  3J7A 5;  2VQE Q;  3OIQ A;  1K0R A;  1NE3 A;  2PI2 E;  5F2D A;  3Q6S A;  4RFB A;  2OCE A;  4JI7 L;  4DXG A;  1CI3 M;  3NXW A;  1L2F A;  1S5B D;  2K28 A;  3K80 C;  3DWQ A;  3NBH B;  4BA1 I;  4GOP B;  2NN6 H;  1LTL A;  2KHI A;  1N32 Q;  3G48 A;  3NBI A;  2YV5 A;  4JI6 L;  2L55 A;  2IX3 A;  4DUY L;  2AUK A;  2CWP A;  2K50 A;  5IT9 L;  1S5C D;  5JEA H;  1LTI D;  4EQ5 A;  3X3M A;  5I9P A;  5DM6 3;  2XNA C;  4X62 L;  1PH3 A;  2EE1 A;  3I4M H;  3TEH B;  1HZC A;  1X3Q A;  3J80 L;  4L63 B;  2VB3 X;  1GUT A;  5M3F B;  4WOR A;  1SMY D;  2VL6 A;  1RIP A;  1BO0 A;  4POG A;  3K5L A;  3BDO A;  3E0E A;  3GTP B;  1XYI A;  1HCZ A;  2A6H D;  2Z1C A;  4DR6 L;  4ZCK A;  2Q8T A;  4CHT B;  1R4P B;  3DM3 A;  1WCM G;  1CHP D;  4DV7 Q;  4LFC L;  2EQS A;  2LXK A;  4O0A A;  3S2D H;  1TWG H;  3FDT A;  2R61 A;  4A3D G;  4JI8 Q;  1O7I A;  3CMA A;  3H0G G;  5FLX E;  4KY6 A;  4KLK A;  1IKL A;  2E75 C;  4RG1 A;  1VQB A;  2GVA A;  1XNQ Q;  4DGZ A;  4AQY L;  1JB3 A;  3FPP A;  2E2I B;  2PPB C;  1JIC A;  1HA5 A;  1PLF A;  4BS9 A;  4BA2 I;  3MHB A;  5IGC A;  1HNW Q;  1GUG A;  2AWO A;  1LTG D;  2UXD L;  1PFS A;  1SYB A;  2R6G A;  2RHS B;  5BN5 A;  2X6G A;  4K6L A;  1SNM A;  4LK1 C;  4Z9C B;  1EOT A;  3QO2 A;  3S1N B;  3UDI A;  1B3Q A;  2A6E D;  4WFN 3;  4N8X 1;  2F0P A;  2B63 H;  4LUV A;  3PO2 H;  4JI4 L;  1TY2 A;  1EIF A;  1QB5 D;  1X3G A;  1SXT A;  4H02 A;  3EIV A;  3S1Q H;  3UDX A;  3M4O B;  1GUS A;  2CH4 W;  3HOW G;  1EY5 A;  3J81 j;  4O2D A;  3C2P A;  3KK7 A;  3I8Z A;  1I50 H;  2JE6 I;  1PH5 A;  2MUY A;  2FXQ A;  1VQE A;  1XPU A;  2L1B A;  4NB3 A;  3I2Z A;  2JA5 G;  4UP9 A;  1Y1W H;  1CA5 A;  4HIO A;  4DUY Q;  2CHB D;  1IYJ B;  2YTY A;  5IP9 G;  1G2S A;  2B2T A;  3M4P A;  3MXN A;  4H0L C;  4DAV A;  3M85 A;  2DJF C;  4K5V A;  2Q2U A;  2B29 A;  2PO4 A;  4I7A A;  4X62 Q;  1CZW A;  2YTV A;  2PMZ E;  1JCK B;  1QE6 A;  1LT5 D;  3A55 A;  2BCO A;  3HZX A;  4QMG A;  3J7Y W;  1K83 B;  1Q82 C;  1XNR L;  4N9T A;  3CCV A;  4NPS A;  4A3E H;  1U4M A;  4DR6 Q;  1M4V A;  1GVP A;  2F0J A;  4EQO A;  3CF5 A;  1PVO A;  5M3M G;  2B2Y C;  3AEV A;  3KF6 B;  5FJ8 G;  4A3L G;  5L37 A;  3ULL A;  2VUM H;  2Q2T A;  4DV1 L;  1CT1 D;  4JI2 L;  3IFD A;  3P20 A;  5HUR A;  2OQK A;  3NBH A;  3HFZ B;  1B7Y B;  2KCN A;  2NN6 G;  5EGT A;  3IL8 A;  2KHS A;  1QVF A;  4A3C G;  3S24 A;  1HFG A;  3NQI A;  1UE7 A;  1LT3 D;  3SR1 A;  1MSH A;  2UXD Q;  2M00 A;  3I4M B;  4R4C A;  1EZ8 A;  3TP8 A;  4NP5 A;  4YWL A;  5IP7 G;  3S14 H;  1A63 A;  3D6W A;  4JI4 Q;  4DF7 A;  2QA4 A;  2JA7 H;  3GQB A;  3NEL A;  2IHF A;  1Y1V H;  4HCE A;  3GV6 A;  1YJN A;  1LT6 D;  3K58 A;  1C4Q A;  3S2D B;  1TWG B;  3A74 A;  2HIV A;  4XYO A;  4EQP A;  2XSC A;  5IYB H;  4DR1 Q;  1GUO A;  2ZJQ A;  4JVZ A;  3CCU A;  1LAB A;  1PRT B;  2PMZ B;  1BCP B;  1EWC A;  4KKS A;  3HOY H;  2N88 A;  5IWA L;  5J39 A;  1Y8O B;  3ULJ A;  4PNY A;  4ZAI A;  5JPN C;  3BVG A;  1PRT D;  3VYR A;  