4EVOA

Crystal structure of staphylococcal nuclease variant nviaga/e122g at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
124
Chain Sequence
LHKEPATLIKAIDGNTVKLMYKGQPMVFRLLLVDIPYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHGQHLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Local flexibility as a determinant of pKa values of surface ionizable groups in proteins
rcsb
molecule keywords Thermonuclease
molecule tags Hydrolase
source organism Staphylococcus aureus
total genus 37
structure length 124
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4evoA00
2KQ3A 4KD3A 4KY6A 1TR5A 2PZUA 4QB4A 3T13A 4DU9A 2SOBA 4F8MA 5IGGA 5IIFA 1SNQA 2F0QA 2PW7A 5IGCA 1SNPA 2F0OA 2EY1A 4DFAA 3OMCA 3D4DA 5E3FA 2F0JA 4B9XA 4KJOA 2ENBA 3HEJA 4G57A 4KY5A 5KGUA 2SNMA 3NP8A 2PZTA 4WORA 4IALA 4F7XA 2HQEA 3MZ5A 2EYPA 2OEOA 5CV6A 4K2LA 1SYCA 3TP7A 4ZUIA 3VA5A 1SYDA 4J1MA 3ERQA 4RKBA 1STYA 5KIXA 5HGTA 4IZ8A 4NDXA 3SXHA 2LKVA 4K8IA 2F0FA 5F2DA 4B9WA 2PYKA 1STNA 2F3VA 4ZQ3A 4KD4A 4NP5A 3PMFA 1A3UA 1KABA 3D4WA 4QF4A 5CGKA 4S3SA 2PZWA 1EY0A 3S9WA 2F0SA 2EY6A 2QDBA 4K5XA 4TRDA 3BDLA 3EVQA 3D6CA 4EVOA 5KRUA 5J1ZA 1JOOA 2F0MA 2F0NA 5CV9A 3H6MA 4K5WA 3E5SA 1EY6A 4YIJA 4N9TA 1SYBA 2F0GA 1RKNA 1TQOA 5CV5A 1KAAA 1KDAA 2WACA 3OSOA 3SK8A 3NUCA 5C4ZA 2F0PA 5KYLA 2F0LA 4KHVA 2KHSA 1II3A 2O4XA 4HMIA 1EY5A 3OWFA 5CV8A 5I9OA 5K5PA 2F0KA 4OL7A 3SHLA 5KYIA 5C5MA 5J39A 5C3WA 5IOCA 5C6AA 3LX0A 5CR3A 3NK9A 3EROA 1NSNS 5IODA 1SYGA 2PQEA 1TT2A 5IGBA 1SYEA 4K14A 2F0UA 3C1EA 3U9OA 5I9PA 5JOBA 1A2UA 2F0EA 3TP6A 3R3OA 3DMUA 2F0DA 1EYCA 5C3XA 5KEEA 3BDCA 1ENCA 4KJNA 4R8NA 4KTAA 3SK5A 5J22A 1EZ6A 2NUCA 4ID6A 4N9PA 2OF1A 4ODGA 3NQTA 2EYFA 4HMJA 1A2TA 5DAUA 1SNCA 4DF7A 5ISRA 1JORA 2EY5A 4PMCA 4E6IA 1EY9A 1EY8A 2F0IA 3QOJA 5CV4A 3SK6A 5IGEA 3HZXA 1AEXA 2F0VA 2M00A 2RBMA 1STBA 3P75A 3T16A 4DGZA 3C1FA 1JOQA 4K8JA 1ENAA 2EYMA 2EYJA 3DHQA 3MEHA 3MHBA 4K5VA 4MIUA 4HTHA 4KV6A 5IGDA 3SK4A 2RKSA 1STAA 1U9RA 1KDCA 5I6WA 2F0TA 4QMGA 1F2MA 4K2KA 4RKLA 5CV7A 3OMGA 3QB3A 3QOLA 1A3VA 3MVVA 3P1HA 4ME5A 1SYFA 4EQPA 3RUZA 3TP5A 2EYHA 1EY7A 5JAVA 2EXZA 4EQNA 5C4HA 5M9OA 5CC4A 2EYLA 3MXPA 5C5LA 2SNSA 3SR1A 5EGTA 5EKLA 1SNOA 4WRDA 3NHHA 4NKLA 3TMEA 1EZ8A 1F2YA 2RDFA 2F0HA 1EQVA 1F2ZA 5DEHA 2EYOA 5HURA 3NXWA 3ITPA 4ZUJA 1A3TA 3V2TA 1SNMA 1STHA 1SNDA 4KY7A 4I65A 5NUCA 4H7BA 4IUNA 1JOKA 3D8GA 4EQOA 1KDBA 5E1FA 4PNYA 1EY4A 2F3WA 4PMBA 1IHZA 3TP8A 5I6YA 5EKKA 1NUCA 1EYDA 1EYAA 2EY2A 2F0WA 1STGA 3EJIA 4LAAA 4NMZA 4K6DA 4J6HA 5IGFA 2PW5A 2OXPA
chains in the Genus database with same CATH superfamily
2XWBB 1SLJA 4IJLA 4KY6A 4LF7Q 4DV4Q 2L55A 3H09A 3QWNA 1K83H 5FJ8H 3ERSX 1IBLL 1B3QA 1B70B 3S15H 1QB5D 3U50C 4L8JA 5EBDA 2F4VQ 4K2LA 2VZAA 1DOMA 4HAEA 2YV5A 4DK6C 1A63A 4CJ0B 4X66Q 1STNA 1H9KA 1PH9A 1M8AA 1FD7D 4K5WA 3E5SA 5K36H 1T9HA 2B2YC 1PV4A 1KAAA 3OSOA 4JW0A 2D0PA 5IP7H 1PFSA 1HNXQ 4A93G 4JI6Q 1PDQA 3BVMA 2ALYB 1CKNB 2K01A 4IPCA 3QR8A 4Y7NH 5C0XH 3JAMc 2RCFA 3EROA 3CD6A 3GTMH 1SE2A 3X3MA 2G5DA 3IKJA 3EN2A 3J7ZC 1Q8KA 1EYCA 4A93B 1VQOA 2NB0A 4UP9A 4ID6A 4DA2A 5GADC 4DR6Q 5C0XJ 2K28A 4JI0L 5LL6S 3PIO3 1TKWB 1TS4A 1UAPA 4JI7L 1N36Q 1ENAA 4V190 2E8GA 1K3BC 4YWLA 4C3IB 4B3MQ 3RN5A 2YTVA 3A7AB 2VXWA 2N55A 2K5VA 2Q2HA 1V43A 3I4NG 1VQIA 1YEZA 4WJ4A 2BCOA 3RUZA 1K8GA 5LMNQ 1IL2A 2PQAB 1N33Q 4EGVA 1FGUA 1YNND 1HUNA 3NHHA 3C2PA 4FF1A 1EQVA 3HOUB 1IKLA 4XT1B 1G91A 1A3TA 3K81C 2VUMB 1LTAD 1IZ6A 4QUFA 4KKUA 3S17B 1VQBA 2K1BA 3I4OA 2EE1A 3S2HB 2E2IH 1Y69U 4GLXA 2BH2A 5IWAL 2XRQD 5TSSA 4AYBB 4JBMA 4LF4Q 3N52A 4LW1A 3M9BA 3BU2A 1F9PA 1SDFA 1T5EA 3OIPA 2NVYB 1ML0D 1ZYRC 3H0GG 1ASYA 1D5ZC 1NR4A 5ELDA 4JPBW 4JC0A 4BY7H 2I5HA 1D1KA 2JJQA 3H0GB 3CCSA 3RZOH 1TQOA 1JR0D 4GOPB 1TWHH 4IPHA 2XSCA 3HGBA 3HKZE 5JEAG 2I5LX 3S24A 5EKIA 1VQFA 3EFXD 1H9RA 1E7ZA 1PXUA 3M3YH 3N6RA 3TP6A 1TS3A 1IXRA 5KEEA 1QOHA 1QVGA 2IJ0A 1IW7C 2B8GA 2E5LQ 1EY9A 1SE3A 2JK8A 2ZJQA 1F77A 1H9SB 5IY0A 1ZKOA 2BDOA 2O2LD 4IOAA 4K5VA 1CKMA 1TWGH 2MNAA 1PRTB 1KDCA 4GZYC 4RKLA 4XDXA 4PG3A 1TWCH 3KOJA 2F52A 3P1HA 2DGYA 1AZQA 5C4XG 3SVMA 3HRZC 3MWYW 4U68A 4H13C 2ASBA 2B63H 2JXMB 1YHAA 4GKJQ 4YCWA 1EFID 1F2ZA 5C4XB 4M1UB 1GUNA 4B3SQ 3K5OA 2OT2A 4IUVA 3E6ZX 5FLXL 1X9NA 1Y14B 4MZ9A 1HR0L 1LTGD 2XGTA 1J6QA 1SROA 4XIGS 3CQZB 2K04A 3S2DB 4A3MH 3UI2A 1FL0A 3HOXG 1S3OA 3UDGA 1VQDA 2XN9C 1RIPA 2P5ZX 3BG3A 2SDFA 2UXBQ 2JSOA 4BY1G 1Z47A 4KY5A 3HEJA 4P72A 4LF6Q 4X6AH 4IUPA 1W2BA 4HJ9A 1BF4A 3HOXB 1X3PA 3MZ5A 3KFUA 1HZAA 1XPRA 4C3JB 5KIXA 4A76A 2VB2X 5G3LD 2PYKA 4BY1B 4IFDI 3PSIA 3PMFA 1EIGA 4CHTB 1U4PA 3NBIA 5BN3A 2F0SA 2HQLA 3EVQA 1I94Q 5JJZA 2F0MA 1HH2P 4JVZA 4A3KG 1H95A 1XX8A 3S16B 2J4XA 1CKOA 4RWSC 1Z6HA 5C4ZA 2F0PA 4DR3Q 3VYTA 1MJCA 2O4XA 4HMIA 4YCVA 3IRBA 5IYBH 4GKKQ 4QY7A 1CK1A 3D31A 3ND9A 4IPGA 2PQEA 4A3KB 1ILPA 1HFGA 1XJVA 1I4RA 1STEA 4HSVA 5IP9H 4A93H 1N34L 3A8IE 1VQEA 2QW7A 3GV3A 1WTWA 2K05A 3CW2C 3PIP3 3HOZG 2R7ZH 5T1GA 2F4VL 2NVQB 1RCVD 3BZCA 3HZXA 4X3SA 4DK3C 1STBA 2CQAA 3KYHC 4WJWA 3R8BA 1PTOB 4BBSG 2HUGA 2K75A 3A8KE 3HOZB 4C3IH 4RCOA 4CDFC 1ASZA 3CC7A 1U9RA 2QILA 3HOWH 2L5TA 4IO9A 3I55A 1CZWA 4A3EG 1WTQA 1YNNC 3TRZA 2RF4A 3AFQA 1YJ9A 5BR8L 1HNXL 4DV3Q 5C5LA 3E9HA 1S40A 4JI6L 2KCCA 4WRDA 2JA7H 1K0SA 4IUQA 1TWAB 2B2UC 4HJ5A 3HOUH 4GLAC 1PYWD 1I50B 1L0XB 3L7ZC 3PCOB 2L0CA 2VUMH 4OGQC 2IX1A 1Z9FA 4EQOA 1YNJC 5KNBA 5DM63 1MI2A 2AQ3B 2WFWA 5EJWA 3AU7A 3K7UC 3MXNB 3EJIA 4F87A 1ENFA 1RJTA 2WKCA 3LWUA 2I0QA 1VCIA 2CVRA 2V1CC 4F8MA 5JJKA 1PH2A 3S1MB 2SOBA 4JOIA 2I5MX 4O0AA 5E7NA 1TIID 5IIFA 2F0QA 5ELFA 1L1OA 3S2HH 2Y0SE 5FLXc 1UEBA 2YU9B 1V1PA 1BUVT 5E3FA 1C48A 1JE4A 2GVAA 3CCJA 1LO5D 5C0XG 3K0XA 3FDTA 1E2ZA 2MFIA 4YY3Q 5GAHC 3BVGA 4DN4M 3ZJYC 1J8IA 3M4OB 2OCEA 4B9WA 4R1JA 3D3RA 1MSHA 2F3VA 2NVYH 5FJ8G 3IAYA 1PRTF 4FDBA 4BA1I 1A3UA 3GTLB 3PUWA 3PF4A 2A68D 3CCLA 3KF8B 3P7JA 1BNZA 2LMCB 2XIWA 1LTRD 3TZUA 1B3AA 1V8QA 2TMPA 2PI2E 1I4QA 3QJYA 3S15B 3F8TA 3SEBA 3VR2A 3NTHA 1I5FA 4JI0Q 3AMUA 5IOCA 3PO2G 4AQYQ 2OWOA 5K36G 4K14A 4UPAA 3R3OA 4Y52H 2FJ2A 3V96A 5IP7G 2KCMA 1A0IA 1Y1WG 5GAGC 4DV0L 3PO2B 1JORA 1QG7A 2M9VA 2QF7A 5COYA 1VQMA 1EEID 2AKWB 2F0IA 1K9MC 3TS0A 3SK6A 3GTPB 4HJAA 1Y1WB 4JI4Q 4ME3A 2Z9HA 1M4VA 3DHQA 3CCMA 1O7IA 3I56A 4HSPA 1HJPA 3AB9A 4XQNA 3GTMB 1SSOA 4K2KA 1A3VA 4LFBL 5GAEC 3K5LA 1SYFA 3PIOA 4DUZQ 3GTOH 1J9OA 4TSSA 1T5XD 4I7AA 2RDGA 4XT3B 2QA4A 2R6GA 1KNAA 3FKIH 3MC0B 1E2VA 3T56B 5M5WH 4RGMA 1HHVA 2CFMA 2CWPA 3G71A 2K6AA 4OWWB 1ET9A 2I07B 4NXML 2F3WA 1VQ7A 1IHZA 5EKKA 1VQJA 3S2DH 1Y8PB 1H9JA 3MFYA 4DR7L 3I8ZA 3CXCA 4QB4A 2NN6I 4HIDA 3NQIA 1SNQA 4M8AA 1EFWA 2RA4A 4OO1I 2EY1A 4L63B 3K57A 2DJGC 1GOZA 3D4RA 1VMCA 1CI3M 4CKBA 4X65L 4J15A 3HOXH 1D8LA 1Q1BA 2F1MA 1HXYD 1D5MC 2R93G 4X3KA 4RKBA 1OXXK 4C3JH 3I91A 4UP7A 2BE5C 4DV6L 4PZ8A 1PTOF 2AUKA 1AW7A 4ZQ3A 1PZID 1EWHA 1O80A 3RR5A 2R93B 1MKHA 1JE5A 3B6YA 4EVOA 1BCPC 4TKOB 2F0NA 1AP0A 3ONAB 1CKNA 2KEEA 1PH7A 4B3SL 1TWFB 2FFKB 4ZKCB 2UUAL 2CH4A 3S16H 3L2PA 4HR7B 2BOSA 2X69A 3OPOA 5IODA 4FXKC 4BY7G 4A3KH 1GKHA 5M5YB 5CORA 4NPSA 1A2UA 4R4CA 1OXTA 3WOEA 1KTKA 1ENCA 1YHQA 4LF6L 1XTDA 2DY7A 3UDFA 4BY7B 4ZLTF 2EIFA 3AYHB 3RZOB 1UEAB 3MAQA 1I3QB 5IGDA 3SK4A 1PTOH 1NE3A 2RKSA 3HOZH 1XMOL 2EJFC 3M3YB 1SJHD 3H3VI 3F2DA 2PQAA 2NZHA 4DKAC 5M3MH 4YCUA 1JMCA 1PFMA 3GD7A 3STBD 3AEVA 4A3CH 1X32A 4QUCA 1DOLA 4AH6A 5M9OA 3G6EA 2SNSA 2XWJB 3K80C 2UXCQ 3M85A 1WCMH 1IW7D 1FYCA 1TWAH 1TWGB 4KY7A 5NUCA 1Z7TA 1C8CA 2L12A 2B63G 4FF3A 3TP8A 2WB1B 5J22A 2KCTA 4NMZA 4MN3A 4K6DA 4HIMA 3I70A 4A3LG 2WAQG 4KD3A 2PZUA 2GVBA 3S1QH 1E1OA 3S1MH 4PQXA 2ZTEA 1HNWL 1QNUA 5IGCA 1QZGA 1IL8A 3HS0C 5GROA 2B63B 1D1IA 4GNXB 2YU9H 2B8FA 5KGUA 5D14A 2KOLA 4A3MG 3HOYB 3DM3A 3RN2A 5DM73 3L3OC 2D2CC 2E2HB 1ESFA 1DCZA 2OEOA 4CBVA 1FJGL 4JBKA 3HFZB 2RHQB 4NDXA 4A3GG 2AQ2B 2BDNA 1XNRQ 1K8OA 2A68C 3M4OH 4UDUC 2A8VA 1L2FA 3QG1A 4KD4A 4A3MB 1XMQL 3R2IA 4QF4A 3T1YQ 2E74C 1I4GA 4DV3L 4YWKA 1LV9A 3GP7A 2HT1A 2K14A 4GOPA 5FO7B 3T51B 4A3GB 5CV9A 3Q6SA 1K3RA 2JYOA 2K5WA 5EBCA 3TEHB 1N34Q 1JICA 1HA6A 2MO1A 3SK8A 1NY4A 1WI5A 4L5RC 1IYUA 5IT9E 4ZKBB 3CPWA 1PH1A 2E2JH 2RQXA 5A2QL 2B2VC 3PGZA 2F0UA 3U9OA 3VYRA 2PMZE 3L0OA 1G2TA 3FHWA 2EQSA 4WFN3 1MJEA 1H9SA 2Z6KA 1JQYD 2K5DA 5IYBG 2WV6D 2MUYA 2EYFA 3PO2H 1I4HA 5KNCA 1X3QA 1DOKA 3U9SA 4YY3L 1AEXA 1JB7A 2M00A 3GTPH 5IP9G 4GLVB 1JOQA 1Y1WH 5BR8Q 4C3HH 1X65A 2DN8A 2R7ZG 1PH6A 3PIPA 2OTLA 1R4QB 3NBHB 3QB3A 3PUXA 4LK1C 1GUOA 2KCNA 1VQ9A 2NN6H 4A75A 2XNAC 3P20A 4NB3A 5HGQA 4OO1H 4A3IB 3W3AA 1KIXA 2NYZD 4UY8C 4C3IG 2R7ZB 3HOWG 1R4PB 3SR1A 