1S72 A;  1XNR Q;  3FKI H;  1GXD C;  1A3T A;  4N9P A;  1I4G A;  1DOK A;  5BR8 L;  1VQ6 A;  2B63 B;  3PO2 B;  1E2V A;  2PI2 A;  1OXS C;  2Y0S E;  4KV6 A;  5C4H A;  4HID A;  4IUV A;  1JQY D;  4C3J H;  1MBY A;  4RH6 A;  4DV1 Q;  4JI2 Q;  3G7L A;  2BA1 A;  2HHH Q;  1EWI A;  1Y1W B;  2NWG A;  2OF1 A;  3PSI A;  3SDZ A;  3KBG A;  2AQ3 B;  4PQX A;  2R7D A;  3A8J E;  4QJF A;  3AFQ A;  3FVQ A;  4DK3 C;  3G6E A;  1T5E A;  3KOJ A;  3NHH A;  2WB1 G;  1B53 A;  1KAW A;  3K8A A;  2BH8 A;  1H9M A;  1SRU A;  4JBM A;  3NTI A;  2BDO A;  5CV5 A;  2SNM A;  1TKW B;  3DHQ A;  2A74 C;  2BE5 C;  2HUG A;  3CCQ A;  3BDC A;  3VR5 A;  2ICE C;  4UPA A;  4ODG A;  2WIN B;  1SE8 A;  1I3Q H;  2B2W A;  1HHV A;  1QVG A;  1U5K A;  4KD4 A;  4C3H G;  1ZYR D;  1XMO L;  3I72 A;  4OO1 G;  2EXZ A;  4A3E G;  2F1M A;  3AFP A;  2CW0 C;  5T1G A;  2OTJ A;  4C1N K;  3D31 A;  3J7A V;  3HP3 A;  3S2H H;  5EPL A;  1DOM A;  1T5X D;  2VUM B;  1E2Z A;  4HED A;  1PFB A;  2NB0 A;  5IIF A;  4G7H C;  3KF6 A;  3N52 A;  5JJZ A;  5IWA Q;  1KDA A;  3J80 c;  2A68 C;  2WII B;  4HN7 A;  4LAA A;  1EYG A;  1X56 A;  1ET6 A;  1ZKO A;  1NR2 A;  3K7A H;  1KDB A;  1SEB D;  1YHB A;  3QIA A;  1EU3 A;  1K9M C;  1G6P A;  4J6H A;  1RL2 A;  5BR8 Q;  4X65 L;  3S14 B;  4HIK A;  1IBM Q;  1VQ9 A;  4GNX C;  1SNO A;  2JA7 B;  1JT8 A;  2JSO A;  3LNN A;  2JJQ A;  3SK6 A;  3GO5 A;  4JI5 L;  5I2X A;  1AW7 A;  4B3M Q;  3J80 i;  3KDF B;  4DNT B;  2PNR C;  2LKV A;  2Y0S G;  3GDE A;  3PIP 3;  1V43 A;  4DR5 L;  1Y1V G;  3HOZ H;  1Q8I A;  3S17 B;  3RUZ A;  2EIF A;  2OQ0 A;  4DU9 A;  2Z0S A;  1D5Z C;  1VQA A;  3HOY B;  1H9J A;  3GTQ H;  1QNU A;  3HKZ B;  1E1T A;  3T16 A;  1U9R A;  4BY1 H;  5IGG A;  3FKI B;  5EKL A;  3RZD H;  2AUJ D;  4B3S L;  3C46 A;  5DLQ E;  4KN4 C;  4XDX A;  5LL6 S;  4BBR H;  1YNN D;  5CV6 A;  1XMO Q;  5KRU A;  2ICI A;  3OTO Q;  5CMD A;  2XIW A;  3S15 H;  2CH4 A;  1KD1 C;  1CSP A;  1AP0 A;  4RAU C;  2HIX A;  5C4J H;  5COR A;  4TRD A;  3C1E A;  4C3J B;  1PV4 A;  4BY7 H;  1FYC A;  3H3V C;  5J1Z A;  1YI2 A;  4FDB A;  3NTH A;  2EY5 A;  4DV2 L;  3U50 C;  4MZ9 A;  4DPG A;  1D5M C;  1IW7 D;  5FLM G;  3E9I A;  3RLF A;  2RF4 A;  1YHA A;  2RBM A;  2EYO A;  4K5X A;  3OW7 A;  1E7Z A;  4GOP C;  1NR4 A;  3OMG A;  4X65 Q;  4WRD A;  1EUJ A;  3J7Z C;  2ZJR A;  1TU2 B;  2F0E A;  2NYZ D;  1V1P B;  2K5D A;  3DWP A;  2Q8I B;  5C6A A;  4JI5 Q;  3STB C;  1I3Q B;  1QCB D;  2ATW A;  1E2W A;  2HDM A;  1KRS A;  2NVY H;  1HQM C;  4F88 A;  1SR3 A;  1KTK A;  2RHQ B;  2YYZ A;  4DR5 Q;  1DZ1 A;  2EJM A;  4I65 A;  2I5L X;  4QQB X;  1EWH A;  3HOV H;  3S2H B;  1WTX A;  4IUR A;  4KMU C;  3TBI B;  1KC8 C;  3RMH A;  2MO0 A;  3H94 A;  1XXG A;  2K5V A;  1PYB A;  3P7J A;  3K7A B;  1R9T H;  4JBK A;  1O80 A;  2JA6 H;  1QIL A;  1LUZ A;  1JOR A;  4A93 G;  4U67 3;  3EVQ A;  1RJT A;  3RN2 A;  1OTC A;  4DAY B;  1Z9F A;  2NTS A;  1JJG A;  2RKS A;  2WAQ E;  3PIP A;  2IWH A;  4A3I G;  5ELB A;  2V1C C;  4XIG S;  3GTL H;  4P2C B;  3NQT A;  1WYD A;  4LJZ C;  5IGF A;  1STN A;  5C3E H;  3KDF A;  1EQV A;  4ME3 A;  4LF7 Q;  4DV2 Q;  1OXX K;  2ZXP A;  3E3X A;  1XJV A;  4DR4 L;  2NVT H;  2ZXR A;  4CKE A;  1VMC A;  1XX8 A;  5K36 G;  2N3S A;  5C4X B;  3MXG A;  1LT4 D;  1HR0 L;  3GTQ B;  1YEZ A;  2EYL A;  1JR0 D;  2B2V A;  4IPH A;  3K59 A;  1PRT F;  1YNX A;  2ZTC A;  2OTL A;  4BY1 B;  4IUQ A;  2KJX A;  3HOX H;  4PMB A;  2KCC A;  1WJJ A;  1H9K A;  4A3M H;  1Z6H A;  2DJG C;  3RZD B;  3PIO 3;  3DEO A;  4FF2 A;  3UE0 A;  5CV9 A;  1MHW C;  3A7A B;  5LMN Q;  4A3G H;  2PW5 A;  2K5W A;  1MKH A;  3K57 A;  3S15 B;  5HGT A;  4KKU A;  4BBR G;  4JI0 L;  4OIK A;  2PZU A;  1FVI A;  4AH6 A;  3GTP H;  3PUY A;  2C9O A;  3U4V A;  1AN8 A;  3E6Z X;  1ML0 D;  2EPB A;  4IFD G;  4BY7 G;  5JPM C;  2MO1 A;  2G9H D;  2KCT A;  1F9P A;  1KDC A;  1OXT A;  2OT2 A;  4XXE A;  2AHO B;  1L0Y B;  4APV A;  5IYC H;  3CXC A;  3H91 A;  4PZ6 A;  1TII D;  3OWE B;  1D1I A;  4LF4 Q;  3I56 A;  2WAQ B;  3A5Z B;  3D4W A;  1UE1 A;  5E4W C;  3Q0A A;  1NTG A;  4AYB G;  3NE5 B;  2DN8 A;  3PCO B;  3WWV A;  4K8I A;  2M9V A;  1V9P A;  1LTT D;  2A8V A;  3O13 A;  3PO3 H;  4RHR A;  1IYV A;  2SNS A;  1V1P A;  1JOO A;  3PUZ A;  4DK0 A;  4P73 A;  2NZO A;  2PNH A;  2NVX H;  3HOV B;  1C9O A;  1UE6 A;  1MJE A;  3M7G A;  4A3J G;  4L5R C;  2N55 A;  4QUC A;  1FNW A;  4YIJ A;  3BZD B;  1F77 A;  2Z9H A;  1HR0 Q;  3MXN B;  4IUN A;  4UP7 A;  3RR5 A;  3EA6 A;  3VYS A;  4RA8 A;  3TZD A;  2A69 D;  2JA6 B;  1VS0 A;  1PFM A;  3T51 B;  4JCV E;  1L0X B;  4HJ5 A;  2PQA B;  3BZK A;  1PYS B;  1BCP C;  1H9S A;  3D8G A;  2K03 A;  3WOE A;  1CA6 A;  4R4I A;  3A0J A;  1UUP A;  1EY6 A;  2A1A A;  4JI0 Q;  3GTL B;  2NBF A;  4DAY A;  4KJN A;  2EYP A;  2F0N A;  2EYH A;  5C3E B;  3VR6 A;  2KCM A;  4TKO B;  1STY A;  4RGO S;  3W3A A;  5M5X H;  2N8N A;  2NVT B;  1SN8 A;  3CC7 A;  4UP8 A;  5JJI A;  1CKO A;  4OWT B;  3F8T A;  1GJX A;  3PUW A;  1BQQ T;  4J15 A;  2D9U A;  3BYT B;  4YHH Q;  1CZG A;  5C0X J;  2V4D A;  2RDG A;  4IOA A;  1EU4 A;  2K01 A;  3IRB A;  2E2J H;  4PMW A;  4L5T A;  2Q2H A;  4DV0 L;  3HOX B;  4ZRZ A;  4A3M B;  3VR3 A;  3EQL C;  5G3L D;  3ERQ A;  1YHQ A;  1Q8K A;  2F52 A;  3GTG H;  4B3R L;  5E3F A;  1ET9 A;  2HDL A;  4O1N A;  4DAM A;  1XMQ L;  4A3G B;  3CME A;  1W6K A;  3TS0 A;  4L5S A;  1QOH A;  4HJ7 A;  1V1O A;  3J81 c;  2EY6 A;  5GAE C;  5M3F G;  1A0I A;  4QL5 A;  5IT9 E;  1PZJ D;  3SEB A;  1IYU A;  1SRO A;  1NNX A;  4Q5V A;  1ESF A;  4KI0 A;  1QWY A;  3Q22 A;  1VQ7 A;  3GTK H;  1PH6 A;  3KFU A;  2NTT A;  3J80 E;  2JA8 H;  1X32 A;  4K6D A;  4UHV A;  4IUU A;  2WKC A;  1WD0 A;  2XTI A;  3CKI B;  2AQ1 B;  2IX1 A;  3F2C A;  5D3D A;  1WTH A;  2F0V A;  3J81 i;  1TVX A;  1IBK L;  3M3Y B;  1ENA A;  1STG A;  3E5S A;  2BA0 A;  3DMU A;  1G6Z A;  5C5M A;  2MHV A;  2OEO A;  1HTP A;  2E2H H;  4HMJ A;  3OYY A;  4FF4 A;  1K8O A;  3OPO A;  3PO3 B;  1PMR A;  