4NKLA 1CSPA 1Y8OB 4AQYL 2AHOB 2XTIA 1JJGA 1HRJA 3ICEA 1SNMA 3QO2A 1V9PA 3HOWB 1JCKB 4LF5L 2JA7G 4HJ7A 1C0AA 3J81j 3HOUG 1RD9D 1B1ZA 4OONA 2WKDA 2VUMG 4POGA 4JI4L 4QJFA 4GN4B 3G7LA 2JA7B 1D7QA 1ILQA 1HNZQ 1LM0A 1TY2A 1SEBD 4G7HC 1STYA 1TXYA 3TBIB 1UNSA 4DUZL 2VQEL 2F0FA 1ICWA 1NR2A 1N9WA 4TVAB 2JA5G 2KECA 2HDLA 2Q2TA 1LTSD 2B2TA 3ZYYX 4KKSA 1A62A 2WINB 1PH8A 4AYBG 1YNJD 5JPMC 4TRDA 4JV5Q 2R93H 1GO3E 2JA6H 1C9OA 2B2WA 1JOOA 3LGJA 4JI3L 4IN3A 2JA5B 4QIWE 1LT4D 3DEPA 1BXTA 1RKNA 1TWFH 4DV0Q 3DM1A 4K0KQ 5KYLA 2F0KA 2RDHA 1SAPA 3OYYA 4A4IA 4OEMB 1EIHA 1PLFA 4O42A 1VDZA 3K8AA 4JBJA 1XYIA 4QL5A 5FO9B 1KXLA 4KLKA 3C1EA 5M5YH 3A5UA 3F2CA 1V1OA 1LLRD 4FXDA 1HTPA 1U4MA 2ZTCA 3BZKA 1SXTA 3NELA 4HMJA 4LFBQ 1EY8A 2VL6A 2A6HD 3FVQA 2NZ1D 4RCNA 3T16A 4K8JA 2EYMA 2EYJA 4O1NA 1CA6A 1I3QH 3E0JA 1N32Q 1X3FA 1SFOB 4QMGA 1I6VC 1EIYB 2KEDA 2IY5B 4JI1Q 5JJIA 1B4OA 2MPMA 3NWSA 2YTXA 3STBC 3LWEA 4J8QA 3BS1A 3FMCA 4NXMQ 4DAVA 2LXKA 2B29A 1IYJB 1CA5A 4ZYSA 3VDYA 3D6WA 1Y1VG 3GQBA 1SR3A 5IT9L 1ZEQX 4DR7Q 3HG9A 1SNOA 3H3VC 4WJ3M 2F0HA 5DEHA 5CBEE 2L11A 2XRSD 3MXNA 1STHA 2DY8A 4BBRH 2K32A 1WOCA 1GD7A 1Y1VB 5A35A 3H94A 1XTCD 4ZRZA 4X65Q 1OXUA 5FK9C 2F0WA 1QCBD 5IGFA 4DV6Q 3FKIG 1VF5C 4JOIC 3GTOB 1MD2D 3CCVA 1WD0A 2Q8TA 3FRPB 2CW0C 4B08A 3X3NA 4B9XA 4CDCC 2SNMA 1QVFA 4WORA 3GTQH 3HOYH 2HQEA 1CHPD 3FKIB 2E2HH 5M5WB 4A3LH 2IWHA 3KDFB 2UUAQ 3KF8A 5F2DA 1GXDC 2EDGA 1N8RC 4IQZA 3MEFA 1S5DD 4DV5Q 4DK0A 3KJOA 4LWCA 4C3JG 2UXCL 2HCCA 4A3GH 2VB3X 1KDAA 3KLRA 3BZDB 1KL9A 2ZM6Q 3I90A 5CV8A 1II3A 1EYGA 1PFNA 3KLWA 1JT8A 4CGYB 1HPCA 3K7AB 3T1HL 5IYDH 4P74A 3CCRA 4MNOA 2UUCQ 4QCLA 5C3XA 5EPLA 2BE5D 4XQJA 3BDCA 2KHIA 1XMOQ 1CTMA 3CAMA 1O78A 2MHVA 4FXGC 1SNCA 1WTHA 4RHRA 2A73B 3K0YA 1NCVA 2CHBD 1XNRL 1BCPD 1W6JA 1QZHA 4JI5L 5C6AA 4LNQA 4MIUA 1K28A 4HTHA 4X62L 3T1YL 4IUTA 4I7ZC 2K5QA 3PQIA 4FF2A 2PCFB 1IKMA 3OWEB 3CRLC 4A3IH 3TQYA 3VR6A 1EU4A 2IX3A 3RMHA 1QE6A 4LFCL 1J5EL 3S1NH 2I46A 4GS3A 1HNWQ 1TS2A 5M3MG 1CM9A 2NTSA 5E4XA 2FHTA 3VR3A 3A7LA 3CU7A 3H91A 1G6ZA 2IL8A 4A3CG 3PUYA 5E1FA 4PMBA 3OOCA 4RGTA 1FJGQ 5IT9c 4LAAA 2PW5A 4ME5A 5E4WC 1WCMG 5M3MB 1X56A 3HKZB 2AQ1B 2D5DA 3VYUA 2AWOA 3ULJA 1BVSA 1XMQQ 3U58A 4O2DA 3OMCA 5C3EB 1S72A 1IBMQ 3C3LA 2VQFL 5ELNA 1V1QA 1BR9A 1WCMB 1SMXA 5CV6A 2NBFA 2E76C 2MGSA 2R92B 5ELEA 2LKVA 4HIOA 4JK1C 4KN7C 4NP5A 5LMUL 1CSQA 2IW3A 3ULLA 3I4MH 2EY6A 2QKIC 2EZVA 3BDLA 3S1QB 3D6CA 4LUZA 2JA5H 1LUZA 3Q24A 3I72A 1YJNA 1D5XC 1UE1A 3EQLC 4FYDA 1I4PA 4HJ8A 3Q22A 4KHVA 5KYIA 1S5ED 3CF5A 5J39A 4OL7A 4CDDC 4KK7A 5C5MA 1RODA 5JVG3 4DK1A 5EPJA 4A3BG 4C2MH 1OO9B 3IFDA 2K03A 3ULPA 5G3LF 4YHHQ 2DNEA 3NEMA 1WTOA 4R8NA 2A6EC 2A19A 2X6GA 2A6HC 2VNUD 1EZ6A 2NUCA 3DWQA 5CBAE 1S4ZA 2CCZA 3K59A 3WOFA 1I6HH 1HNZL 3I73A 4PMCA 4A3BB 4OWTB 2RBMA 3ND8A 1HQRD 1SFOH 1UUPA 2E2JB 1EU3A 1GM5A 4APVA 4CKCA 1VMPA 3OMGA 4JV5L 2V4DA 2KA7A 1GUWA 2K5NA 3A5ZB 5D3IB 2UUBL 4C3HG 2EXZA 4LF5Q 1DYQA 1E3PA 4K0KL 1AH9A 1LABA 5C4HA 3SGIA 1GUSA 5EKLA 4JI8L 1ONLA 2F03A 1PZJD 3GTGH 3NTIA 2NN6G 5HURA 3ITPA 4C3HB 4OO1G 3PF5A 1JOKA 1Y1VH 1SRUA 3RZDH 5M3FH 1U0LA 3EA6A 3RLFA 5CV7A 2OQ0A 5I2YA 3RNUA 3KF6B 4GNXA 4G4KA 1AFPA 2VQEQ 1NNXA 2KENA 3D0FA 4OIKA 4A3DH 2PW7A 1JWSD 3J81E 1NMGA 3D4DA 1MGSA 1N32L 4RGNA 1UE5A 2VW9A 5IYCG 1JWUD 2A1AA 4JI3Q 4JI1L 1NTGA 4K8IA 4IFDH 4LJZC 1KRTA 2K50A 4XXEA 4DR5Q 3KBGA 2WAQE 3S9WA 2X6LA 2MO0A 1VS0A 1EY6A 3S1RB 3CKIB 5CV5A 5BN5A 1B9NA 5C4JH 2KHSA 1TS5A 3K6OA 1A8VA 1DM0B 3R93A 3GDEA 1VQPA 2JA6G 5C3WA 1Q12A 1MBYA 2A74C 5CR3A 1VQ5A 5IGBA 2IHEA 3K7AH 1B2TA 1F2LA 3A74A 1ZXTA 4LUOA 1HCZA 2Z6KC 4DV1L 2JA6B 2Y0SG 3FPUB 2EJMA 1WYDA 3NBHA 1EIFA 2O5IC 2NWGA 3KLSX 1XNQL 3OIQA 2Y0SB 4DV5L 5C44H 3W2DA 3MVVA 1R9TB 3WWVA 4A3JB 4IFDJ 2EYHA 2YYZA 3MTSA 2ZM6L 1PFBA 2EYLA 1CQFA 3E3XA 3J80E 3HP3A 4JI2Q 3A8JE 1NMFA 1G51A 3NXWA 4JYAL 2UUCL 4DAPA 2IT1A 1EY4A 4A3FB 2CH4W 1EQTA 2K4KA 2JA8H 1K8MA 2Z4HA 1KLGD 1P8LA 5AJ3L 2Z0SA 1BQQT 1QJOA 3VYSA 1EOVA 4DU9A 4JG2A 5IGGA 4BBRG 4KN4C 1OXSC 3IL8A 2F0JA 2NZOA 2A69C 1W6KA 5C3EH 4IJHA 2WB1G 2PZTA 3NE5B 2AWNA 3MXGA 2HD3A 1F9QA 3KK7A 4BBRB 5HGTA 1KD1C 2R92H 2ZXPA 1B50A 4UAIA 3DUZA 3V05A 3NENA 3CPFA 2B2TC 2HCIA 3G48A 3BYTB 3HOYG 2ICIA 1EY0A 4DUYL 3TN2A 3UE1A 4RFBA 3T1HQ 2GA4B 4R4QA 3TREA 2JP1A 3M7NA 4RGOS 1SYBA 3J7A5 1LT5D 4KI0A 3GTQB 1WVLA 1XPOA 2ZXRA 1EY5A 2CW0D 2RVLA 3LX0A 3PO3G 1FVIA 1MSGA 2DJFC 1SYEA 1UWVA 3J81L 4JI5Q 3PUVA 2F0EA 4RH6A 3UDIA 4X62Q 4AYBE 2D9UA 1NJIC 2LS01 2RHSB 3QIAA 4KJNA 4KTAA 1IBML 1JB3A 3NQTA 1A2TA 3PO3B 1EEFD 2CQOA 4A3BH 5IGEA 5IYDG 2KHJA 3MA2B 5D65A 2IHFA 3SK5A 3GTKH 4LFCQ 1STAA 1J5EQ 4K6LA 1JJCB 1SBBB 2HIVA 2KJXA 4LMQD 4LF9Q 1QILA 2K52A 1TY0A 1G2SA 4DR4L 1SN8A 5JAVA 1Q3LA 4QQBX 5EGTA 4KHZA 2L15A 3TMEA 3J81i 3R2TA 5CMDA 2ZJRA 1XXGA 1SNDA 1PH4A 4Q0FA 2VQFQ 4A3IG 3OHXC 4DV2L 4EX5A 1AN8A 2UXDL 3T53B 1DJRD 4YHHL 1IBKL 1F9SA 2EY2A 3GTJB 4G7OC 1VQ4A 5JPNC 1IYVA 3BVZA 2KQ3A 1HUMA 3T13A 3TS2A 1W3SA 4H02A 2ZXOA 4MTNA 3UE0A 5LMUQ 2BH8A 4X64Q 1KAWA 3KUPA 4P2CB 3KDFA 4B3RQ 3T4AC 3NP8A 1O7LA 4FNFA 3KJPA 1MIUA 4IALA 3S1NB 1Q46A 4QGUA 4R9WA 3OW2A 2RSOA 1LTLA 4X3TA 1U5KA 4MTKA 4XQQA 3H15A 2TSSA 3J80L 5FLXE 5IYCH 3RD4A 4OWXB 4K5XA 1QUQB 4ZAIA 5FLMH 3K5MA 5M5XH 4YIJA 2PNHA 1LTBD 3S1RH 1E1TA 4DAYB 3CMAA 3TSSA 1HR0W 3I4MG 5DLQE 1E24A 3J7AV 1PZKD 3NK9A 2QEXA 3CCUA 1PHJA 2M2LA 3AQQA 2EXDA 5JOBA 1LT3D 4OX9Q 1VF7A 2F0DA 1H9MA 1HZBA 3A0JA 3I4MB 1HFNA 4DR2L 2UUBQ 4JCVE 3OTOQ 3I4NB 3J81c 2WP8J 4KMUC 4AIMA 5JVH3 4C56C 2R7FA 4JI8Q 3J80i 2JA9A 1U4LA 1PYSB 5I6WA 2EJGC 2Z4IA 2F0TA 3HKSA 4DR5L 1BBXC 2JEAI 3H3VH 2MP1A 3I3CA 3M7GA 3VR4A 1O7ZA 3DEOA 4G7ZC 4C2MB 2EOTA 1R9TH 4A3JH 4HEDA 3SE0A 1EOTA 1NAPA 1XWEA 2BA0A 3J7AF 2MJ8A 1I6HB 4LFAQ 1C4QA 1YIJA 2A6ED 3E9IA 1WFQA 1HTLD 4DNTB 2C5CA 2QDLA 3TDQA 2R61A 4ALPA 4IUNA 1G8ZD 1X6OA 1EUJA 5GQOA 1PYBA 4A3FH 4X3UA 3HOVH 1K8AC 1SE4A 1BKBA 3BJUA 3OW7A 4J6HA 3W1GA 1ICFB 1Q81C 2JEBI 2LY7A 1SNPA 5M3FG 2B39A 2PMZB 3GTGB 1VQKA 1SYCA 3FP9A 4J1MA 4A3DG 4IZ8A 2QCPX 1YVCA 4PV1C 2Q8RE 2B2VA 3CMEA 3RZDB 3K5NA 5M3FB 1GHJA 1YI2A 4PZ6A 4B3TL 2WIIB 3CC2A 3D4WA 5CGKA 2RSNA 2NTTA 4ULLA 3F2BA 5ELCA 4A3DB 3NWTA 1CQVA 4U673 5I2XA 4JI2L 3H6MA 1L1OC 4IFDG 1I4XA 4UHVA 5I4DA 4JBWA 4N9TA 4EQ5A 2F0GA 2B2YA 4DV1Q 1LACA 1UE6A 2B3GA 1BCPB 1VQNA 1D6EC 2G9HD 4DNIA 4DV7L 1WTVA 1WTPA 1PH5A 3OWFA 5K5PA 3J80c 1QWYA 1S5FD 4HN7A 1NSNS 1EQRA 1SYGA 2IX0A 2K7VA 2H1EA 2KUMA 3DMUA 2NVXH 1XNQQ 1EWIA 2N8NA 4R4TA 3URYA 1RHPA 4KHPL 4OHJA 4L5QA 4LF8L 4GN5A 5DAUA 2PO4A 2UU9Q 2EPBA 4FP5D 2L9HA 4R4IA 3PO3H 3PUZA 3QOJA 4ZK9B 4BA2I 2H5XA 4DGZA 5C4JB 1A6XA 3TZDA 4RG1A 5EAYA 4C1NK 1NBWA 1YJWA 5LMNW 4BXXG 1VQ6A 3DXJC 4IURA 5J3BA 3U4VA 1PMRA 4L6TB 3GO5A 4JYAQ 1JJ2A 3E0EA 2N49A 4EQNA 1RF2D 4PMWA 1X3EA 3CP0A 1X54A 5AJ3Q 1CT1D 1WTXA 2SEBD 3NTKA 5C44G 1EWCA 3U4ZA 1EZ8A 1RL2A 2RDFA 2EYOA 2Z1CA 4MHEA 2Q8IB 3KF6A 1PRTD 1E22A 4H7BA 3D8GA 4QIWB 1KDBA 2YTYA 1Q86C 4NXNL 5L37A 5C44B 5I6YA 2F3IA 3GTJH 1WD1A 1PH3A 2HHHL 1E0BA 4GNXC 4ZUJA 2DNCA 1RDPD 1D2BA 2K5HA 4DR1L 4P73A 2J0TD 2F0OA 4DUYQ 2ENBA 4XTCS 2JA8G 3A54A 4V0BA 1SMYD 1AZPA 3VA5A 4LF9L 3HKZG 2Q2IA 2C35B 1KC8C 3DLLA 4LF7L 4DV4L 3NSWA 4BS9A 5C3EG 1JC7A 2JA8B 1LYLA 2LSSA 1L0WA 1L0YB 2QGQA 2NVTB 1S5CD 2KBNA 4LUVA 2R92G 3CCQA 1B53A 2LXJA 5T1IA 2PNRC 1A15A 1M1KC 1RTOA 3ER0A 3NUCA 4X66L 5BN4A 4H44C 2A69D 5LHY1 2LFNA 2L4NA 1B9MA 5FOBB 1Q8IA 1B7YB 3I2ZA 4BBSB 3S14B 1BO0A 2AUJD 4X64L 4B3RL 3UDXA 4ZCKA 2OF1A 4ODGA 3MXUA 5ISRA 4POFA 4IUUA 3RLNA 5CV4A 3M4YA 3Q0AA 4DR4Q 4A3EB 1YZ6A 2F0VA 1CFMA 3I4NH 5IE8A 3C1FA 3CC4A 3MHBA 1IBLQ 2Z6BA 1ET6A 1K0RA 1S5BD 4DR6L 3S17H 2JQOA 3CHBD 4DV2Q 1EL0A 2UXDQ 1BDOA 1EY7A 3J7YW 5AFWA 4R8IA 1IBKQ 1QVCA 1N36L 2R7DA 3CCEA 3MXPA 5EQ0A 4B3ML 2VS1A 4IPDA 2HIXA 2PI2A 3JAME 1KQSA 1UE7A 1FGBD 1LT6D 4F88A 1PTOD 1KNEA 1WJJA 3W1BA 4NW2A 4CDEC 1BCPF 4OX9L 1FNWA 3GTKB 2RCNA 3SDZA 2R3ZA 4PNYA 4ABNA 4HCEA 5LMNL 1NUCA 1EYDA 1N33L 5I9OA 2OXPA 1TR5A 3OTOL 2OTJA 3F2UA 4FO2A 4FVMA 1K83B 4DFAA 1VQGA 3H0GH 4G57A 4FF4A 4H0LC 3TP7A 3M4QA 1SYDA 1ESRA 1TVXA 2JE6I 4JI7Q 2E75C 4HCSA 1KRSA 4IOCA 1O7YA 2FMMA 1KABA 2AMCB 2D0OA 4OELB 3MFGA 4S3SA 4LFAL 5JEAH 5C0XI 2ID0A 1EQQA 2XVSA 4LF4L 4KKTA 4CJ1B 2ATWA 1M90C 1LTTD 4L5SA 1CZGA 1KHIA 2FINB 2WB1E 1HQMC 1B44D 2WACA 3I4LA 1DONA 5D3DA 4HIKA 3KBXA 4DR2Q 2BA1A 4XYQA 4Y7NB 3SHLA 5FLMG 4BWGB 2Q2UA 4ILWA 4TQUS 1PA6A 1DGSA 4N8FA 3I7FA 3LNNA 1BBUA 1Q1EA 4GOPC 5M5XB 2EVBA 2FXQA 1TU2B 1Y8NB 3EIVA 4E6IA 3G6JB 1AE3A 3Q8DA 2PPBC 1KLUD 4XYOA 5C4XH 5IWAQ 1AE2A 4RAUC 1Q90A 3AFPA 1QNKA 4CKEA 2DUDA 2K33A 1GUGA 3CQZH 2N88A 2FMCA 4RA8A 1CUKA 5FO8B 2F4IA 2E5LL 2QEJC 1DZ1A 4EQPA 1B8AA 1U4RA 2OQKA 5A2QE 3G4SA 4UP8A 2ICEC 4GN3B 5CC4A 4BXXH 1P16A 2IPKD 5JEAJ 3BYYB 3M4PA 3PV0A 4OXPA 1PRTC 4DNRB 2B2UA 4A3JG 1YBYA 4P71A 3NPPA 2KVMA 2VY3A 4L5TA 1WTRA 4BY1H 3W5OA 2C9OA 4N8X1 1EYAA 3FPPA 1JWMD 2UU9L 4RHSA 3O13A 2ZTDA 1GHKA 4GKJL 1VQHA 1YNXA 3A55A 1CHQD 2E2IB 5ELBA 4B3TQ 1SMYC 1FR3A 1DD2A 4C1NI 1K73C 4A3FG 5KNDA 4KJOA 2L1BA 1XPUA 5DNFA 1VQAA 3HOVG 2GN5A 4F7XA 3A56A 2EYPA 1L1OB 3GV6A 3IFTA 4ZUIA 4DPGA 3ERQA 1V1PB 2N78A 3KLSA 1GUTA 3WDNA 3SXHA 4PZ7A 1QUQA 5HY6A 4DV7Q 2N3SA 1FNVA 1X3GA 3HOVB 4R4OA 3BDOA 2UXBL 2PZWA 5H1SE 3FEWX 3JAML 2QDBA 1ZYRD 5KRUA 1VQ8A 2ES2A 2NVTH 5J1ZA 4DAYA 1OTCA 3K58A 2NVQH 4KHPQ 1X55A 5LL6X 4LF8Q 1TWHB 5CYUA 2E2DC 1C7YA 2ZT9C 2F0LA 4Q5VA 1HA5A 1DXMA 2CWAA 3JC66 1YITA 4Z9CB 4CJ2C 1TT2A 3CRKC 2MQHA 1I94L 5I9PA 1HR0Q 2CKZB 2H4OA 5ELOA 3S14H 4BBSH 4N9PA 2O5JC 1MHWC 4DF7A 3C46A 4DR3L 2B2WC 2EY5A 4GKKL 4A3EH 3P75A 1VQLA 1PVOA 1G6PA 3F1ZA 1I50H 3DWAA 3MEHA 5EPKA 4KV6A 1HZCA 1RTNA 1FNUA 3VR5A 1YHBA 3DWPA 1F2MA 1TWCB 4DXGA 3JAMi 2ZJPA 3QOLA 1F9RA 1BOSA 2NVXB 2JN4A 3L9AX 1SE8A 2Z8LA 1Q82C 1BBWA 4RMFA 3TP5A 2D62A 4P75A 4NXNQ 1SJED 2A5HA 2HDMA 2HHHQ 4OIJA 1PTOC 1F2YA 4YWMA 1GVPA 2WAQB 4DR1Q 1Q7YC 4DAMA 3V2TA 5JJLA 4I65A 3EBEA 3Q23A 3RLOA 1E2WA 1HZ9A 1G291 1LTID 4DXFA 1OXVA 1VQCA 1STGA 2G9DA 2J7ZA 3VA7A 1GJXA 3GTLH 5FKAC
chains in the Genus database with same CATH topology
2XWBB 4KY6A 2L55A 3H09A 3QWNA 1QB5D 4L8JA 5EBDA 4K2LA 1DOMA 4HAEA 4CJ0B 1STNA 1H9KA 1M8AA 1FD7D 4K5WA 3E5SA 5K36H 2B2YC 1KAAA 3OSOA 1PDQA 3BVMA 2K01A 5C0XH 3EROA 1SE2A 3X3MA 3IKJA 1EYCA 4A93B 2NB0A 4ID6A 4DA2A 5C0XJ 2K28A 5LL6S 3PIO3 1TKWB 1TS4A 1UAPA 1ENAA 4V190 4C3IB 3A7AB 2VXWA 2N55A 1V43A 2BCOA 3RUZA 4EGVA 1YNND 1HUNA 3NHHA 3C2PA 4FF1A 1EQVA 3HOUB 1IKLA 4XT1B 1G91A 1A3TA 2VUMB 1LTAD 4QUFA 4KKUA 3S17B 2K1BA 2EE1A 3S2HB 1Y69U 2XRQD 5TSSA 4AYBB 3N52A 1F9PA 1SDFA 1T5EA 3OIPA 2NVYB 1ML0D 1ZYRC 1D5ZC 1NR4A 5ELDA 1D1KA 3H0GB 1TQOA 1JR0D 2XSCA 3HGBA 5JEAG 5EKIA 3EFXD 1H9RA 1PXUA 3N6RA 3TP6A 1TS3A 5KEEA 1QOHA 2IJ0A 1IW7C 2B8GA 1EY9A 1SE3A 1F77A 1H9SB 1ZKOA 2BDOA 2O2LD 4K5VA 1PRTB 1KDCA 4GZYC 4RKLA 4XDXA 3P1HA 1AZQA 3SVMA 3HRZC 3MWYW 4U68A 4H13C 2JXMB 1EFID 1F2ZA 5C4XB 4M1UB 1GUNA 3K5OA 2OT2A 4IUVA 3E6ZX 5FLXL 1LTGD 4XIGS 3CQZB 2K04A 3S2DB 3UI2A 2XN9C 3BG3A 2SDFA 2JSOA 1Z47A 4KY5A 3HEJA 4IUPA 1BF4A 3HOXB 1X3PA 3MZ5A 4C3JB 5KIXA 2VB2X 5G3LD 2PYKA 4BY1B 4IFDI 3PMFA 1EIGA 4CHTB 1U4PA 3NBIA 5BN3A 2F0SA 3EVQA 5JJZA 2F0MA 1XX8A 3S16B 2J4XA 4RWSC 1Z6HA 5C4ZA 2F0PA 3VYTA 2O4XA 4HMIA 1CK1A 3D31A 3ND9A 2PQEA 4A3KB 1ILPA 1HFGA 1I4RA 1STEA 4HSVA 3A8IE 1WTWA 3GV3A 2K05A 3PIP3 5T1GA 2NVQB 1RCVD 3HZXA 4X3SA 1STBA 2CQAA 4WJWA 3R8BA 1PTOB 2HUGA 3A8KE 3HOZB 4RCOA 1U9RA 2QILA 2L5TA 1CZWA 1WTQA 1YNNC 5C5LA 2KCCA 4WRDA 4IUQA 1TWAB 2B2UC 1PYWD 1I50B 1L0XB 3L7ZC 2L0CA 4OGQC 2IX1A 4EQOA 1YNJC 5KNBA 5DM63 1MI2A 2AQ3B 5EJWA 3AU7A 3EJIA 4F87A 1ENFA 1RJTA 2WKCA 3LWUA 1VCIA 2CVRA 4F8MA 3S1MB 2SOBA 5IIFA 1TIID 2F0QA 5ELFA 2YU9B 1V1PA 1BUVT 5E3FA 1C48A 1JE4A 1LO5D 5C0XG 3FDTA 1E2ZA 3BVGA 4DN4M 1J8IA 3M4OB 4B9WA 3D3RA 1MSHA 2F3VA 3IAYA 1PRTF 4BA1I 1A3UA 3GTLB 3PUWA 2A68D 3P7JA 1BNZA 2LMCB 2XIWA 1LTRD 3TZUA 1B3AA 1V8QA 2TMPA 1I4QA 3QJYA 3S15B 3SEBA 3VR2A 3NTHA 3AMUA 5IOCA 5K36G 4K14A 3R3OA 2FJ2A 3V96A 3PO2B 1JORA 1QG7A 2M9VA 2QF7A 5COYA 1EEID 2F0IA 3SK6A 3GTPB 1Y1WB 1M4VA 3DHQA 4HSPA 3AB9A 4XQNA 3GTMB 1SSOA 4K2KA 1A3VA 3K5LA 1SYFA 1J9OA 4TSSA 1T5XD 2RDGA 4XT3B 2R6GA 1KNAA 3MC0B 3T56B 1E2VA 1HHVA 4RGMA 2K6AA 1ET9A 2I07B 2F3WA 1IHZA 5EKKA 1Y8PB 1H9JA 3MFYA 3I8ZA 4QB4A 2NN6I 3NQIA 1SNQA 4M8AA 2RA4A 4OO1I 2EY1A 4L63B 3K57A 1GOZA 3D4RA 1VMCA 1CI3M 4CKBA 1Q1BA 2F1MA 1HXYD 1D5MC 4X3KA 4RKBA 1OXXK 3I91A 2BE5C 1PTOF 2AUKA 1AW7A 4ZQ3A 1PZID 1EWHA 1O80A 2R93B 4EVOA 1BCPC 4TKOB 2F0NA 1AP0A 3ONAB 2KEEA 1TWFB 2FFKB 4ZKCB 4HR7B 2BOSA 2X69A 3OPOA 5IODA 4FXKC 5M5YB 5CORA 1A2UA 1OXTA 3WOEA 1KTKA 1ENCA 2DY7A 4BY7B 4ZLTF 3RZOB 1UEAB 3MAQA 1I3QB 5IGDA 3SK4A 1PTOH 2RKSA 2EJFC 3M3YB 1SJHD 1PFMA 3GD7A 1X32A 4QUCA 1DOLA 5M9OA 2SNSA 2XWJB 3M85A 1IW7D 1FYCA 1TWGB 4KY7A 5NUCA 1Z7TA 1C8CA 2L12A 4FF3A 3TP8A 2WB1B 5J22A 4NMZA 4MN3A 4K6DA 3I70A 4KD3A 2PZUA 4PQXA 1QNUA 5IGCA 1IL8A 3HS0C 2B63B 1D1IA 2B8FA 5KGUA 5D14A 2KOLA 3HOYB 5DM73 3L3OC 2D2CC 2E2HB 1ESFA 1DCZA 2OEOA 4CBVA 4NDXA 2AQ2B 2BDNA 1K8OA 2A68C 4UDUC 3QG1A 4KD4A 4A3MB 3R2IA 4QF4A 2E74C 1I4GA 1LV9A 3GP7A 5FO7B 3T51B 4A3GB 5CV9A 3Q6SA 2JYOA 2K5WA 5EBCA 1JICA 1HA6A 3SK8A 1IYUA 5IT9E 4ZKBB 2RQXA 5A2QL 2B2VC 2F0UA 3U9OA 3VYRA 1G2TA 4WFN3 1H9SA 1JQYD 2K5DA 2WV6D 2MUYA 2EYFA 1I4HA 5KNCA 1X3QA 1DOKA 3U9SA 1AEXA 2M00A 1JOQA 2DN8A 1R4QB 3QB3A 3PUXA 4LK1C 1GUOA 2KCNA 2NN6H 2XNAC 3P20A 4OO1H 4A3IB 3W3AA 2NYZD 4C3IG 2R7ZB 1R4PB 3SR1A 4NKLA 1Y8OB 1HRJA 1SNMA 3QO2A 3HOWB 1JCKB 1RD9D 1B1ZA 2WKDA 3G7LA 2JA7B 1ILQA 1TY2A 1SEBD 4G7HC 1STYA 3TBIB 1UNSA 2F0FA 1ICWA 1NR2A 2KECA 2HDLA 1LTSD 2B2TA 3ZYYX 4KKSA 2WINB 1YNJD 5JPMC 4TRDA 2B2WA 1JOOA 4IN3A 2JA5B 1LT4D 1BXTA 1RKNA 3DEPA 3DM1A 5KYLA 2F0KA 2RDHA 1SAPA 1EIHA 1PLFA 4O42A 1VDZA 1XYIA 5FO9B 3C1EA 1V1OA 1LLRD 4FXDA 1HTPA 1U4MA 1SXTA 4HMJA 1EY8A 2A6HD 3FVQA 2NZ1D 4RCNA 3T16A 4K8JA 2EYMA 2EYJA 4O1NA 1CA6A 3E0JA 1SFOB 4QMGA 1I6VC 2KEDA 1B4OA 2MPMA 3NWSA 3LWEA 4J8QA 3BS1A 3FMCA 4DAVA 1CA5A 4ZYSA 3D6WA 3GQBA 5IT9L 1ZEQX 3HG9A 1SNOA 3H3VC 2F0HA 5DEHA 5CBEE 2L11A 2XRSD 3MXNA 1STHA 2DY8A 2K32A 1Y1VB 5A35A 3H94A 1XTCD 4ZRZA 1OXUA 5FK9C 2F0WA 1QCBD 5IGFA 1VF5C 3GTOB 1MD2D 1WD0A 2Q8TA 3FRPB 2CW0C 4B08A 3X3NA 4B9XA 2SNMA 4WORA 2HQEA 1CHPD 3FKIB 5M5WB 2IWHA 3KF8A 5F2DA 1GXDC 2EDGA 4IQZA 1S5DD 4DK0A 4C3JG 2HCCA 2VB3X 1KDAA 3KLRA 3BZDB 3I90A 5CV8A 1II3A 1PFNA 4CGYB 1HPCA 3K7AB 4QCLA 5C3XA 5EPLA 2BE5D 4XQJA 3BDCA 1CTMA 1O78A 2MHVA 4FXGC 1SNCA 4RHRA 2A73B 3K0YA 1NCVA 2CHBD 1BCPD 1W6JA 5C6AA 4MIUA 4HTHA 4IUTA 4I7ZC 2K5QA 4FF2A 2PCFB 1IKMA 3OWEB 3CRLC 3VR6A 1EU4A 2IX3A 3RMHA 1QE6A 2I46A 1TS2A 1CM9A 2NTSA 5E4XA 3VR3A 2FHTA 3A7LA 3CU7A 3H91A 1G6ZA 2IL8A 3PUYA 5E1FA 4PMBA 3OOCA 4RGTA 4LAAA 2PW5A 4ME5A 5E4WC 5M3MB 3HKZB 2AQ1B 2D5DA 3VYUA 2AWOA 3OMCA 5C3EB 3C3LA 1BR9A 1WCMB 5CV6A 2NBFA 2E76C 2MGSA 2R92B 5ELEA 2LKVA 4JK1C 4KN7C 4NP5A 2IW3A 2EY6A 2QKIC 2EZVA 3BDLA 3S1QB 3D6CA 3Q24A 3I72A 1D5XC 4FYDA 3EQLC 1I4PA 3Q22A 4KHVA 5KYIA 1S5ED 5J39A 4OL7A 4KK7A 5C5MA 1RODA 5JVG3 4DK1A 5EPJA 1OO9B 3IFDA 2K03A 5G3LF 2DNEA 1WTOA 4R8NA 2A6EC 2X6GA 2A6HC 2VNUD 1EZ6A 2NUCA 3DWQA 5CBAE 1S4ZA 3K59A 3WOFA 3I73A 4PMCA 4A3BB 2RBMA 3ND8A 1HQRD 1UUPA 2E2JB 1EU3A 4CKCA 1VMPA 3OMGA 2V4DA 2KA7A 1GUWA 5D3IB 4C3HG 2EXZA 1DYQA 1LABA 5C4HA 1GUSA 5EKLA 2F03A 1ONLA 1PZJD 3NTIA 2NN6G 5HURA 3ITPA 4C3HB 4OO1G 1JOKA 3EA6A 3RLFA 5CV7A 5I2YA 4G4KA 1AFPA 4OIKA 2PW7A 1JWSD 3J81E 3D4DA 1MGSA 4RGNA 1JWUD 4K8IA 4IFDH 4LJZC 4XXEA 3KBGA 3S9WA 2X6LA 1EY6A 3S1RB 3CKIB 5CV5A 5BN5A 1B9NA 2KHSA 1TS5A 3K6OA 1DM0B 3R93A 5C3WA 1Q12A 1MBYA 2A74C 5CR3A 5IGBA 1B2TA 1F2LA 1ZXTA 1HCZA 2JA6B 3FPUB 2EJMA 3NBHA 2O5IC 2NWGA 3KLSX 3OIQA 2Y0SB 3W2DA 3MVVA 1R9TB 4A3JB 4IFDJ 2EYHA 2YYZA 3MTSA 1PFBA 2EYLA 1CQFA 3J80E 3HP3A 3A8JE 3NXWA 4DAPA 2IT1A 1EY4A 4A3FB 1EQTA 1K8MA 2Z4HA 1KLGD 1BQQT 1QJOA 3VYSA 4DU9A 5IGGA 4KN4C 1OXSC 3IL8A 2F0JA 2A69C 1W6KA 2PZTA 3NE5B 2AWNA 3MXGA 1F9QA 3KK7A 4BBRB 5HGTA 2ZXPA 1B50A 4UAIA 3DUZA 3V05A 2B2TC 2HCIA 3BYTB 2ICIA 1EY0A 3TN2A 4RFBA 2GA4B 2JP1A 3M7NA 4RGOS 1SYBA 1LT5D 4KI0A 3GTQB 1WVLA 2ZXRA 1EY5A 2CW0D 2RVLA 3LX0A 1MSGA 1SYEA 3J81L 3PUVA 2F0EA 4RH6A 2D9UA 2LS01 3QIAA 4KJNA 4KTAA 1JB3A 3NQTA 1A2TA 3PO3B 1EEFD 5IGEA 3MA2B 5D65A 3SK5A 1STAA 4K6LA 1SBBB 2KJXA 4LMQD 1QILA 1TY0A 1G2SA 5JAVA 1Q3LA 5EGTA 4KHZA 3TMEA 3R2TA 5CMDA 1XXGA 1SNDA 4Q0FA 3OHXC 1AN8A 3T53B 1DJRD 1F9SA 2EY2A 3GTJB 4G7OC 5JPNC 1IYVA 3BVZA 2KQ3A 1HUMA 3T13A 2ZXOA 3KUPA 4P2CB 3T4AC 3NP8A 1O7LA 4FNFA 3S1NB 4IALA 4R9WA 2RSOA 4X3TA 4XQQA 2TSSA 3J80L 5FLXE 3RD4A 4K5XA 4ZAIA 3K5MA 4YIJA 1LTBD 3TSSA 3J7AV 1PZKD 3NK9A 2M2LA 5JOBA 1LT3D 1VF7A 2F0DA 1H9MA 3I4MB 1HFNA 3I4NB 2WP8J 4KMUC 5JVH3 4C56C 1U4LA 5I6WA 2EJGC 2Z4IA 2F0TA 1BBXC 2JEAI 2MP1A 3I3CA 3M7GA 3VR4A 1O7ZA 3DEOA 4G7ZC 4C2MB 2EOTA 4HEDA 3SE0A 1EOTA 1NAPA 1XWEA 2BA0A 3J7AF 2MJ8A 1I6HB 1C4QA 2A6ED 1HTLD 4DNTB 2C5CA 3TDQA 2R61A 4IUNA 1G8ZD 4X3UA 1SE4A 3OW7A 4J6HA 2JEBI 2LY7A 1SNPA 2B39A 2PMZB 3GTGB 1SYCA 4J1MA 4IZ8A 2QCPX 4PV1C 2Q8RE 2B2VA 3RZDB 3K5NA 5M3FB 1GHJA 2WIIB 3D4WA 5CGKA 2RSNA 2NTTA 4ULLA 5ELCA 4A3DB 3NWTA 1CQVA 4U673 5I2XA 3H6MA 4IFDG 1I4XA 5I4DA 4JBWA 4N9TA 2F0GA 2B2YA 1LACA 1BCPB 1D6EC 2G9HD 1WTVA 1WTPA 3OWFA 5K5PA 