3JC6 6;  1RD9 D;  2F4I A;  1ENF A;  1TS3 A;  4JI7 Q;  1BBW A;  2B8G A;  4DV5 L;  2RDF A;  5IYD G;  2NVX B;  4Y52 H;  1GD7 A;  1D5X C;  4DNI A;  1YZ6 A;  1Q81 C;  5GQO A;  1CKN B;  3PF4 A;  1AH9 A;  4XQN A;  1CQF A;  1Q1E A;  1BBX C;  1D7Q A;  2EJG C;  2ZJP A;  2K75 A;  3A7L A;  2XGT A;  3KYH C;  3TZU A;  4JI6 Q;  2TSS A;  3TN2 A;  4RWS C;  1L1O B;  4OL7 A;  1X54 A;  4N8F A;  1E22 A;  1II3 A;  1OO9 B;  2HD3 A;  1SAP A;  2XWJ B;  1B9M A;  4OON A;  4L8J A;  1XMQ Q;  1S3O A;  3G6J B;  1HNZ L;  2EOT A;  2PQA A;  1EYA A;  1RHP A;  4ALP A;  4ZLT F;  3ZJY C;  4KHV A;  4DA2 A;  2UUA L;  1K0S A;  1VF5 C;  4O42 A;  2B39 A;  3OOC A;  4LFC Q;  5M5X B;  1SFO H;  2HQE A;  1STA A;  4ZUI A;  1X3F A;  4MTK A;  3URY A;  2Z4I A;  4AQY Q;  3H6M A;  2MPM A;  2UU9 L;  1MI2 A;  5KGU A;  3FHW A;  2K5N A;  1PDQ A;  2E2J B;  5M5Y H;  2IY5 B;  2F0O A;  1EFI D;  4YWM A;  1STE A;  1RDP D;  1DM0 B;  5JEA G;  4GZY C;  3GTG B;  1Q1B A;  3I90 A;  1CQV A;  4KK7 A;  4G4K A;  4P72 A;  1Y69 U; 
#chains in the Genus database with same CATH homology
 2F0U A;  1WD1 A;  4J8Q A;  3K0Y A;  4KY5 A;  3QJY A;  4B9X A;  3D3R A;  2F0F A;  3OIP A;  2A73 B;  2E76 C;  4HCS A;  5DM7 3;  3V05 A;  1I4H A;  1M8A A;  4CBV A;  4FYD A;  2J0T D;  3GTK B;  1RTN A;  3A56 A;  2JA8 B;  4C2M B;  3QOL A;  3MAQ A;  1ZEQ X;  1A3V A;  1SDF A;  3BVM A;  1DYQ A;  1NSN S;  1H9R A;  1WTR A;  3H09 A;  2E2H B;  4XQQ A;  4DFA A;  1PTO D;  2H1E A;  1ZXT A;  2NUC A;  3AU7 A;  3Q23 A;  1EYD A;  4KD3 A;  4R8N A;  2F0D A;  2DY7 A;  2K05 A;  1A2U A;  2FMM A;  4C1N I;  5DNF A;  4QB4 A;  3TP7 A;  1U4L A;  2J4X A;  5IOD A;  5C0X I;  1ILP A;  1YNJ C;  3MFG A;  2JEB I;  5K5P A;  4PV1 C;  5EKI A;  2O4X A;  3MC0 B;  4UAI A;  1DON A;  5JAV A;  3ZYY X;  1JOQ A;  3E0J A;  5CBE E;  4JBW A;  1EL0 A;  1G8Z D;  1SND A;  3OMC A;  2MP1 A;  4RGT A;  1SFO B;  3P1H A;  4IQZ A;  1S5E D;  2VXW A;  1DOL A;  1TS2 A;  4K5W A;  1I4Q A;  3GV3 A;  2KQ3 A;  2KVM A;  4ID6 A;  5C0X H;  1FD7 D;  5M5Y B;  2WKD A;  1LLR D;  3ONA B;  1MSG A;  2X6L A;  5G3L F;  2IJ0 A;  3WOF A;  4XTC S;  4JK1 C;  4ZKB B;  1B3A A;  4NKL A;  2L0C A;  1AZQ A;  5KND A;  4QCL A;  1OXU A;  3FPU B;  4XT1 B;  5E1F A;  1RKN A;  3VYU A;  3BG3 A;  2K04 A;  2DNE A;  3ERO A;  2F0W A;  4A3F B;  4Y7N B;  3P75 A;  3KUP A;  4RKL A;  1CM9 A;  5CBA E;  1F2Z A;  5D14 A;  3U9S A;  4F87 A;  2IPK D;  1BUV T;  2RDH A;  3BYY B;  3CU7 A;  2RQX A;  4BBS B;  4ULL A;  3K5M A;  3HOU B;  2B2T C;  3HS0 C;  1IL8 A;  1TWC B;  1UNS A;  2F3V A;  3K5N A;  2B2U A;  1FNV A;  1AZP A;  2F0G A;  4FXG C;  3NTK A;  3R2T A;  2IX0 A;  2JP1 A;  2G9D A;  1QJO A;  3SE0 A;  4G7Z C;  3EFX D;  1JOK A;  4V19 0;  1Q12 A;  1S4Z A;  2O2L D;  1BF4 A;  4C3J G;  5FO7 B;  2XVS A;  3J81 L;  2K7V A;  3WDN A;  2EDG A;  2R93 B;  2R92 B;  2WAC A;  2D2C C;  1TWH B;  4ILW A;  4OGQ C;  4V0B A;  1BNZ A;  1GHJ A;  4HMI A;  3MEH A;  3S1M B;  4F8M A;  2F0L A;  1JWU D;  