1QWYA 1S5FD 4HN7A 1NSNS 2K7VA 1SYGA 2IX0A 2H1EA 2KUMA 3DMUA 3URYA 1RHPA 4OHJA 5DAUA 2PO4A 2EPBA 4FP5D 2L9HA 3PUZA 3QOJA 4ZK9B 4BA2I 4DGZA 5C4JB 1A6XA 3TZDA 4C1NK 3DXJC 4IURA 1PMRA 4L6TB 3GO5A 4EQNA 1RF2D 4PMWA 1WTXA 1CT1D 2SEBD 3NTKA 1EWCA 1EZ8A 2RDFA 2EYOA 2Z1CA 4MHEA 2Q8IB 1PRTD 4H7BA 3D8GA 4QIWB 1KDBA 5C44B 5I6YA 1WD1A 1E0BA 4ZUJA 2DNCA 1RDPD 1D2BA 2J0TD 2F0OA 2ENBA 4XTCS 3A54A 4V0BA 1SMYD 1AZPA 3VA5A 3NSWA 4BS9A 1JC7A 2JA8B 1L0YB 2NVTB 1S5CD 1B53A 5T1IA 2PNRC 1A15A 1RTOA 3NUCA 5BN4A 4H44C 2A69D 5LHY1 2LFNA 2L4NA 1B9MA 5FOBB 1Q8IA 4BBSB 3S14B 1BO0A 2AUJD 2OF1A 4ODGA 3MXUA 5ISRA 4IUUA 5CV4A 3M4YA 3Q0AA 4A3EB 2F0VA 1CFMA 3C1FA 3MHBA 1ET6A 1S5BD 3CHBD 1EL0A 1BDOA 1EY7A 3J7YW 5AFWA 4R8IA 3MXPA 5EQ0A 3JAME 1FGBD 1LT6D 4F88A 1PTOD 1KNEA 4NW2A 1BCPF 1FNWA 3GTKB 3SDZA 2R3ZA 4PNYA 4ABNA 4HCEA 1NUCA 1EYDA 5I9OA 2OXPA 1TR5A 3F2UA 4FO2A 4FVMA 1K83B 4DFAA 4G57A 4FF4A 4H0LC 3TP7A 1SYDA 1ESRA 1TVXA 2JE6I 2E75C 4HCSA 1O7YA 2FMMA 1KABA 3MFGA 4S3SA 5JEAH 5C0XI 2ID0A 2XVSA 4KKTA 4CJ1B 1LTTD 1CZGA 2FINB 1HQMC 1B44D 2WACA 3I4LA 1DONA 5D3DA 3KBXA 2BA1A 4XYQA 4Y7NB 3SHLA 4BWGB 4ILWA 4TQUS 3LNNA 1Q1EA 5M5XB 2EVBA 1TU2B 1Y8NB 4E6IA 3G6JB 2PPBC 1KLUD 4XYOA 4RAUC 1Q90A 1QNKA 4CKEA 2K33A 1GUGA 2N88A 2FMCA 4RA8A 5FO8B 2F4IA 2QEJC 1DZ1A 4EQPA 1U4RA 5A2QE 2ICEC 5CC4A 2IPKD 5JEAJ 3BYYB 3PV0A 1PRTC 4DNRB 2B2UA 3NPPA 2KVMA 1WTRA 2C9OA 1EYAA 3FPPA 1JWMD 4RHSA 3O13A 1GHKA 3A55A 2E2IB 1CHQD 5ELBA 1SMYC 1FR3A 1DD2A 4C1NI 5KNDA 4KJOA 2L1BA 5DNFA 4F7XA 3A56A 2EYPA 3GV6A 3IFTA 4ZUIA 3ERQA 1V1PB 3KLSA 1GUTA 3WDNA 3SXHA 1FNVA 3HOVB 3BDOA 2PZWA 3FEWX 3JAML 2QDBA 1ZYRD 5KRUA 5J1ZA 4DAYA 3K58A 5LL6X 1TWHB 5CYUA 2E2DC 2ZT9C 2F0LA 4Q5VA 1HA5A 1DXMA 4Z9CB 4CJ2C 1TT2A 3CRKC 5I9PA 2H4OA 4N9PA 2O5JC 4DF7A 3C46A 2B2WC 2EY5A 3P75A 3DWAA 3MEHA 5EPKA 4KV6A 1RTNA 1FNUA 3VR5A 3DWPA 1F2MA 1TWCB 4DXGA 3QOLA 1F9RA 1BOSA 2NVXB 3L9AX 2Z8LA 3TP5A 2D62A 1SJED 2A5HA 2HDMA 4OIJA 1PTOC 1F2YA 2WAQB 3V2TA 4I65A 3Q23A 1E2WA 1G291 1LTID 4DXFA 1OXVA 1STGA 2G9DA 2J7ZA 3VA7A 1GJXA 5FKAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQ3 A;  4KD3 A;  4KY6 A;  1TR5 A;  2PZU A;  4QB4 A;  3T13 A;  4DU9 A;  2SOB A;  4F8M A;  5IGG A;  5IIF A;  1SNQ A;  2F0Q A;  2PW7 A;  5IGC A;  1SNP A;  2F0O A;  2EY1 A;  4DFA A;  3OMC A;  3D4D A;  5E3F A;  2F0J A;  4B9X A;  4KJO A;  2ENB A;  3HEJ A;  4G57 A;  4KY5 A;  5KGU A;  2SNM A;  3NP8 A;  2PZT A;  4WOR A;  4IAL A;  4F7X A;  2HQE A;  3MZ5 A;  2EYP A;  2OEO A;  5CV6 A;  4K2L A;  1SYC A;  3TP7 A;  4ZUI A;  3VA5 A;  1SYD A;  4J1M A;  3ERQ A;  4RKB A;  1STY A;  5KIX A;  5HGT A;  4IZ8 A;  4NDX A;  3SXH A;  2LKV A;  4K8I A;  2F0F A;  5F2D A;  4B9W A;  2PYK A;  1STN A;  2F3V A;  4ZQ3 A;  4KD4 A;  4NP5 A;  3PMF A;  1A3U A;  1KAB A;  3D4W A;  4QF4 A;  5CGK A;  4S3S A;  2PZW A;  1EY0 A;  3S9W A;  2F0S A;  2EY6 A;  2QDB A;  4K5X A;  4TRD A;  3BDL A;  3EVQ A;  3D6C A;  4EVO A;  5KRU A;  5J1Z A;  1JOO A;  2F0M A;  2F0N A;  5CV9 A;  3H6M A;  4K5W A;  3E5S A;  1EY6 A;  4YIJ A;  4N9T A;  1SYB A;  2F0G A;  1RKN A;  1TQO A;  5CV5 A;  1KAA A;  1KDA A;  2WAC A;  3OSO A;  3SK8 A;  3NUC A;  5C4Z A;  2F0P A;  5KYL A;  2F0L A;  4KHV A;  2KHS A;  1II3 A;  2O4X A;  4HMI A;  1EY5 A;  3OWF A;  5CV8 A;  5I9O A;  5K5P A;  2F0K A;  4OL7 A;  3SHL A;  5KYI A;  5C5M A;  5J39 A;  5C3W A;  5IOC A;  5C6A A;  3LX0 A;  5CR3 A;  3NK9 A;  3ERO A;  1NSN S;  5IOD A;  1SYG A;  2PQE A;  1TT2 A;  5IGB A;  1SYE A;  4K14 A;  2F0U A;  3C1E A;  3U9O A;  5I9P A;  5JOB A;  1A2U A;  2F0E A;  3TP6 A;  3R3O A;  3DMU A;  2F0D A;  1EYC A;  5C3X A;  5KEE A;  3BDC A;  1ENC A;  4KJN A;  4R8N A;  4KTA A;  3SK5 A;  5J22 A;  1EZ6 A;  2NUC A;  4ID6 A;  4N9P A;  2OF1 A;  4ODG A;  3NQT A;  2EYF A;  4HMJ A;  1A2T A;  5DAU A;  1SNC A;  4DF7 A;  5ISR A;  1JOR A;  2EY5 A;  4PMC A;  4E6I A;  1EY9 A;  1EY8 A;  2F0I A;  3QOJ A;  5CV4 A;  3SK6 A;  5IGE A;  3HZX A;  1AEX A;  2F0V A;  2M00 A;  2RBM A;  1STB A;  3P75 A;  3T16 A;  4DGZ A;  3C1F A;  1JOQ A;  4K8J A;  1ENA A;  2EYM A;  2EYJ A;  3DHQ A;  3MEH A;  3MHB A;  4K5V A;  4MIU A;  4HTH A;  4KV6 A;  5IGD A;  3SK4 A;  2RKS A;  1STA A;  1U9R A;  1KDC A;  5I6W A;  2F0T A;  4QMG A;  1F2M A;  4K2K A;  4RKL A;  5CV7 A;  3OMG A;  3QB3 A;  3QOL A;  1A3V A;  3MVV A;  3P1H A;  4ME5 A;  1SYF A;  4EQP A;  3RUZ A;  3TP5 A;  2EYH A;  1EY7 A;  5JAV A;  2EXZ A;  4EQN A;  5C4H A;  5M9O A;  5CC4 A;  2EYL A;  3MXP A;  5C5L A;  2SNS A;  3SR1 A;  5EGT A;  5EKL A;  1SNO A;  4WRD A;  3NHH A;  4NKL A;  3TME A;  1EZ8 A;  1F2Y A;  2RDF A;  2F0H A;  1EQV A;  1F2Z A;  5DEH A;  2EYO A;  5HUR A;  3NXW A;  3ITP A;  4ZUJ A;  1A3T A;  3V2T A;  1SNM A;  1STH A;  1SND A;  4KY7 A;  4I65 A;  5NUC A;  4H7B A;  4IUN A;  1JOK A;  3D8G A;  4EQO A;  1KDB A;  5E1F A;  4PNY A;  1EY4 A;  2F3W A;  4PMB A;  1IHZ A;  3TP8 A;  5I6Y A;  5EKK A;  1NUC A;  1EYD A;  1EYA A;  2EY2 A;  2F0W A;  1STG A;  3EJI A;  4LAA A;  4NMZ A;  4K6D A;  4J6H A;  5IGF A;  2PW5 A;  2OXP A; 
#chains in the Genus database with same CATH topology
 2XWB B;  1SLJ A;  4IJL A;  4KY6 A;  4LF7 Q;  4DV4 Q;  2L55 A;  3H09 A;  3QWN A;  1K83 H;  5FJ8 H;  3ERS X;  1IBL L;  1B3Q A;  1B70 B;  3S15 H;  1QB5 D;  3U50 C;  4L8J A;  5EBD A;  2F4V Q;  4K2L A;  2VZA A;  1DOM A;  4HAE A;  2YV5 A;  4DK6 C;  1A63 A;  4CJ0 B;  4X66 Q;  1STN A;  1H9K A;  1PH9 A;  1M8A A;  1FD7 D;  4K5W A;  3E5S A;  5K36 H;  1T9H A;  2B2Y C;  1PV4 A;  1KAA A;  3OSO A;  4JW0 A;  2D0P A;  5IP7 H;  1PFS A;  1HNX Q;  4A93 G;  4JI6 Q;  1PDQ A;  3BVM A;  2ALY B;  1CKN B;  2K01 A;  4IPC A;  3QR8 A;  4Y7N H;  5C0X H;  3JAM c;  2RCF A;  3ERO A;  3CD6 A;  3GTM H;  1SE2 A;  3X3M A;  2G5D A;  3IKJ A;  3EN2 A;  3J7Z C;  1Q8K A;  1EYC A;  4A93 B;  1VQO A;  2NB0 A;  4UP9 A;  4ID6 A;  4DA2 A;  5GAD C;  4DR6 Q;  5C0X J;  2K28 A;  4JI0 L;  5LL6 S;  3PIO 3;  1TKW B;  1TS4 A;  1UAP A;  4JI7 L;  1N36 Q;  1ENA A;  4V19 0;  2E8G A;  1K3B C;  4YWL A;  4C3I B;  4B3M Q;  3RN5 A;  2YTV A;  3A7A B;  2VXW A;  2N55 A;  2K5V A;  2Q2H A;  1V43 A;  3I4N G;  1VQI A;  1YEZ A;  4WJ4 A;  2BCO A;  3RUZ A;  1K8G A;  5LMN Q;  1IL2 A;  2PQA B;  1N33 Q;  4EGV A;  1FGU A;  1YNN D;  1HUN A;  3NHH A;  3C2P A;  4FF1 A;  1EQV A;  3HOU B;  1IKL A;  4XT1 B;  1G91 A;  1A3T A;  3K81 C;  2VUM B;  1LTA D;  1IZ6 A;  4QUF A;  4KKU A;  3S17 B;  1VQB A;  2K1B A;  3I4O A;  2EE1 A;  3S2H B;  2E2I H;  1Y69 U;  4GLX A;  2BH2 A;  5IWA L;  2XRQ D;  5TSS A;  4AYB B;  4JBM A;  4LF4 Q;  3N52 A;  4LW1 A;  3M9B A;  3BU2 A;  1F9P A;  1SDF A;  1T5E A;  3OIP A;  2NVY B;  1ML0 D;  1ZYR C;  3H0G G;  1ASY A;  1D5Z C;  1NR4 A;  5ELD A;  4JPB W;  4JC0 A;  4BY7 H;  2I5H A;  1D1K A;  2JJQ A;  3H0G B;  3CCS A;  3RZO H;  1TQO A;  1JR0 D;  4GOP B;  1TWH H;  4IPH A;  2XSC A;  3HGB A;  3HKZ E;  5JEA G;  2I5L X;  3S24 A;  5EKI A;  1VQF A;  3EFX D;  1H9R A;  1E7Z A;  1PXU A;  3M3Y H;  3N6R A;  3TP6 A;  1TS3 A;  1IXR A;  5KEE A;  1QOH A;  1QVG A;  2IJ0 A;  1IW7 C;  2B8G A;  2E5L Q;  1EY9 A;  1SE3 A;  2JK8 A;  2ZJQ A;  1F77 A;  1H9S B;  5IY0 A;  1ZKO A;  2BDO A;  2O2L D;  4IOA A;  4K5V A;  1CKM A;  1TWG H;  2MNA A;  1PRT B;  1KDC A;  4GZY C;  4RKL A;  4XDX A;  4PG3 A;  1TWC H;  3KOJ A;  2F52 A;  3P1H A;  2DGY A;  1AZQ A;  5C4X G;  3SVM A;  3HRZ C;  3MWY W;  4U68 A;  4H13 C;  2ASB A;  2B63 H;  2JXM B;  1YHA A;  4GKJ Q;  4YCW A;  1EFI D;  1F2Z A;  5C4X B;  4M1U B;  1GUN A;  4B3S Q;  3K5O A;  2OT2 A;  4IUV A;  3E6Z X;  5FLX L;  1X9N A;  1Y14 B;  4MZ9 A;  1HR0 L;  1LTG D;  2XGT A;  1J6Q A;  1SRO A;  4XIG S;  3CQZ B;  2K04 A;  3S2D B;  4A3M H;  3UI2 A;  1FL0 A;  3HOX G;  1S3O A;  3UDG A;  1VQD A;  2XN9 C;  1RIP A;  2P5Z X;  3BG3 A;  2SDF A;  2UXB Q;  2JSO A;  4BY1 G;  1Z47 A;  4KY5 A;  3HEJ A;  4P72 A;  4LF6 Q;  4X6A H;  4IUP A;  1W2B A;  4HJ9 A;  1BF4 A;  3HOX B;  1X3P A;  3MZ5 A;  3KFU A;  1HZA A;  1XPR A;  4C3J B;  5KIX A;  4A76 A;  2VB2 X;  5G3L D;  2PYK A;  4BY1 B;  4IFD I;  3PSI A;  3PMF A;  1EIG A;  4CHT B;  1U4P A;  3NBI A;  5BN3 A;  2F0S A;  2HQL A;  3EVQ A;  1I94 Q;  5JJZ A;  2F0M A;  1HH2 P;  4JVZ A;  4A3K G;  1H95 A;  1XX8 A;  3S16 B;  2J4X A;  1CKO A;  4RWS C;  1Z6H A;  5C4Z A;  2F0P A;  4DR3 Q;  3VYT A;  1MJC A;  2O4X A;  4HMI A;  4YCV A;  3IRB A;  5IYB H;  4GKK Q;  4QY7 A;  1CK1 A;  3D31 A;  3ND9 A;  4IPG A;  2PQE A;  4A3K B;  1ILP A;  1HFG A;  1XJV A;  1I4R A;  1STE A;  4HSV A;  5IP9 H;  4A93 H;  1N34 L;  3A8I E;  1VQE A;  2QW7 A;  3GV3 A;  1WTW A;  2K05 A;  3CW2 C;  3PIP 3;  3HOZ G;  2R7Z H;  5T1G A;  2F4V L;  2NVQ B;  1RCV D;  3BZC A;  3HZX A;  4X3S A;  4DK3 C;  1STB A;  2CQA A;  3KYH C;  4WJW A;  3R8B A;  1PTO B;  4BBS G;  2HUG A;  2K75 A;  3A8K E;  3HOZ B;  4C3I H;  4RCO A;  4CDF C;  1ASZ A;  3CC7 A;  1U9R A;  2QIL A;  3HOW H;  2L5T A;  4IO9 A;  3I55 A;  1CZW A;  4A3E G;  1WTQ A;  1YNN C;  3TRZ A;  2RF4 A;  3AFQ A;  1YJ9 A;  5BR8 L;  1HNX L;  4DV3 Q;  5C5L A;  3E9H A;  1S40 A;  4JI6 L;  2KCC A;  4WRD A;  2JA7 H;  1K0S A;  4IUQ A;  1TWA B;  2B2U C;  4HJ5 A;  3HOU H;  4GLA C;  1PYW D;  1I50 B;  1L0X B;  3L7Z C;  3PCO B;  2L0C A;  2VUM H;  4OGQ C;  2IX1 A;  1Z9F A;  4EQO A;  1YNJ C;  5KNB A;  5DM6 3;  1MI2 A;  2AQ3 B;  2WFW A;  5EJW A;  3AU7 A;  3K7U C;  3MXN B;  3EJI A;  4F87 A;  1ENF A;  1RJT A;  2WKC A;  3LWU A;  2I0Q A;  1VCI A;  2CVR A;  2V1C C;  4F8M A;  5JJK A;  1PH2 A;  3S1M B;  2SOB A;  4JOI A;  2I5M X;  4O0A A;  5E7N A;  1TII D;  5IIF A;  2F0Q A;  5ELF A;  1L1O A;  3S2H H;  2Y0S E;  5FLX c;  1UEB A;  2YU9 B;  1V1P A;  1BUV T;  5E3F A;  1C48 A;  1JE4 A;  2GVA A;  3CCJ A;  1LO5 D;  5C0X G;  3K0X A;  3FDT A;  1E2Z A;  2MFI A;  4YY3 Q;  5GAH C;  3BVG A;  4DN4 M;  3ZJY C;  1J8I A;  3M4O B;  2OCE A;  4B9W A;  4R1J A;  3D3R A;  1MSH A;  2F3V A;  2NVY H;  5FJ8 G;  3IAY A;  1PRT F;  4FDB A;  4BA1 I;  1A3U A;  3GTL B;  3PUW A;  3PF4 A;  2A68 D;  3CCL A;  3KF8 B;  3P7J A;  1BNZ A;  2LMC B;  2XIW A;  1LTR D;  3TZU A;  1B3A A;  1V8Q A;  2TMP A;  2PI2 E;  1I4Q A;  3QJY A;  3S15 B;  3F8T A;  3SEB A;  3VR2 A;  3NTH A;  1I5F A;  4JI0 Q;  3AMU A;  5IOC A;  3PO2 G;  4AQY Q;  2OWO A;  5K36 G;  4K14 A;  4UPA A;  3R3O A;  4Y52 H;  2FJ2 A;  3V96 A;  5IP7 G;  2KCM A;  1A0I A;  1Y1W G;  5GAG C;  4DV0 L;  3PO2 B;  1JOR A;  1QG7 A;  2M9V A;  2QF7 A;  5COY A;  1VQM A;  1EEI D;  2AKW B;  2F0I A;  1K9M C;  3TS0 A;  3SK6 A;  3GTP B;  4HJA A;  1Y1W B;  4JI4 Q;  4ME3 A;  2Z9H A;  1M4V A;  3DHQ A;  3CCM A;  1O7I A;  3I56 A;  4HSP A;  1HJP A;  3AB9 A;  4XQN A;  3GTM B;  1SSO A;  4K2K A;  1A3V A;  4LFB L;  5GAE C;  3K5L A;  1SYF A;  3PIO A;  4DUZ Q;  3GTO H;  1J9O A;  4TSS A;  1T5X D;  4I7A A;  2RDG A;  4XT3 B;  2QA4 A;  2R6G A;  1KNA A;  3FKI H;  3MC0 B;  1E2V A;  3T56 B;  5M5W H;  4RGM A;  1HHV A;  2CFM A;  2CWP A;  3G71 A;  2K6A A;  4OWW B;  1ET9 A;  2I07 B;  4NXM L;  2F3W A;  1VQ7 A;  1IHZ A;  5EKK A;  1VQJ A;  3S2D H;  1Y8P B;  1H9J A;  3MFY A;  4DR7 L;  3I8Z A;  3CXC A;  4QB4 A;  2NN6 I;  4HID A;  3NQI A;  1SNQ A;  4M8A A;  1EFW A;  2RA4 A;  4OO1 I;  2EY1 A;  4L63 B;  3K57 A;  2DJG C;  1GOZ A;  3D4R A;  1VMC A;  1CI3 M;  4CKB A;  4X65 L;  4J15 A;  3HOX H;  1D8L A;  1Q1B A;  2F1M A;  1HXY D;  1D5M C;  2R93 G;  4X3K A;  4RKB A;  1OXX K;  4C3J H;  3I91 A;  4UP7 A;  2BE5 C;  4DV6 L;  4PZ8 A;  1PTO F;  2AUK A;  1AW7 A;  4ZQ3 A;  1PZI D;  1EWH A;  1O80 A;  3RR5 A;  2R93 B;  1MKH A;  1JE5 A;  3B6Y A;  4EVO A;  1BCP C;  4TKO B;  2F0N A;  1AP0 A;  3ONA B;  1CKN A;  2KEE A;  1PH7 A;  4B3S L;  1TWF B;  2FFK B;  4ZKC B;  2UUA L;  2CH4 A;  3S16 H;  3L2P A;  4HR7 B;  2BOS A;  2X69 A;  3OPO A;  5IOD A;  4FXK C;  4BY7 G;  4A3K H;  1GKH A;  5M5Y B;  5COR A;  4NPS A;  1A2U A;  4R4C A;  1OXT A;  3WOE A;  1KTK A;  1ENC A;  1YHQ A;  4LF6 L;  1XTD A;  2DY7 A;  3UDF A;  4BY7 B;  4ZLT F;  2EIF A;  3AYH B;  3RZO B;  1UEA B;  3MAQ A;  1I3Q B;  5IGD A;  3SK4 A;  1PTO H;  1NE3 A;  2RKS A;  3HOZ H;  1XMO L;  2EJF C;  3M3Y B;  1SJH D;  3H3V I;  3F2D A;  2PQA A;  2NZH A;  4DKA C;  5M3M H;  4YCU A;  1JMC A;  1PFM A;  3GD7 A;  3STB D;  3AEV A;  4A3C H;  1X32 A;  4QUC A;  1DOL A;  4AH6 A;  5M9O A;  3G6E A;  2SNS A;  2XWJ B;  3K80 C;  2UXC Q;  3M85 A;  1WCM H;  1IW7 D;  1FYC A;  1TWA H;  1TWG B;  4KY7 A;  5NUC A;  1Z7T A;  1C8C A;  2L12 A;  2B63 G;  4FF3 A;  3TP8 A;  2WB1 B;  5J22 A;  2KCT A;  4NMZ A;  4MN3 A;  4K6D A;  4HIM A;  3I70 A;  4A3L G;  2WAQ G;  4KD3 A;  2PZU A;  2GVB A;  3S1Q H;  1E1O A;  3S1M H;  4PQX A;  2ZTE A;  1HNW L;  1QNU A;  5IGC A;  1QZG A;  1IL8 A;  3HS0 C;  5GRO A;  2B63 B;  1D1I A;  4GNX B;  2YU9 H;  2B8F A;  5KGU A;  5D14 A;  2KOL A;  4A3M G;  3HOY B;  3DM3 A;  3RN2 A;  5DM7 3;  3L3O C;  2D2C C;  2E2H B;  1ESF A;  1DCZ A;  2OEO A;  4CBV A;  1FJG L;  4JBK A;  3HFZ B;  2RHQ B;  4NDX A;  4A3G G;  2AQ2 B;  2BDN A;  1XNR Q;  1K8O A;  2A68 C;  3M4O H;  4UDU C;  2A8V A;  1L2F A;  3QG1 A;  4KD4 A;  4A3M B;  1XMQ L;  3R2I A;  4QF4 A;  3T1Y Q;  2E74 C;  1I4G A;  4DV3 L;  4YWK A;  1LV9 A;  3GP7 A;  2HT1 A;  2K14 A;  4GOP A;  5FO7 B;  3T51 B;  4A3G B;  5CV9 A;  3Q6S A;  1K3R A;  2JYO A;  2K5W A;  5EBC A;  3TEH B;  1N34 Q;  1JIC A;  1HA6 A;  2MO1 A;  3SK8 A;  1NY4 A;  1WI5 A;  4L5R C;  1IYU A;  5IT9 E;  4ZKB B;  3CPW A;  1PH1 A;  2E2J H;  2RQX A;  5A2Q L;  2B2V C;  3PGZ A;  2F0U A;  3U9O A;  3VYR A;  2PMZ E;  3L0O A;  1G2T A;  3FHW A;  2EQS A;  4WFN 3;  1MJE A;  1H9S A;  2Z6K A;  1JQY D;  2K5D A;  5IYB G;  2WV6 D;  2MUY A;  2EYF A;  3PO2 H;  1I4H A;  5KNC A;  1X3Q A;  1DOK A;  3U9S A;  4YY3 L;  1AEX A;  1JB7 A;  2M00 A;  3GTP H;  5IP9 G;  4GLV B;  1JOQ A;  1Y1W H;  5BR8 Q;  4C3H H;  1X65 A;  2DN8 A;  2R7Z G;  1PH6 A;  3PIP A;  2OTL A;  1R4Q B;  3NBH B;  3QB3 A;  3PUX A;  4LK1 C;  1GUO A;  2KCN A;  1VQ9 A;  2NN6 H;  4A75 A;  2XNA C;  3P20 A;  4NB3 A;  5HGQ A;  4OO1 H;  4A3I B;  3W3A A;  1KIX A;  2NYZ D;  4UY8 C;  4C3I G;  2R7Z B;  3HOW G;  1R4P B;  3SR1 A;  4NKL A;  1CSP A;  1Y8O B;  4AQY L;  2AHO B;  2XTI A;  1JJG A;  1HRJ A;  3ICE A;  1SNM A;  3QO2 A;  1V9P A;  3HOW B;  1JCK B;  4LF5 L;  2JA7 G;  4HJ7 A;  1C0A A;  3J81 j;  3HOU G;  1RD9 D;  1B1Z A;  4OON A;  2WKD A;  2VUM G;  4POG A;  4JI4 L;  4QJF A;  4GN4 B;  3G7L A;  2JA7 B;  1D7Q A;  1ILQ A;  1HNZ Q;  1LM0 A;  1TY2 A;  1SEB D;  4G7H C;  1STY A;  1TXY A;  3TBI B;  1UNS A;  4DUZ L;  2VQE L;  2F0F A;  1ICW A;  1NR2 A;  1N9W A;  4TVA B;  2JA5 G;  2KEC A;  2HDL A;  2Q2T A;  1LTS D;  2B2T A;  3ZYY X;  4KKS A;  1A62 A;  2WIN B;  1PH8 A;  4AYB G;  1YNJ D;  5JPM C;  4TRD A;  4JV5 Q;  2R93 H;  1GO3 E;  2JA6 H;  1C9O A;  2B2W A;  1JOO A;  3LGJ A;  4JI3 L;  4IN3 A;  2JA5 B;  4QIW E;  1LT4 D;  3DEP A;  1BXT A;  1RKN A;  1TWF H;  4DV0 Q;  3DM1 A;  4K0K Q;  5KYL A;  2F0K A;  2RDH A;  1SAP A;  3OYY A;  4A4I A;  4OEM B;  1EIH A;  1PLF A;  4O42 A;  1VDZ A;  3K8A A;  4JBJ A;  1XYI A;  4QL5 A;  5FO9 B;  1KXL A;  4KLK A;  3C1E A;  5M5Y H;  3A5U A;  3F2C A;  1V1O A;  1LLR D;  4FXD A;  1HTP A;  1U4M A;  2ZTC A;  3BZK A;  1SXT A;  3NEL A;  4HMJ A;  4LFB Q;  1EY8 A;  2VL6 A;  2A6H D;  3FVQ A;  2NZ1 D;  4RCN A;  3T16 A;  4K8J A;  2EYM A;  2EYJ A;  4O1N A;  1CA6 A;  1I3Q H;  3E0J A;  1N32 Q;  1X3F A;  1SFO B;  4QMG A;  1I6V C;  1EIY B;  2KED A;  2IY5 B;  4JI1 Q;  5JJI A;  1B4O A;  2MPM A;  3NWS A;  2YTX A;  3STB C;  3LWE A;  4J8Q A;  3BS1 A;  3FMC A;  4NXM Q;  4DAV A;  2LXK A;  2B29 A;  1IYJ B;  1CA5 A;  4ZYS A;  3VDY A;  3D6W A;  1Y1V G;  3GQB A;  1SR3 A;  5IT9 L;  1ZEQ X;  4DR7 Q;  3HG9 A;  1SNO A;  3H3V C;  4WJ3 M;  2F0H A;  5DEH A;  5CBE E;  2L11 A;  2XRS D;  3MXN A;  1STH A;  2DY8 A;  4BBR H;  2K32 A;  1WOC A;  1GD7 A;  1Y1V B;  5A35 A;  3H94 A;  1XTC D;  4ZRZ A;  4X65 Q;  1OXU A;  5FK9 C;  2F0W A;  1QCB D;  5IGF A;  4DV6 Q;  3FKI G;  1VF5 C;  4JOI C;  3GTO B;  1MD2 D;  3CCV A;  1WD0 A;  2Q8T A;  3FRP B;  2CW0 C;  4B08 A;  3X3N A;  4B9X A;  4CDC C;  2SNM A;  1QVF A;  4WOR A;  3GTQ H;  3HOY H;  2HQE A;  1CHP D;  3FKI B;  2E2H H;  5M5W B;  4A3L H;  2IWH A;  3KDF B;  2UUA Q;  3KF8 A;  5F2D A;  1GXD C;  2EDG A;  1N8R C;  4IQZ A;  3MEF A;  1S5D D;  4DV5 Q;  4DK0 A;  3KJO A;  4LWC A;  4C3J G;  2UXC L;  2HCC A;  4A3G H;  2VB3 X;  1KDA A;  3KLR A;  3BZD B;  1KL9 A;  2ZM6 Q;  3I90 A;  5CV8 A;  1II3 A;  1EYG A;  1PFN A;  3KLW A;  1JT8 A;  4CGY B;  1HPC A;  3K7A B;  3T1H L;  5IYD H;  4P74 A;  3CCR A;  4MNO A;  2UUC Q;  4QCL A;  5C3X A;  5EPL A;  2BE5 D;  4XQJ A;  3BDC A;  2KHI A;  1XMO Q;  1CTM A;  3CAM A;  1O78 A;  2MHV A;  4FXG C;  1SNC A;  1WTH A;  4RHR A;  2A73 B;  3K0Y A;  1NCV A;  2CHB D;  1XNR L;  1BCP D;  1W6J A;  1QZH A;  4JI5 L;  5C6A A;  4LNQ A;  4MIU A;  1K28 A;  4HTH A;  4X62 L;  3T1Y L;  4IUT A;  4I7Z C;  2K5Q A;  3PQI A;  4FF2 A;  2PCF B;  1IKM A;  3OWE B;  3CRL C;  4A3I H;  3TQY A;  3VR6 A;  1EU4 A;  2IX3 A;  3RMH A;  1QE6 A;  4LFC L;  1J5E L;  3S1N H;  2I46 A;  4GS3 A;  1HNW Q;  1TS2 A;  5M3M G;  1CM9 A;  2NTS A;  5E4X A;  2FHT A;  3VR3 A;  3A7L A;  3CU7 A;  3H91 A;  1G6Z A;  2IL8 A;  4A3C G;  3PUY A;  5E1F A;  