1SMY C;  1A3U A;  1KNE A;  1X3P A;  3CHB D;  1DJR D;  3D4D A;  4IN3 A;  5M5W B;  2A6H C;  5I6Y A;  1CTM A;  5LL6 X;  2L4N A;  3NSW A;  4NDX A;  4EVO A;  1SYC A;  4B9W A;  4KJO A;  5JVG 3;  4A3B B;  5I6W A;  3UI2 A;  3AB9 A;  1W6J A;  2PZW A;  1H9S B;  1O7Y A;  3R3O A;  2EVB A;  2PQE A;  2MJ8 A;  3GTJ B;  5BN4 A;  1VF7 A;  4ZQ3 A;  5FOB B;  1MD2 D;  2DNC A;  2FMC A;  1CFM A;  4LMQ D;  1LO5 D;  4KTA A;  2A6E C;  2VNU D;  4IAL A;  2A5H A;  1HPC A;  3MZ5 A;  3OWF A;  5EBD A;  1LTR D;  1SNQ A;  1B50 A;  4XYQ A;  1HRJ A;  2R7Z B;  1VCI A;  2F0Q A;  2O5I C;  3K6O A;  2KEE A;  3KLS X;  4QUF A;  4K2K A;  3NP8 A;  3PUX A;  1SYG A;  4DNR B;  4QF4 A;  3NPP A;  2PYK A;  2EJF C;  1PTO F;  4H7B A;  1G91 A;  5A35 A;  2I46 A;  5KYI A;  3TME A;  1A15 A;  4A3K B;  5IGD A;  3MVV A;  4KKT A;  2B2W C;  4RCN A;  2K6A A;  3T4A C;  3OSO A;  3T53 B;  1SBB B;  1F2L A;  2BE5 D;  1FGB D;  5IGB A;  1S5F D;  2QF7 A;  1JC7 A;  5C44 B;  1RF2 D;  3SK8 A;  2QDB A;  2CW0 D;  2B2Y A;  3I4L A;  2XRS D;  4C3I B;  2XN9 C;  1TWF B;  3X3N A;  2EZV A;  1ONL A;  5FO8 B;  4CGY B;  2FIN B;  2A68 D;  5ELF A;  1GUW A;  1F9Q A;  3FRP B;  5AFW A;  1JWM D;  2L9H A;  1UAP A;  4KN7 C;  5IGE A;  3DUZ A;  3PUV A;  2F0T A;  3V2T A;  5ELC A;  3VA5 A;  1KAB A;  4I7Z C;  1V8Q A;  5BN3 A;  1EY7 A;  3VR2 A;  3V96 A;  4DN4 M;  5C3X A;  4CJ0 B;  2D62 A;  3R8B A;  4WJW A;  5EQ0 A;  3ND9 A;  1PRT C;  5COY A;  1SNC A;  5M9O A;  3GP7 A;  1OXV A;  3SHL A;  2L5T A;  5C4Z A;  1J8I A;  1F2Y A;  1D2B A;  2EYF A;  2WP8 J;  1LTB D;  3I4N B;  3R93 A;  3M7N A;  2IL8 A;  5CC4 A;  1EIH A;  1HXY D;  2HCC A;  2K32 A;  2KEC A;  2JEA I;  2F0K A;  1ENC A;  2ENB A;  2LY7 A;  2PW7 A;  1JWS D;  2E74 C;  1LV9 A;  2PCF B;  2D5D A;  4NMZ A;  5I9O A;  3JAM L;  4RHS A;  2JYO A;  3PV0 A;  2QIL A;  2SDF A;  4R8I A;  1EY9 A;  2AWN A;  4HSP A;  5FK9 C;  3CRK C;  1Y8P B;  1S5D D;  1ZYR C;  2EY2 A;  1KLG D;  4M1U B;  4H13 C;  1A2T A;  2B8F A;  1FNU A;  1PFN A;  1LAC A;  2ZT9 C;  5E4X A;  4MIU A;  4KHZ A;  5FLX L;  1I6V C;  3JAM E;  4F7X A;  2JXM B;  4HAE A;  4R9W A;  1WCM B;  4MHE A;  2FFK B;  3ITP A;  4A3D B;  4HSV A;  1PTO H;  3H0G B;  5I2Y A;  1FR3 A;  3LWU A;  3MXP A;  3GD7 A;  4DAP A;  3I91 A;  3SK5 A;  1HTL D;  3K5O A;  3LWE A;  3DM1 A;  1EZ6 A;  2NZ1 D;  1NUC A;  3RZO B;  4Q0F A;  3Q24 A;  1HA6 A;  4FXD A;  3R2I A;  2SEB D;  1B2T A;  2M2L A;  4TQU S;  1I6H B;  3TSS A;  1Q90 A;  4OO1 I;  3HGB A;  3HOW B;  3NK9 A;  2F0M A;  3L9A X;  4ZYS A;  4IFD J;  1CK1 A;  3RD4 A;  4J1M A;  2B2V C;  2JA5 B;  2X69 A;  1SYD A;  2R3Z A;  3I73 A;  1ESR A;  1NAP A;  1EEF D;  4CJ1 B;  1YNN C;  2BOS A;  4ZUJ A;  1BDO A;  1B9N A;  5KNB A;  4RCO A;  4C56 C;  1RTO A;  4X3U A;  3FMC A;  4UDU C;  5LHY 1;  5CV8 A;  1DD2 A;  4U68 A;  4OO1 H;  4DK1 A;  1A6X A;  1IW7 C;  5M3M B;  3KLR A;  4RGM A;  1O7L A;  1XTC D;  2SOB A;  4IZ8 A;  1TY0 A;  1VDZ A;  3MXU A;  2LMC B;  5NUC A;  4MN3 A;  1I4R A;  5JOB A;  4G57 A;  4ABN A;  5EJW A;  3C1F A;  3S16 B;  5EKK A;  1HQR D;  5KIX A;  2RSN A;  1WVL A;  3BVZ A;  1TR5 A;  3A8K E;  2GA4 B;  4TSS A;  3GTO B;  1PTO B;  3U9O A;  2F0H A;  1O7Z A;  4X3S A;  5CGK A;  5IOC A;  4G7O C;  5CV4 A;  5ELE A;  4H44 C;  3FEW X;  3OHX C;  2TMP A;  5ISR A;  3J7A F;  2Z4H A;  3QWN A;  1SJE D;  1BCP D;  2XWB B;  2Q8R E;  3DXJ C;  3SK4 A;  1BR9 A;  2RVL A;  3QG1 A;  2ID0 A;  3NUC A;  2BDN A;  4FF3 A;  2KED A;  2L12 A;  3S1Q B;  3NWS A;  4E6I A;  2I07 B;  2L11 A;  3QB3 A;  1B44 D;  4DXF A;  1I50 B;  2QCP X;  2H4O A;  1EY0 A;  2QEJ C;  3HG9 A;  1Z47 A;  4CJ2 C;  3MWY W;  4FNF A;  2WB1 B;  3LX0 A;  1SE4 A;  4RKB A;  1AFP A;  1GHK A;  1Y8N B;  4FF1 A;  5EBC A;  2AQ2 B;  3C3L A;  3D6C A;  3SXH A;  1EYC A;  3T13 A;  4KY7 A;  1IHZ A;  4C3H B;  4EGV A;  3PMF A;  1EY8 A;  4A3E B;  3MA2 B;  1SYE A;  3HRZ C;  3TP6 A;  3T56 B;  4L6T B;  1GOZ A;  2RA4 A;  2FJ2 A;  1WTW A;  3IFT A;  4NW2 A;  5KEE A;  5ELD A;  2K1B A;  4ME5 A;  4PMC A;  4FXK C;  3KBX A;  1EY4 A;  3I70 A;  5CR3 A;  4OIJ A;  1RCV D;  1Q3L A;  1PXU A;  4OHJ A;  4IUT A;  2Y0S B;  4HR7 B;  1SE2 A;  2YU9 B;  5D65 A;  1Y1V B;  4X3K A;  2A69 C;  2IT1 A;  4IFD I;  1PZK D;  1I4P A;  3NWT A;  1HUM A;  5K36 H;  3KF8 A;  5DEH A;  4ZKC B;  5C3W A;  1KLU D;  4QIW B;  1SNP A;  5JEA J;  4FVM A;  3N6R A;  1BXT A;  1EEI D;  1C48 A;  1B4O A;  3IAY A;  4K14 A;  3IKJ A;  1J9O A;  3GTM B;  2FHT A;  2LFN A;  2KOL A;  2J7Z A;  5A2Q L;  2O5J C;  1IKM A;  2HCI A;  2NVQ B;  4IFD H;  1HUN A;  2E2D C;  3DEP A;  1CHQ D;  1ROD A;  5JVH 3;  3QOJ A;  3J81 E;  5T1I A;  2CVR A;  1D6E C;  2K5Q A;  3BDL A;  1ILQ A;  1G2T A;  1TT2 A;  5A2Q E;  1B1Z A;  1PZI D;  2RSO A;  1K8M A;  1LTA D;  1KAA A;  1TS5 A;  3L7Z C;  1XWE A;  2KUM A;  3ND8 A;  2F03 A;  2EYM A;  1STH A;  1C8C A;  5C0X G;  5J22 A;  3W2D A;  1SSO A;  5EPK A;  4XQJ A;  1EQT A;  3AMU A;  2PZT A;  5I4D A;  2MGS A;  4A93 B;  4K2L A;  5DAU A;  1R4Q B;  3VA7 A;  4CKB A;  2C5C A;  4HTH A;  4A3I B;  1LTS D;  1E0B A;  2XRQ D;  3EJI A;  4M8A A;  1JE4 A;  1STB A;  5C5L A;  3S1R B;  5KNC A;  2EY1 A;  1QNK A;  1PYW D;  3BS1 A;  1I4X A;  2F0S A;  3HOZ B;  1WTP A;  1EIG A;  5CV7 A;  2F3W A;  4BWG B;  2Z8L A;  3DWA A;  3S9W A;  1YNJ D;  3VYT A;  1SJH D;  1TS4 A;  4ZK9 B;  1BCP F;  2KA7 A;  4K8J A;  2EYJ A;  4FP5 D;  1F9R A;  1SE3 A;  1WTQ A;  2K33 A;  4BBR B;  5KYL A;  1D1K A;  1SYF A;  3I3C A;  5CYU A;  3F2U A;  1U4P A;  3MTS A;  2ZXO A;  3L3O C;  2WV6 D;  3D4R A;  3M4Y A;  1F9S A;  1WTO A;  5C4J B;  5EPJ A;  5FKA C;  4BY7 B;  4S3S A;  2QKI C;  1UEA B;  3TDQ A;  1DXM A;  3HEJ A;  5TSS A;  1MGS A;  4C3I G;  1HFN A;  1DCZ A;  1TQO A;  5FO9 B;  1AEX A;  3VR4 A;  1WTV A;  2CQA A;  4AYB B;  3SVM A;  1G29 1;  4FO2 A;  1Z7T A;  4IUP A;  2NVY B;  1NCV A;  2IW3 A;  1U4R A;  4CKC A;  4A3J B;  1TWA B;  1GUN A;  4X3T A;  2VB2 X;  4B08 A;  1KNA A;  4EQN A;  4XT3 B;  1VMP A;  2F0I A;  2B2U