4PMB A;  3OOC A;  4RGT A;  1FJG Q;  5IT9 c;  4LAA A;  2PW5 A;  4ME5 A;  5E4W C;  1WCM G;  5M3M B;  1X56 A;  3HKZ B;  2AQ1 B;  2D5D A;  3VYU A;  2AWO A;  3ULJ A;  1BVS A;  1XMQ Q;  3U58 A;  4O2D A;  3OMC A;  5C3E B;  1S72 A;  1IBM Q;  3C3L A;  2VQF L;  5ELN A;  1V1Q A;  1BR9 A;  1WCM B;  1SMX A;  5CV6 A;  2NBF A;  2E76 C;  2MGS A;  2R92 B;  5ELE A;  2LKV A;  4HIO A;  4JK1 C;  4KN7 C;  4NP5 A;  5LMU L;  1CSQ A;  2IW3 A;  3ULL A;  3I4M H;  2EY6 A;  2QKI C;  2EZV A;  3BDL A;  3S1Q B;  3D6C A;  4LUZ A;  2JA5 H;  1LUZ A;  3Q24 A;  3I72 A;  1YJN A;  1D5X C;  1UE1 A;  3EQL C;  4FYD A;  1I4P A;  4HJ8 A;  3Q22 A;  4KHV A;  5KYI A;  1S5E D;  3CF5 A;  5J39 A;  4OL7 A;  4CDD C;  4KK7 A;  5C5M A;  1ROD A;  5JVG 3;  4DK1 A;  5EPJ A;  4A3B G;  4C2M H;  1OO9 B;  3IFD A;  2K03 A;  3ULP A;  5G3L F;  4YHH Q;  2DNE A;  3NEM A;  1WTO A;  4R8N A;  2A6E C;  2A19 A;  2X6G A;  2A6H C;  2VNU D;  1EZ6 A;  2NUC A;  3DWQ A;  5CBA E;  1S4Z A;  2CCZ A;  3K59 A;  3WOF A;  1I6H H;  1HNZ L;  3I73 A;  4PMC A;  4A3B B;  4OWT B;  2RBM A;  3ND8 A;  1HQR D;  1SFO H;  1UUP A;  2E2J B;  1EU3 A;  1GM5 A;  4APV A;  4CKC A;  1VMP A;  3OMG A;  4JV5 L;  2V4D A;  2KA7 A;  1GUW A;  2K5N A;  3A5Z B;  5D3I B;  2UUB L;  4C3H G;  2EXZ A;  4LF5 Q;  1DYQ A;  1E3P A;  4K0K L;  1AH9 A;  1LAB A;  5C4H A;  3SGI A;  1GUS A;  5EKL A;  4JI8 L;  1ONL A;  2F03 A;  1PZJ D;  3GTG H;  3NTI A;  2NN6 G;  5HUR A;  3ITP A;  4C3H B;  4OO1 G;  3PF5 A;  1JOK A;  1Y1V H;  1SRU A;  3RZD H;  5M3F H;  1U0L A;  3EA6 A;  3RLF A;  5CV7 A;  2OQ0 A;  5I2Y A;  3RNU A;  3KF6 B;  4GNX A;  4G4K A;  1AFP A;  2VQE Q;  1NNX A;  2KEN A;  3D0F A;  4OIK A;  4A3D H;  2PW7 A;  1JWS D;  3J81 E;  1NMG A;  3D4D A;  1MGS A;  1N32 L;  4RGN A;  1UE5 A;  2VW9 A;  5IYC G;  1JWU D;  2A1A A;  4JI3 Q;  4JI1 L;  1NTG A;  4K8I A;  4IFD H;  4LJZ C;  1KRT A;  2K50 A;  4XXE A;  4DR5 Q;  3KBG A;  2WAQ E;  3S9W A;  2X6L A;  2MO0 A;  1VS0 A;  1EY6 A;  3S1R B;  3CKI B;  5CV5 A;  5BN5 A;  1B9N A;  5C4J H;  2KHS A;  1TS5 A;  3K6O A;  1A8V A;  1DM0 B;  3R93 A;  3GDE A;  1VQP A;  2JA6 G;  5C3W A;  1Q12 A;  1MBY A;  2A74 C;  5CR3 A;  1VQ5 A;  5IGB A;  2IHE A;  3K7A H;  1B2T A;  1F2L A;  3A74 A;  1ZXT A;  4LUO A;  1HCZ A;  2Z6K C;  4DV1 L;  2JA6 B;  2Y0S G;  3FPU B;  2EJM A;  1WYD A;  3NBH A;  1EIF A;  2O5I C;  2NWG A;  3KLS X;  1XNQ L;  3OIQ A;  2Y0S B;  4DV5 L;  5C44 H;  3W2D A;  3MVV A;  1R9T B;  3WWV A;  4A3J B;  4IFD J;  2EYH A;  2YYZ A;  3MTS A;  2ZM6 L;  1PFB A;  2EYL A;  1CQF A;  3E3X A;  3J80 E;  3HP3 A;  4JI2 Q;  3A8J E;  1NMF A;  1G51 A;  3NXW A;  4JYA L;  2UUC L;  4DAP A;  2IT1 A;  1EY4 A;  4A3F B;  2CH4 W;  1EQT A;  2K4K A;  2JA8 H;  1K8M A;  2Z4H A;  1KLG D;  1P8L A;  5AJ3 L;  2Z0S A;  1BQQ T;  1QJO A;  3VYS A;  1EOV A;  4DU9 A;  4JG2 A;  5IGG A;  4BBR G;  4KN4 C;  1OXS C;  3IL8 A;  2F0J A;  2NZO A;  2A69 C;  1W6K A;  5C3E H;  4IJH A;  2WB1 G;  2PZT A;  3NE5 B;  2AWN A;  3MXG A;  2HD3 A;  1F9Q A;  3KK7 A;  4BBR B;  5HGT A;  1KD1 C;  2R92 H;  2ZXP A;  1B50 A;  4UAI A;  3DUZ A;  3V05 A;  3NEN A;  3CPF A;  2B2T C;  2HCI A;  3G48 A;  3BYT B;  3HOY G;  2ICI A;  1EY0 A;  4DUY L;  3TN2 A;  3UE1 A;  4RFB A;  3T1H Q;  2GA4 B;  4R4Q A;  3TRE A;  2JP1 A;  3M7N A;  4RGO S;  1SYB A;  3J7A 5;  1LT5 D;  4KI0 A;  3GTQ B;  1WVL A;  1XPO A;  2ZXR A;  1EY5 A;  2CW0 D;  2RVL A;  3LX0 A;  3PO3 G;  1FVI A;  1MSG A;  2DJF C;  1SYE A;  1UWV A;  3J81 L;  4JI5 Q;  3PUV A;  2F0E A;  4RH6 A;  3UDI A;  4X62 Q;  4AYB E;  2D9U A;  1NJI C;  2LS0 1;  2RHS B;  3QIA A;  4KJN A;  4KTA A;  1IBM L;  1JB3 A;  3NQT A;  1A2T A;  3PO3 B;  1EEF D;  2CQO A;  4A3B H;  5IGE A;  5IYD G;  2KHJ A;  3MA2 B;  5D65 A;  2IHF A;  3SK5 A;  3GTK H;  4LFC Q;  1STA A;  1J5E Q;  4K6L A;  1JJC B;  1SBB B;  2HIV A;  2KJX A;  4LMQ D;  4LF9 Q;  1QIL A;  2K52 A;  1TY0 A;  1G2S A;  4DR4 L;  1SN8 A;  5JAV A;  1Q3L A;  4QQB X;  5EGT A;  4KHZ A;  2L15 A;  3TME A;  3J81 i;  3R2T A;  5CMD A;  2ZJR A;  1XXG A;  1SND A;  1PH4 A;  4Q0F A;  2VQF Q;  4A3I G;  3OHX C;  4DV2 L;  4EX5 A;  1AN8 A;  2UXD L;  3T53 B;  1DJR D;  4YHH L;  1IBK L;  1F9S A;  2EY2 A;  3GTJ B;  4G7O C;  1VQ4 A;  5JPN C;  1IYV A;  3BVZ A;  2KQ3 A;  1HUM A;  3T13 A;  3TS2 A;  1W3S A;  4H02 A;  2ZXO A;  4MTN A;  3UE0 A;  5LMU Q;  2BH8 A;  4X64 Q;  1KAW A;  3KUP A;  4P2C B;  3KDF A;  4B3R Q;  3T4A C;  3NP8 A;  1O7L A;  4FNF A;  3KJP A;  1MIU A;  4IAL A;  3S1N B;  1Q46 A;  4QGU A;  4R9W A;  3OW2 A;  2RSO A;  1LTL A;  4X3T A;  1U5K A;  4MTK A;  4XQQ A;  3H15 A;  2TSS A;  3J80 L;  5FLX E;  5IYC H;  3RD4 A;  4OWX B;  4K5X A;  1QUQ B;  4ZAI A;  5FLM H;  3K5M A;  5M5X H;  4YIJ A;  2PNH A;  1LTB D;  3S1R H;  1E1T A;  4DAY B;  3CMA A;  3TSS A;  1HR0 W;  3I4M G;  5DLQ E;  1E24 A;  3J7A V;  1PZK D;  3NK9 A;  2QEX A;  3CCU A;  1PHJ A;  2M2L A;  3AQQ A;  2EXD A;  5JOB A;  1LT3 D;  4OX9 Q;  1VF7 A;  2F0D A;  1H9M A;  1HZB A;  3A0J A;  3I4M B;  1HFN A;  4DR2 L;  2UUB Q;  4JCV E;  3OTO Q;  3I4N B;  3J81 c;  2WP8 J;  4KMU C;  4AIM A;  5JVH 3;  4C56 C;  2R7F A;  4JI8 Q;  3J80 i;  2JA9 A;  1U4L A;  1PYS B;  5I6W A;  2EJG C;  2Z4I A;  2F0T A;  3HKS A;  4DR5 L;  1BBX C;  2JEA I;  3H3V H;  2MP1 A;  3I3C A;  3M7G A;  3VR4 A;  1O7Z A;  3DEO A;  4G7Z C;  4C2M B;  2EOT A;  1R9T H;  4A3J H;  4HED A;  3SE0 A;  1EOT A;  1NAP A;  1XWE A;  2BA0 A;  3J7A F;  2MJ8 A;  1I6H B;  4LFA Q;  1C4Q A;  1YIJ A;  2A6E D;  3E9I A;  1WFQ A;  1HTL D;  4DNT B;  2C5C A;  2QDL A;  3TDQ A;  2R61 A;  4ALP A;  4IUN A;  1G8Z D;  1X6O A;  1EUJ A;  5GQO A;  1PYB A;  4A3F H;  4X3U A;  3HOV H;  1K8A C;  1SE4 A;  1BKB A;  3BJU A;  3OW7 A;  4J6H A;  3W1G A;  1ICF B;  1Q81 C;  2JEB I;  2LY7 A;  1SNP A;  5M3F G;  2B39 A;  2PMZ B;  3GTG B;  1VQK A;  1SYC A;  3FP9 A;  4J1M A;  4A3D G;  4IZ8 A;  2QCP X;  1YVC A;  4PV1 C;  2Q8R E;  2B2V A;  3CME A;  3RZD B;  3K5N A;  5M3F B;  1GHJ A;  1YI2 A;  4PZ6 A;  4B3T L;  2WII B;  3CC2 A;  3D4W A;  5CGK A;  2RSN A;  2NTT A;  4ULL A;  3F2B A;  5ELC A;  4A3D B;  3NWT A;  1CQV A;  4U67 3;  5I2X A;  4JI2 L;  3H6M A;  1L1O C;  4IFD G;  1I4X A;  4UHV A;  5I4D A;  4JBW A;  4N9T A;  4EQ5 A;  2F0G A;  2B2Y A;  4DV1 Q;  1LAC A;  1UE6 A;  2B3G A;  1BCP B;  1VQN A;  1D6E C;  2G9H D;  4DNI A;  4DV7 L;  1WTV A;  1WTP A;  1PH5 A;  3OWF A;  5K5P A;  3J80 c;  1QWY A;  1S5F D;  4HN7 A;  1NSN S;  1EQR A;  1SYG A;  2IX0 A;  2K7V A;  2H1E A;  2KUM A;  3DMU A;  2NVX H;  1XNQ Q;  1EWI A;  2N8N A;  4R4T A;  3URY A;  1RHP A;  4KHP L;  4OHJ A;  4L5Q A;  4LF8 L;  4GN5 A;  5DAU A;  2PO4 A;  2UU9 Q;  2EPB A;  4FP5 D;  2L9H A;  4R4I A;  3PO3 H;  3PUZ A;  3QOJ A;  4ZK9 B;  4BA2 I;  2H5X A;  4DGZ A;  5C4J B;  1A6X A;  3TZD A;  4RG1 A;  5EAY A;  4C1N K;  1NBW A;  1YJW A;  5LMN W;  4BXX G;  1VQ6 A;  3DXJ C;  4IUR A;  5J3B A;  3U4V A;  1PMR A;  4L6T B;  3GO5 A;  4JYA Q;  1JJ2 A;  3E0E A;  2N49 A;  4EQN A;  1RF2 D;  4PMW A;  1X3E A;  3CP0 A;  1X54 A;  5AJ3 Q;  1CT1 D;  1WTX A;  2SEB D;  3NTK A;  5C44 G;  1EWC A;  3U4Z A;  1EZ8 A;  1RL2 A;  2RDF A;  2EYO A;  2Z1C A;  4MHE A;  2Q8I B;  3KF6 A;  1PRT D;  1E22 A;  4H7B A;  3D8G A;  4QIW B;  1KDB A;  2YTY A;  1Q86 C;  4NXN L;  5L37 A;  5C44 B;  5I6Y A;  2F3I A;  3GTJ H;  1WD1 A;  1PH3 A;  2HHH L;  1E0B A;  4GNX C;  4ZUJ A;  2DNC A;  1RDP D;  1D2B A;  2K5H A;  4DR1 L;  4P73 A;  2J0T D;  2F0O A;  4DUY Q;  2ENB A;  4XTC S;  2JA8 G;  3A54 A;  4V0B A;  1SMY D;  1AZP A;  3VA5 A;  4LF9 L;  3HKZ G;  2Q2I A;  2C35 B;  1KC8 C;  3DLL A;  4LF7 L;  4DV4 L;  3NSW A;  4BS9 A;  5C3E G;  1JC7 A;  2JA8 B;  1LYL A;  2LSS A;  1L0W A;  1L0Y B;  2QGQ A;  2NVT B;  1S5C D;  2KBN A;  4LUV A;  2R92 G;  3CCQ A;  1B53 A;  2LXJ A;  5T1I A;  2PNR C;  1A15 A;  1M1K C;  1RTO A;  3ER0 A;  3NUC A;  4X66 L;  5BN4 A;  4H44 C;  2A69 D;  5LHY 1;  2LFN A;  2L4N A;  1B9M A;  5FOB B;  1Q8I A;  1B7Y B;  3I2Z A;  4BBS B;  3S14 B;  1BO0 A;  2AUJ D;  4X64 L;  4B3R L;  3UDX A;  4ZCK A;  2OF1 A;  4ODG A;  3MXU A;  5ISR A;  4POF A;  4IUU A;  3RLN A;  5CV4 A;  3M4Y A;  3Q0A A;  4DR4 Q;  4A3E B;  1YZ6 A;  2F0V A;  1CFM A;  3I4N H;  5IE8 A;  3C1F A;  3CC4 A;  3MHB A;  1IBL Q;  2Z6B A;  1ET6 A;  1K0R A;  1S5B D;  4DR6 L;  3S17 H;  2JQO A;  3CHB D;  4DV2 Q;  1EL0 A;  2UXD Q;  1BDO A;  1EY7 A;  3J7Y W;  5AFW A;  4R8I A;  1IBK Q;  1QVC A;  1N36 L;  2R7D A;  3CCE A;  3MXP A;  5EQ0 A;  4B3M L;  2VS1 A;  4IPD A;  2HIX A;  2PI2 A;  3JAM E;  1KQS A;  1UE7 A;  1FGB D;  1LT6 D;  4F88 A;  1PTO D;  1KNE A;  1WJJ A;  3W1B