C;  1ICW A;  3A54 A;  3A8I E;  3TP5 A;  2NN6 I;  2OXP A;  4RGN A;  1PTO C;  3CRL C;  1O78 A;  1QG7 A;  3MFY A;  3KLS A;  1R9T B;  5D3I B;  1BOS A;  2LS0 1;  3CQZ B;  1F2M A;  2DY8 A;  3OIQ A;  5F2D A;  3Q6S A;  4RFB A;  4DXG A;  1CI3 M;  3NXW A;  1S5B D;  2K28 A;  3DWQ A;  4BA1 I;  2NN6 H;  3NBI A;  2L55 A;  2IX3 A;  2AUK A;  5IT9 L;  1S5C D;  5JEA H;  1LTI D;  3X3M A;  5I9P A;  5DM6 3;  2XNA C;  2EE1 A;  1X3Q A;  3J80 L;  4L63 B;  2VB3 X;  1GUT A;  5M3F B;  4WOR A;  1SMY D;  1BO0 A;  3K5L A;  3BDO A;  3GTP B;  1XYI A;  1HCZ A;  2A6H D;  2Z1C A;  2Q8T A;  4CHT B;  1R4P B;  1CHP D;  3FDT A;  2R61 A;  5FLX E;  4KY6 A;  1IKL A;  2E75 C;  4DGZ A;  1JB3 A;  3FPP A;  2E2I B;  2PPB C;  1JIC A;  1HA5 A;  1PLF A;  4BS9 A;  4BA2 I;  3MHB A;  5IGC A;  1GUG A;  2AWO A;  1LTG D;  1SYB A;  2R6G A;  5BN5 A;  2X6G A;  4K6L A;  1SNM A;  4LK1 C;  4Z9C B;  1EOT A;  3QO2 A;  3S1N B;  2A6E D;  4WFN 3;  2F0P A;  1TY2 A;  1QB5 D;  1SXT A;  3M4O B;  1GUS A;  1EY5 A;  3C2P A;  3I8Z A;  3KK7 A;  2JE6 I;  2MUY A;  2L1B A;  1CA5 A;  2CHB D;  1G2S A;  2B2T A;  3MXN A;  4H0L C;  4DAV A;  3M85 A;  4K5V A;  2PO4 A;  1CZW A;  1JCK B;  1QE6 A;  1LT5 D;  3A55 A;  2BCO A;  3HZX A;  4QMG A;  3J7Y W;  1K83 B;  4N9T A;  1U4M A;  1M4V A;  2F0J A;  4EQO A;  2B2Y C;  1CT1 D;  3IFD A;  3P20 A;  5HUR A;  3NBH A;  2NN6 G;  2KCN A;  5EGT A;  3IL8 A;  2KHS A;  1HFG A;  3NQI A;  1LT3 D;  3SR1 A;  1MSH A;  2M00 A;  3I4M B;  1EZ8 A;  3TP8 A;  4NP5 A;  3D6W A;  4DF7 A;  3GQB A;  4HCE A;  3GV6 A;  1LT6 D;  3K58 A;  1C4Q A;  3S2D B;  1TWG B;  4XYO A;  4EQP A;  2XSC A;  1GUO A;  1LAB A;  1PRT B;  2PMZ B;  1BCP B;  1EWC A;  4KKS A;  2N88 A;  5J39 A;  1Y8O B;  4PNY A;  4ZAI A;  5JPN C;  3BVG A;  1PRT D;  3VYR A;  1GXD C;  1A3T A;  4N9P A;  1I4G A;  1DOK A;  2B63 B;  3PO2 B;  1E2V A;  1OXS C;  4KV6 A;  5C4H A;  4IUV A;  1JQY D;  1MBY A;  4RH6 A;  3G7L A;  2BA1 A;  1Y1W B;  2NWG A;  2OF1 A;  3SDZ A;  3KBG A;  2AQ3 B;  4PQX A;  3A8J E;  3FVQ A;  1T5E A;  3NHH A;  1B53 A;  1H9M A;  3NTI A;  2BDO A;  5CV5 A;  2SNM A;  1TKW B;  3DHQ A;  2A74 C;  2BE5 C;  2HUG A;  3BDC A;  3VR5 A;  2ICE C;  4ODG A;  2WIN B;  2B2W A;  1HHV A;  4C3H G;  4KD4 A;  1ZYR D;  4OO1 G;  3I72 A;  2EXZ A;  2F1M A;  2CW0 C;  5T1G A;  4C1N K;  3D31 A;  3J7A V;  3HP3 A;  2VUM B;  5EPL A;  1DOM A;  1T5X D;  1E2Z A;  4HED A;  1PFB A;  2NB0 A;  5IIF A;  4G7H C;  5JJZ A;  3N52 A;  1KDA A;  2A68 C;  2WII B;  4HN7 A;  4LAA A;  1ET6 A;  1ZKO A;  1NR2 A;  1KDB A;  1SEB D;  3QIA A;  1EU3 A;  4J6H A;  3S14 B;  1SNO A;  2JA7 B;  2JSO A;  3LNN A;  3SK6 A;  3GO5 A;  5I2X A;  1AW7 A;  4DNT B;  2PNR C;  2LKV A;  3PIP 3;  1V43 A;  1Q8I A;  3S17 B;  3RUZ A;  4DU9 A;  1D5Z C;  3HOY B;  1H9J A;  1QNU A;  3HKZ B;  3T16 A;  1U9R A;  5IGG A;  3FKI B;  5EKL A;  2AUJ D;  3C46 A;  4KN4 C;  4XDX A;  5LL6 S;  1YNN D;  5CV6 A;  5KRU A;  2ICI A;  5CMD A;  2XIW A;  1AP0 A;  4RAU C;  5COR