A;  4NW2 A;  4CDE C;  1BCP F;  4OX9 L;  1FNW A;  3GTK B;  2RCN A;  3SDZ A;  2R3Z A;  4PNY A;  4ABN A;  4HCE A;  5LMN L;  1NUC A;  1EYD A;  1N33 L;  5I9O A;  2OXP A;  1TR5 A;  3OTO L;  2OTJ A;  3F2U A;  4FO2 A;  4FVM A;  1K83 B;  4DFA A;  1VQG A;  3H0G H;  4G57 A;  4FF4 A;  4H0L C;  3TP7 A;  3M4Q A;  1SYD A;  1ESR A;  1TVX A;  2JE6 I;  4JI7 Q;  2E75 C;  4HCS A;  1KRS A;  4IOC A;  1O7Y A;  2FMM A;  1KAB A;  2AMC B;  2D0O A;  4OEL B;  3MFG A;  4S3S A;  4LFA L;  5JEA H;  5C0X I;  2ID0 A;  1EQQ A;  2XVS A;  4LF4 L;  4KKT A;  4CJ1 B;  2ATW A;  1M90 C;  1LTT D;  4L5S A;  1CZG A;  1KHI A;  2FIN B;  2WB1 E;  1HQM C;  1B44 D;  2WAC A;  3I4L A;  1DON A;  5D3D A;  4HIK A;  3KBX A;  4DR2 Q;  2BA1 A;  4XYQ A;  4Y7N B;  3SHL A;  5FLM G;  4BWG B;  2Q2U A;  4ILW A;  4TQU S;  1PA6 A;  1DGS A;  4N8F A;  3I7F A;  3LNN A;  1BBU A;  1Q1E A;  4GOP C;  5M5X B;  2EVB A;  2FXQ A;  1TU2 B;  1Y8N B;  3EIV A;  4E6I A;  3G6J B;  1AE3 A;  3Q8D A;  2PPB C;  1KLU D;  4XYO A;  5C4X H;  5IWA Q;  1AE2 A;  4RAU C;  1Q90 A;  3AFP A;  1QNK A;  4CKE A;  2DUD A;  2K33 A;  1GUG A;  3CQZ H;  2N88 A;  2FMC A;  4RA8 A;  1CUK A;  5FO8 B;  2F4I A;  2E5L L;  2QEJ C;  1DZ1 A;  4EQP A;  1B8A A;  1U4R A;  2OQK A;  5A2Q E;  3G4S A;  4UP8 A;  2ICE C;  4GN3 B;  5CC4 A;  4BXX H;  1P16 A;  2IPK D;  5JEA J;  3BYY B;  3M4P A;  3PV0 A;  4OXP A;  1PRT C;  4DNR B;  2B2U A;  4A3J G;  1YBY A;  4P71 A;  3NPP A;  2KVM A;  2VY3 A;  4L5T A;  1WTR A;  4BY1 H;  3W5O A;  2C9O A;  4N8X 1;  1EYA A;  3FPP A;  1JWM D;  2UU9 L;  4RHS A;  3O13 A;  2ZTD A;  1GHK A;  4GKJ L;  1VQH A;  1YNX A;  3A55 A;  1CHQ D;  2E2I B;  5ELB A;  4B3T Q;  1SMY C;  1FR3 A;  1DD2 A;  4C1N I;  1K73 C;  4A3F G;  5KND A;  4KJO A;  2L1B A;  1XPU A;  5DNF A;  1VQA A;  3HOV G;  2GN5 A;  4F7X A;  3A56 A;  2EYP A;  1L1O B;  3GV6 A;  3IFT A;  4ZUI A;  4DPG A;  3ERQ A;  1V1P B;  2N78 A;  3KLS A;  1GUT A;  3WDN A;  3SXH A;  4PZ7 A;  1QUQ A;  5HY6 A;  4DV7 Q;  2N3S A;  1FNV A;  1X3G A;  3HOV B;  4R4O A;  3BDO A;  2UXB L;  2PZW A;  5H1S E;  3FEW X;  3JAM L;  2QDB A;  1ZYR D;  5KRU A;  1VQ8 A;  2ES2 A;  2NVT H;  5J1Z A;  4DAY A;  1OTC A;  3K58 A;  2NVQ H;  4KHP Q;  1X55 A;  5LL6 X;  4LF8 Q;  1TWH B;  5CYU A;  2E2D C;  1C7Y A;  2ZT9 C;  2F0L A;  4Q5V A;  1HA5 A;  1DXM A;  2CWA A;  3JC6 6;  1YIT A;  4Z9C B;  4CJ2 C;  1TT2 A;  3CRK C;  2MQH A;  1I94 L;  5I9P A;  1HR0 Q;  2CKZ B;  2H4O A;  5ELO A;  3S14 H;  4BBS H;  4N9P A;  2O5J C;  1MHW C;  4DF7 A;  3C46 A;  4DR3 L;  2B2W C;  2EY5 A;  4GKK L;  4A3E H;  3P75 A;  1VQL A;  1PVO A;  1G6P A;  3F1Z A;  1I50 H;  3DWA A;  3MEH A;  5EPK A;  4KV6 A;  1HZC A;  1RTN A;  1FNU A;  3VR5 A;  1YHB A;  3DWP A;  1F2M A;  1TWC B;  4DXG A;  3JAM i;  2ZJP A;  3QOL A;  1F9R A;  1BOS A;  2NVX B;  2JN4 A;  3L9A X;  1SE8 A;  2Z8L A;  1Q82 C;  1BBW A;  4RMF A;  3TP5 A;  2D62 A;  4P75 A;  4NXN Q;  1SJE D;  2A5H A;  2HDM A;  2HHH Q;  4OIJ A;  1PTO C;  1F2Y A;  4YWM A;  1GVP A;  2WAQ B;  4DR1 Q;  1Q7Y C;  4DAM A;  3V2T A;  5JJL A;  4I65 A;  3EBE A;  3Q23 A;  3RLO A;  1E2W A;  1HZ9 A;  1G29 1;  1LTI D;  4DXF A;  1OXV A;  1VQC A;  1STG A;  2G9D A;  2J7Z A;  3VA7 A;  1GJX A;  3GTL H;  5FKA C; 
#chains in the Genus database with same CATH homology
 2XWB B;  4KY6 A;  2L55 A;  3H09 A;  3QWN A;  1QB5 D;  4L8J A;  5EBD A;  4K2L A;  1DOM A;  4HAE A;  4CJ0 B;  1STN A;  1H9K A;  1M8A A;  1FD7 D;  4K5W A;  3E5S A;  5K36 H;  2B2Y C;  1KAA A;  3OSO A;  1PDQ A;  3BVM A;  2K01 A;  5C0X H;  3ERO A;  1SE2 A;  3X3M A;  3IKJ A;  1EYC A;  4A93 B;  2NB0 A;  4ID6 A;  4DA2 A;  5C0X J;  2K28 A;  5LL6 S;  3PIO 3;  1TKW B;  1TS4 A;  1UAP A;  1ENA A;  4V19 0;  4C3I B;  3A7A B;  2VXW A;  2N55 A;  1V43 A;  2BCO A;  3RUZ A;  4EGV A;  1YNN D;  1HUN A;  3NHH A;  3C2P A;  4FF1 A;  1EQV A;  3HOU B;  1IKL A;  4XT1 B;  1G91 A;  1A3T A;  2VUM B;  1LTA D;  4QUF A;  4KKU A;  3S17 B;  2K1B A;  2EE1 A;  3S2H B;  1Y69 U;  2XRQ D;  5TSS A;  4AYB B;  3N52 A;  1F9P A;  1SDF A;  1T5E A;  3OIP A;  2NVY B;  1ML0 D;  1ZYR C;  1D5Z C;  1NR4 A;  5ELD A;  1D1K A;  3H0G B;  1TQO A;  1JR0 D;  2XSC A;  3HGB A;  5JEA G;  5EKI A;  3EFX D;  1H9R A;  1PXU A;  3N6R A;  3TP6 A;  1TS3 A;  5KEE A;  1QOH A;  2IJ0 A;  1IW7 C;  2B8G A;  1EY9 A;  1SE3 A;  1F77 A;  1H9S B;  1ZKO A;  2BDO A;  2O2L D;  4K5V A;  1PRT B;  1KDC A;  4GZY C;  4RKL A;  4XDX A;  3P1H A;  1AZQ A;  3SVM A;  3HRZ C;  3MWY W;  4U68 A;  4H13 C;  2JXM B;  1EFI D;  1F2Z A;  5C4X B;  4M1U B;  1GUN A;  3K5O A;  2OT2 A;  4IUV A;  3E6Z X;  5FLX L;  1LTG D;  4XIG S;  3CQZ B;  2K04 A;  3S2D B;  3UI2 A;  2XN9 C;  3BG3 A;  2SDF A;  2JSO A;  1Z47 A;  4KY5 A;  3HEJ A;  4IUP A;  1BF4 A;  3HOX B;  1X3P A;  3MZ5 A;  4C3J B;  5KIX A;  2VB2 X;  5G3L D;  2PYK A;  4BY1 B;  4IFD I;  3PMF A;  1EIG A;  4CHT B;  1U4P A;  3NBI A;  5BN3 A;  2F0S A;  3EVQ A;  5JJZ A;  2F0M A;  1XX8 A;  3S16 B;  2J4X A;  4RWS C;  1Z6H A;  5C4Z A;  2F0P A;  3VYT A;  2O4X A;  4HMI A;  1CK1 A;  3D31 A;  3ND9 A;  2PQE A;  4A3K B;  1ILP A;  1HFG A;  1I4R A;  1STE A;  4HSV A;  3A8I E;  1WTW A;  3GV3 A;  2K05 A;  3PIP 3;  5T1G A;  2NVQ B;  1RCV D;  3HZX A;  4X3S A;  1STB A;  2CQA A;  4WJW A;  3R8B A;  1PTO B;  2HUG A;  3A8K E;  3HOZ B;  4RCO A;  1U9R A;  2QIL A;  2L5T A;  1CZW A;  1WTQ A;  1YNN C;  5C5L A;  2KCC A;  4WRD A;  4IUQ A;  1TWA B;  2B2U C;  1PYW D;  1I50 B;  1L0X B;  3L7Z C;  2L0C A;  4OGQ C;  2IX1 A;  4EQO A;  1YNJ C;  5KNB A;  5DM6 3;  1MI2 A;  2AQ3 B;  5EJW A;  3AU7 A;  3EJI A;  4F87 A;  1ENF A;  1RJT A;  2WKC A;  3LWU A;  1VCI A;  2CVR A;  4F8M A;  3S1M B;  2SOB A;  5IIF A;  1TII D;  2F0Q A;  5ELF A;  2YU9 B;  1V1P A;  1BUV T;  5E3F A;  1C48 A;  1JE4 A;  1LO5 D;  5C0X G;  3FDT A;  1E2Z A;  3BVG A;  4DN4 M;  1J8I A;  3M4O B;  4B9W A;  3D3R A;  1MSH A;  2F3V A;  3IAY A;  1PRT F;  4BA1 I;  1A3U A;  3GTL B;  3PUW A;  2A68 D;  3P7J A;  1BNZ A;  2LMC B;  2XIW A;  1LTR D;  3TZU A;  1B3A A;  1V8Q A;  2TMP A;  1I4Q A;  3QJY A;  3S15 B;  3SEB A;  3VR2 A;  3NTH A;  3AMU A;  5IOC A;  5K36 G;  4K14 A;  3R3O A;  2FJ2 A;  3V96 A;  3PO2 B;  1JOR A;  1QG7 A;  2M9V A;  2QF7 A;  5COY A;  1EEI D;  2F0I A;  3SK6 A;  3GTP B;  1Y1W B;  1M4V A;  3DHQ A;  4HSP A;  3AB9 A;  4XQN A;  3GTM B;  1SSO A;  4K2K A;  1A3V A;  3K5L A;  1SYF A;  1J9O A;  4TSS A;  1T5X D;  2RDG A;  4XT3 B;  2R6G A;  1KNA A;  3MC0 B;  3T56 B;  1E2V A;  1HHV A;  4RGM A;  2K6A A;  1ET9 A;  2I07 B;  2F3W A;  1IHZ A;  5EKK A;  1Y8P B;  1H9J A;  3MFY A;  3I8Z A;  4QB4 A;  2NN6 I;  3NQI A;  1SNQ A;  4M8A A;  2RA4 A;  4OO1 I;  2EY1 A;  4L63 B;  3K57 A;  1GOZ A;  3D4R A;  1VMC A;  1CI3 M;  4CKB A;  1Q1B A;  2F1M A;  1HXY D;  1D5M C;  4X3K A;  4RKB A;  1OXX K;  3I91 A;  2BE5 C;  1PTO F;  2AUK A;  1AW7 A;  4ZQ3 A;  1PZI D;  1EWH A;  1O80 A;  2R93 B;  4EVO A;  1BCP C;  4TKO B;  2F0N A;  1AP0 A;  3ONA B;  2KEE A;  1TWF B;  2FFK B;  4ZKC B;  4HR7 B;  2BOS A;  2X69 A;  3OPO A;  5IOD A;  4FXK C;  5M5Y B;  5COR A;  1A2U A;  1OXT A;  3WOE A;  1KTK A;  1ENC A;  2DY7 A;  4BY7 B;  4ZLT F;  3RZO B;  1UEA B;  3MAQ A;  1I3Q B;  5IGD A;  3SK4 A;  1PTO H;  2RKS A;  2EJF C;  3M3Y B;  1SJH D;  1PFM A;  3GD7 A;  1X32 A;  4QUC A;  1DOL A;  5M9O A;  2SNS A;  2XWJ B;  3M85 A;  1IW7 D;  1FYC A;  1TWG B;  4KY7 A;  5NUC A;  1Z7T A;  1C8C A;  2L12 A;  4FF3 A;  3TP8 A;  2WB1 B;  5J22 A;  4NMZ A;  4MN3 A;  4K6D A;  3I70 A;  4KD3 A;  2PZU A;  4PQX A;  1QNU A;  5IGC A;  1IL8 A;  3HS0 C;  2B63 B;  1D1I A;  2B8F A;  5KGU A;  5D14 A;  2KOL A;  3HOY B;  5DM7 3;  3L3O C;  2D2C C;  2E2H B;  1ESF A;  1DCZ A;  2OEO A;  4CBV A;  4NDX A;  2AQ2 B;  2BDN A;  1K8O A;  2A68 C;  4UDU C;  3QG1 A;  4KD4 A;  4A3M B;  3R2I A;  4QF4 A;  2E74 C;  1I4G A;  1LV9 A;  3GP7 A;  5FO7 B;  3T51 B;  4A3G B;  5CV9 A;  3Q6S A;  2JYO A;  2K5W A;  5EBC A;  1JIC A;  1HA6 A;  3SK8 A;  1IYU A;  5IT9 E;  4ZKB B;  2RQX A;  5A2Q L;  2B2V C;  2F0U A;  3U9O A;  3VYR A;  1G2T A;  4WFN 3;  1H9S A;  1JQY D;  2K5D A;  2WV6 D;  2MUY A;  2EYF A;  1I4H A;  5KNC A;  1X3Q A;  1DOK A;  3U9S A;  1AEX A;  2M00 A;  1JOQ A;  2DN8 A;  1R4Q B;  3QB3 A;  3PUX A;  4LK1 C;  1GUO A;  2KCN A;  2NN6 H;  2XNA C;  3P20 A;  4OO1 H;  4A3I B;  3W3A A;  2NYZ D;  4C3I G;  2R7Z B;  1R4P B;  3SR1 A;  4NKL A;  1Y8O B;  1HRJ A;  1SNM A;  3QO2 A;  3HOW B;  1JCK B;  1RD9 D;  1B1Z A;  2WKD A;  3G7L A;  2JA7 B;  1ILQ A;  1TY2 A;  1SEB D;  4G7H C;  1STY A;  3TBI B;  1UNS A;  2F0F A;  1ICW A;  1NR2 A;  2KEC A;  2HDL A;  1LTS D;  