A;  4TRD A;  3C1E A;  4C3J B;  1FYC A;  3H3V C;  5J1Z A;  3NTH A;  2EY5 A;  1D5M C;  1IW7 D;  3RLF A;  2RBM A;  2EYO A;  4K5X A;  3OW7 A;  1NR4 A;  3OMG A;  4WRD A;  1TU2 B;  2F0E A;  2NYZ D;  1V1P B;  2K5D A;  3DWP A;  2Q8I B;  5C6A A;  1I3Q B;  1QCB D;  1E2W A;  2HDM A;  1HQM C;  4F88 A;  1KTK A;  2YYZ A;  1DZ1 A;  2EJM A;  4I65 A;  1EWH A;  3S2H B;  1WTX A;  4IUR A;  4KMU C;  3TBI B;  3RMH A;  3H94 A;  1XXG A;  3P7J A;  3K7A B;  1O80 A;  1QIL A;  1JOR A;  4U67 3;  3EVQ A;  1RJT A;  2NTS A;  2RKS A;  2IWH A;  5ELB A;  4XIG S;  4P2C B;  3NQT A;  4LJZ C;  5IGF A;  1STN A;  1EQV A;  1OXX K;  2ZXP A;  2ZXR A;  4CKE A;  1VMC A;  1XX8 A;  5K36 G;  5C4X B;  3MXG A;  1LT4 D;  3GTQ B;  2EYL A;  1JR0 D;  2B2V A;  3K59 A;  1PRT F;  4BY1 B;  4IUQ A;  2KJX A;  4PMB A;  2KCC A;  1H9K A;  1Z6H A;  3RZD B;  3PIO 3;  3DEO A;  4FF2 A;  5CV9 A;  3A7A B;  2PW5 A;  2K5W A;  3K57 A;  3S15 B;  5HGT A;  4KKU A;  4OIK A;  2PZU A;  3PUY A;  2C9O A;  1AN8 A;  3E6Z X;  1ML0 D;  2EPB A;  4IFD G;  5JPM C;  2G9H D;  1F9P A;  1KDC A;  1OXT A;  2OT2 A;  4XXE A;  1L0Y B;  3H91 A;  1TII D;  3OWE B;  1D1I A;  2WAQ B;  3D4W A;  5E4W C;  3Q0A A;  3NE5 B;  2DN8 A;  4K8I A;  2M9V A;  1LTT D;  3O13 A;  4RHR A;  1IYV A;  2SNS A;  1V1P A;  1JOO A;  3PUZ A;  4DK0 A;  3HOV B;  3M7G A;  2N55 A;  4QUC A;  1FNW A;  4YIJ A;  3BZD B;  1F77 A;  4IUN A;  3EA6 A;  3VYS A;  4RA8 A;  3TZD A;  2A69 D;  2JA6 B;  1PFM A;  3T51 B;  1L0X B;  1BCP C;  1H9S A;  3D8G A;  2K03 A;  3WOE A;  1CA6 A;  1UUP A;  1EY6 A;  3GTL B;  2NBF A;  4DAY A;  4KJN A;  2EYP A;  2F0N A;  2EYH A;  5C3E B;  3VR6 A;  4TKO B;  1STY A;  4RGO S;  3W3A A;  2NVT B;  1GJX A;  3PUW A;  1BQQ T;  2D9U A;  3BYT B;  1CZG A;  5C0X J;  2V4D A;  2RDG A;  1EU4 A;  2K01 A;  4PMW A;  3HOX B;  4ZRZ A;  4A3M B;  3VR3 A;  3EQL C;  5G3L D;  3ERQ A;  5E3F A;  1ET9 A;  2HDL A;  4O1N A;  4A3G B;  1W6K A;  1QOH A;  1V1O A;  2EY6 A;  5IT9 E;  1PZJ D;  3SEB A;  1IYU A;  4Q5V A;  1ESF A;  4KI0 A;  1QWY A;  3Q22 A;  2NTT A;  3J80 E;  1X32 A;  4K6D A;  4IUU A;  2WKC A;  1WD0 A;  3CKI B;  2AQ1 B;  2IX1 A;  5D3D A;  2F0V A;  1TVX A;  3M3Y B;  1ENA A;  1STG A;  3E5S A;  2BA0 A;  3DMU A;  1G6Z A;  5C5M A;  2MHV A;  2OEO A;  1HTP A;  4HMJ A;  4FF4 A;  1K8O A;  3OPO A;  3PO3 B;  1PMR A;  1RD9 D;  2F4I A;  1ENF A;  1TS3 A;  2B8G A;  2RDF A;  2NVX B;  1D5X C;  4XQN A;  1CQF A;  1Q1E A;  1BBX C;  2EJG C;  3A7L A;  3TZU A;  2TSS A;  3TN2 A;  4RWS C;  4OL7 A;  1II3 A;  1OO9 B;  1SAP A;  2XWJ B;  1B9M A;  4L8J A;  3G6J B;  2EOT A;  1EYA A;  1RHP A;  4ZLT F;  4KHV A;  4DA2 A;  1VF5 C;  4O42 A;  2B39 A;  3OOC A;  5M5X B;  2HQE A;  1STA A;  4ZUI A;  3URY A;  2Z4I A;  3H6M A;  2MPM A;  1MI2 A;  5KGU A;  1PDQ A;  2E2J B;  2F0O A;  1EFI D;  1STE A;  1RDP D;  1DM0 B;  5JEA G;  4GZY C;  3GTG B;  1Q1B A;  3I90 A;  1CQV A;  4KK7 A;  4G4K A;  1Y69 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...