2B2T A;  3ZYY X;  4KKS A;  2WIN B;  1YNJ D;  5JPM C;  4TRD A;  2B2W A;  1JOO A;  4IN3 A;  2JA5 B;  1LT4 D;  1BXT A;  1RKN A;  3DEP A;  3DM1 A;  5KYL A;  2F0K A;  2RDH A;  1SAP A;  1EIH A;  1PLF A;  4O42 A;  1VDZ A;  1XYI A;  5FO9 B;  3C1E A;  1V1O A;  1LLR D;  4FXD A;  1HTP A;  1U4M A;  1SXT A;  4HMJ A;  1EY8 A;  2A6H D;  3FVQ A;  2NZ1 D;  4RCN A;  3T16 A;  4K8J A;  2EYM A;  2EYJ A;  4O1N A;  1CA6 A;  3E0J A;  1SFO B;  4QMG A;  1I6V C;  2KED A;  1B4O A;  2MPM A;  3NWS A;  3LWE A;  4J8Q A;  3BS1 A;  3FMC A;  4DAV A;  1CA5 A;  4ZYS A;  3D6W A;  3GQB A;  5IT9 L;  1ZEQ X;  3HG9 A;  1SNO A;  3H3V C;  2F0H A;  5DEH A;  5CBE E;  2L11 A;  2XRS D;  3MXN A;  1STH A;  2DY8 A;  2K32 A;  1Y1V B;  5A35 A;  3H94 A;  1XTC D;  4ZRZ A;  1OXU A;  5FK9 C;  2F0W A;  1QCB D;  5IGF A;  1VF5 C;  3GTO B;  1MD2 D;  1WD0 A;  2Q8T A;  3FRP B;  2CW0 C;  4B08 A;  3X3N A;  4B9X A;  2SNM A;  4WOR A;  2HQE A;  1CHP D;  3FKI B;  5M5W B;  2IWH A;  3KF8 A;  5F2D A;  1GXD C;  2EDG A;  4IQZ A;  1S5D D;  4DK0 A;  4C3J G;  2HCC A;  2VB3 X;  1KDA A;  3KLR A;  3BZD B;  3I90 A;  5CV8 A;  1II3 A;  1PFN A;  4CGY B;  1HPC A;  3K7A B;  4QCL A;  5C3X A;  5EPL A;  2BE5 D;  4XQJ A;  3BDC A;  1CTM A;  1O78 A;  2MHV A;  4FXG C;  1SNC A;  4RHR A;  2A73 B;  3K0Y A;  1NCV A;  2CHB D;  1BCP D;  1W6J A;  5C6A A;  4MIU A;  4HTH A;  4IUT A;  4I7Z C;  2K5Q A;  4FF2 A;  2PCF B;  1IKM A;  3OWE B;  3CRL C;  3VR6 A;  1EU4 A;  2IX3 A;  3RMH A;  1QE6 A;  2I46 A;  1TS2 A;  1CM9 A;  2NTS A;  5E4X A;  3VR3 A;  2FHT A;  3A7L A;  3CU7 A;  3H91 A;  1G6Z A;  2IL8 A;  3PUY A;  5E1F A;  4PMB A;  3OOC A;  4RGT A;  4LAA A;  2PW5 A;  4ME5 A;  5E4W C;  5M3M B;  3HKZ B;  2AQ1 B;  2D5D A;  3VYU A;  2AWO A;  3OMC A;  5C3E B;  3C3L A;  1BR9 A;  1WCM B;  5CV6 A;  2NBF A;  2E76 C;  2MGS A;  2R92 B;  5ELE A;  2LKV A;  4JK1 C;  4KN7 C;  4NP5 A;  2IW3 A;  2EY6 A;  2QKI C;  2EZV A;  3BDL A;  3S1Q B;  3D6C A;  3Q24 A;  3I72 A;  1D5X C;  4FYD A;  3EQL C;  1I4P A;  3Q22 A;  4KHV A;  5KYI A;  1S5E D;  5J39 A;  4OL7 A;  4KK7 A;  5C5M A;  1ROD A;  5JVG 3;  4DK1 A;  5EPJ A;  1OO9 B;  3IFD A;  2K03 A;  5G3L F;  2DNE A;  1WTO A;  4R8N A;  2A6E C;  2X6G A;  2A6H C;  2VNU D;  1EZ6 A;  2NUC A;  3DWQ A;  5CBA E;  1S4Z A;  3K59 A;  3WOF A;  3I73 A;  4PMC A;  4A3B B;  2RBM A;  3ND8 A;  1HQR D;  1UUP A;  2E2J B;  1EU3 A;  4CKC A;  1VMP A;  3OMG A;  2V4D A;  2KA7 A;  1GUW A;  5D3I B;  4C3H G;  2EXZ A;  1DYQ A;  1LAB A;  5C4H A;  1GUS A;  5EKL A;  2F03 A;  1ONL A;  1PZJ D;  3NTI A;  2NN6 G;  5HUR A;  3ITP A;  4C3H B;  4OO1 G;  1JOK A;  3EA6 A;  3RLF A;  5CV7 A;  5I2Y A;  4G4K A;  1AFP A;  4OIK A;  2PW7 A;  1JWS D;  3J81 E;  3D4D A;  1MGS A;  4RGN A;  1JWU D;  4K8I A;  4IFD H;  4LJZ C;  4XXE A;  3KBG A;  3S9W A;  2X6L A;  1EY6 A;  3S1R B;  3CKI B;  5CV5 A;  5BN5 A;  1B9N A;  2KHS A;  1TS5 A;  3K6O A;  1DM0 B;  3R93 A;  5C3W A;  1Q12 A;  1MBY A;  2A74 C;  5CR3 A;  5IGB A;  1B2T A;  1F2L A;  1ZXT A;  1HCZ A;  2JA6 B;  3FPU B;  2EJM A;  3NBH A;  2O5I C;  2NWG A;  3KLS X;  3OIQ A;  2Y0S B;  3W2D A;  3MVV A;  1R9T B;  4A3J B;  4IFD J;  2EYH A;  2YYZ A;  3MTS A;  1PFB A;  2EYL A;  1CQF A;  3J80 E;  3HP3 A;  3A8J E;  3NXW A;  4DAP A;  2IT1 A;  1EY4 A;  4A3F B;  1EQT A;  1K8M A;  2Z4H A;  1KLG D;  1BQQ T;  1QJO A;  3VYS A;  4DU9 A;  5IGG A;  4KN4 C;  1OXS C;  3IL8 A;  2F0J A;  2A69 C;  1W6K A;  2PZT A;  3NE5 B;  2AWN A;  3MXG A;  1F9Q A;  3KK7 A;  4BBR B;  5HGT A;  2ZXP A;  1B50 A;  4UAI A;  3DUZ A;  3V05 A;  2B2T C;  2HCI A;  3BYT B;  2ICI A;  1EY0 A;  3TN2 A;  4RFB A;  2GA4 B;  2JP1 A;  3M7N A;  4RGO S;  1SYB A;  1LT5 D;  4KI0 A;  3GTQ B;  1WVL A;  2ZXR A;  1EY5 A;  2CW0 D;  2RVL A;  3LX0 A;  1MSG A;  1SYE A;  3J81 L;  3PUV A;  2F0E A;  4RH6 A;  2D9U A;  2LS0 1;  3QIA A;  4KJN A;  4KTA A;  1JB3 A;  3NQT A;  1A2T A;  3PO3 B;  1EEF D;  5IGE A;  3MA2 B;  5D65 A;  3SK5 A;  1STA A;  4K6L A;  1SBB B;  2KJX A;  4LMQ D;  1QIL A;  1TY0 A;  1G2S A;  5JAV A;  1Q3L A;  5EGT A;  4KHZ A;  3TME A;  3R2T A;  5CMD A;  1XXG A;  1SND A;  4Q0F A;  3OHX C;  1AN8 A;  3T53 B;  1DJR D;  1F9S A;  2EY2 A;  3GTJ B;  4G7O C;  5JPN C;  1IYV A;  3BVZ A;  2KQ3 A;  1HUM A;  3T13 A;  2ZXO A;  3KUP A;  4P2C B;  3T4A C;  3NP8 A;  1O7L A;  4FNF A;  3S1N B;  4IAL A;  4R9W A;  2RSO A;  4X3T A;  4XQQ A;  2TSS A;  3J80 L;  5FLX E;  3RD4 A;  4K5X A;  4ZAI A;  3K5M A;  4YIJ A;  1LTB D;  3TSS A;  3J7A V;  1PZK D;  3NK9 A;  2M2L A;  5JOB A;  1LT3 D;  1VF7 A;  2F0D A;  1H9M A;  3I4M B;  1HFN A;  3I4N B;  2WP8 J;  4KMU C;  5JVH 3;  4C56 C;  1U4L A;  5I6W A;  2EJG C;  2Z4I A;  2F0T A;  1BBX C;  2JEA I;  2MP1 A;  3I3C A;  3M7G A;  3VR4 A;  1O7Z A;  3DEO A;  4G7Z C;  4C2M B;  2EOT A;  4HED A;  3SE0 A;  1EOT A;  1NAP A;  1XWE A;  2BA0 A;  3J7A F;  2MJ8 A;  1I6H B;  1C4Q A;  2A6E D;  1HTL D;  4DNT B;  2C5C A;  3TDQ A;  2R61 A;  4IUN A;  1G8Z D;  4X3U A;  1SE4 A;  3OW7 A;  4J6H A;  2JEB I;  2LY7 A;  1SNP A;  2B39 A;  2PMZ B;  3GTG B;  1SYC A;  4J1M A;  4IZ8 A;  2QCP X;  4PV1 C;  2Q8R E;  2B2V A;  3RZD B;  3K5N A;  5M3F B;  1GHJ A;  2WII B;  3D4W A;  5CGK A;  2RSN A;  2NTT A;  4ULL A;  5ELC A;  4A3D B;  3NWT A;  1CQV A;  4U67 3;  5I2X A;  3H6M A;  4IFD G;  1I4X A;  5I4D A;  4JBW A;  4N9T A;  2F0G A;  2B2Y A;  1LAC A;  1BCP B;  1D6E C;  2G9H D;  1WTV A;  1WTP A;  3OWF A;  5K5P A;  1QWY A;  1S5F D;  4HN7 A;  1NSN S;  2K7V A;  1SYG A;  2IX0 A;  2H1E A;  2KUM A;  3DMU A;  3URY A;  1RHP A;  4OHJ A;  5DAU A;  2PO4 A;  2EPB A;  4FP5 D;  2L9H A;  3PUZ A;  3QOJ A;  4ZK9 B;  4BA2 I;  4DGZ A;  5C4J B;  1A6X A;  3TZD A;  4C1N K;  3DXJ C;  4IUR A;  1PMR A;  4L6T B;  3GO5 A;  4EQN A;  1RF2 D;  4PMW A;  1WTX A;  1CT1 D;  2SEB D;  3NTK A;  1EWC A;  1EZ8 A;  2RDF A;  2EYO A;  2Z1C A;  4MHE A;  2Q8I B;  1PRT D;  4H7B A;  3D8G A;  4QIW B;  1KDB A;  5C44 B;  5I6Y A;  1WD1 A;  1E0B A;  4ZUJ A;  2DNC A;  1RDP D;  1D2B A;  2J0T D;  2F0O A;  2ENB A;  4XTC S;  3A54 A;  4V0B A;  1SMY D;  1AZP A;  3VA5 A;  3NSW A;  4BS9 A;  1JC7 A;  2JA8 B;  1L0Y B;  2NVT B;  1S5C D;  1B53 A;  5T1I A;  2PNR C;  1A15 A;  1RTO A;  3NUC A;  5BN4 A;  4H44 C;  2A69 D;  5LHY 1;  2LFN A;  2L4N A;  1B9M A;  5FOB B;  1Q8I A;  4BBS B;  3S14 B;  1BO0 A;  2AUJ D;  2OF1 A;  4ODG A;  3MXU A;  5ISR A;  4IUU A;  5CV4 A;  3M4Y A;  3Q0A A;  4A3E B;  2F0V A;  1CFM A;  3C1F A;  3MHB A;  1ET6 A;  1S5B D;  3CHB D;  1EL0 A;  1BDO A;  1EY7 A;  3J7Y W;  5AFW A;  4R8I A;  3MXP A;  5EQ0 A;  3JAM E;  1FGB D;  1LT6 D;  4F88 A;  1PTO D;  1KNE A;  4NW2 A;  1BCP F;  1FNW A;  3GTK B;  3SDZ A;  2R3Z A;  4PNY A;  4ABN A;  4HCE A;  1NUC A;  1EYD A;  5I9O A;  2OXP A;  1TR5 A;  3F2U A;  4FO2 A;  4FVM A;  1K83 B;  4DFA A;  4G57 A;  4FF4 A;  4H0L C;  3TP7 A;  1SYD A;  1ESR A;  1TVX A;  2JE6 I;  2E75 C;  4HCS A;  1O7Y A;  2FMM A;  1KAB A;  3MFG A;  4S3S A;  5JEA H;  5C0X I;  2ID0 A;  2XVS A;  4KKT A;  4CJ1 B;  1LTT D;  1CZG A;  2FIN B;  1HQM C;  1B44 D;  2WAC A;  3I4L A;  1DON A;  5D3D A;  3KBX A;  2BA1 A;  4XYQ A;  4Y7N B;  3SHL A;  4BWG B;  4ILW A;  4TQU S;  3LNN A;  1Q1E A;  5M5X B;  2EVB A;  1TU2 B;  1Y8N B;  4E6I A;  3G6J B;  2PPB C;  1KLU D;  4XYO A;  4RAU C;  1Q90 A;  1QNK A;  4CKE A;  2K33 A;  1GUG A;  2N88 A;  2FMC A;  4RA8 A;  5FO8 B;  2F4I A;  2QEJ C;  1DZ1 A;  4EQP A;  1U4R A;  5A2Q E;  2ICE C;  5CC4 A;  2IPK D;  5JEA J;  3BYY B;  3PV0 A;  1PRT C;  4DNR B;  2B2U A;  3NPP A;  2KVM A;  1WTR A;  2C9O A;  1EYA A;  3FPP A;  1JWM D;  4RHS A;  3O13 A;  1GHK A;  3A55 A;  2E2I B;  1CHQ D;  5ELB A;  1SMY C;  1FR3 A;  1DD2 A;  4C1N I;  5KND A;  4KJO A;  2L1B A;  5DNF A;  4F7X A;  3A56 A;  2EYP A;  3GV6 A;  3IFT A;  4ZUI A;  3ERQ A;  1V1P B;  3KLS A;  1GUT A;  3WDN A;  3SXH A;  1FNV A;  3HOV B;  3BDO A;  2PZW A;  3FEW X;  3JAM L;  2QDB A;  1ZYR D;  5KRU A;  5J1Z A;  4DAY A;  3K58 A;  5LL6 X;  1TWH B;  5CYU A;  2E2D C;  2ZT9 C;  2F0L A;  4Q5V A;  1HA5 A;  1DXM A;  4Z9C B;  4CJ2 C;  1TT2 A;  3CRK C;  5I9P A;  2H4O A;  4N9P A;  2O5J C;  4DF7 A;  3C46 A;  2B2W C;  2EY5 A;  3P75 A;  3DWA A;  3MEH A;  5EPK A;  4KV6 A;  1RTN A;  1FNU A;  3VR5 A;  3DWP A;  1F2M A;  1TWC B;  4DXG A;  3QOL A;  1F9R A;  1BOS A;  2NVX B;  3L9A X;  2Z8L A;  3TP5 A;  2D62 A;  1SJE D;  2A5H A;  2HDM A;  4OIJ A;  1PTO C;  1F2Y A;  2WAQ B;  3V2T A;  4I65 A;  3Q23 A;  1E2W A;  1G29 1;  1LTI D;  4DXF A;  1OXV A;  1STG A;  2G9D A;  2J7Z A;  3VA7 A;  1GJX A;  5FKA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...