4EVOA

Crystal structure of staphylococcal nuclease variant nviaga/e122g at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
124
Chain Sequence
LHKEPATLIKAIDGNTVKLMYKGQPMVFRLLLVDIPYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHGQHLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Local flexibility as a determinant of pKa values of surface ionizable groups in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 37
structure length 124
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4evoA00
5C4HA 4KY6A 2F0HA 4KJNA 3QOLA 3S9WA 3D4WA 3E5SA 1F2ZA 5E1FA 1SYFA 3HEJA 2NUCA 3LX0A 5CGKA 5HGTA 2F3VA 1STAA 5IGDA 1KAAA 3DMUA 1STHA 4K6DA 1SNPA 1EYCA 3MEHA 4DGZA 1SNCA 2EY2A 3MXPA 4MIUA 3V2TA 4DU9A 5IOCA 1SYEA 3NXWA 5KRUA 4PNYA 2F0PA 2OF1A 2F0OA 4RKBA 5C6AA 3NHHA 5CV9A 5IIFA 2F0MA 4QF4A 3SK4A 5C5LA 4I65A 5DEHA 4WORA 4ME5A 3TMEA 1EY9A 2F0NA 5KYLA 3TP8A 1TT2A 2SOBA 5JAVA 4WRDA 2EYFA 1STNA 4EVOA 3SK8A 2OXPA 2SNMA 4KHVA 2QDBA 2PW5A 4KD4A 2ENBA 4ODGA 4NP5A 4EQPA 2F0UA 1KABA 2PZTA 3NK9A 4K8IA 1EY5A 2F0TA 5I6YA 4OL7A 1SYDA 1JOKA 1A3UA 2O4XA 2PZUA 1EY0A 1SNOA 3C1EA 3HZXA 3MVVA 5CR3A 4ZQ3A 2F0FA 1EZ6A 2WACA 1EY4A 4B9XA 2EY5A 3EVQA 3D6CA 3T13A 2F0IA 1STYA 2RKSA 4ZUJA 3PMFA 5F2DA 5C4ZA 5IGBA 2F0QA 4LAAA 2F0EA 4PMCA 4NMZA 5E3FA 1EY7A 1EYDA 1SYCA 3ERQA 4HMJA 1II3A 1A2UA 3NP8A 2KHSA 4KTAA 4KY7A 3QOJA 5CV7A 5CV5A 5CC4A 4F7XA 1RKNA 3OMCA 3T16A 1EY6A 4K8JA 1A2TA 2EYMA 3OSOA 4PMBA 3TP6A 3RUZA 2EXZA 4R8NA 1TQOA 3TP5A 2RBMA 2HQEA 4B9WA 2PYKA 4K5WA 1EYAA 4K2KA 1IHZA 2PZWA 4YIJA 4QMGA 2EYPA 2EYOA 2KQ3A 2F0JA 5J1ZA 4KV6A 5IGCA 3BDLA 5KYIA 2F0DA 1STGA 4EQNA 1STBA 5ISRA 4DFAA 3SK5A 3DHQA 4N9TA 3H6MA 2F3WA 4IUNA 5EKLA 1EY8A 2F0WA 3SXHA 1SNMA 4E6IA 3SR1A 3TP7A 2F0VA 5IGGA 5C5MA 1ENCA 1F2YA 2EY1A 3OMGA 4HMIA 5I9OA 2PW7A 3NQTA 2OEOA 1A3VA 1F2MA 4ID6A 5EGTA 3OWFA 4ZUIA 5NUCA 3BDCA 3D4DA 4K5XA 4QB4A 1JOQA 3C1FA 2RDFA 3P1HA 4J6HA 4K5VA 4KJOA 2SNSA 5EKKA 1NSNS 1JOOA 4IALA 1ENAA 1NUCA 4RKLA 4N9PA 4KD3A 4TRDA 5CV6A 3VA5A 5HURA 5J22A 2PQEA 3EJIA 3NUCA 2EYLA 4F8MA 4HTHA 5KGUA 3P75A 2M00A 5I9PA 3SHLA 1KDCA 1KDAA 3MZ5A 1A3TA 5JOBA 1SYGA 3QB3A 1EZ8A 4K14A 5CV8A 2F0GA 2F0KA 3U9OA 1SNDA 4NKLA 3MHBA 1AEXA 4S3SA 5CV4A 1TR5A 1EQVA 3EROA 4IZ8A 5C3WA 2EYJA 2F0LA 1SNQA 4NDXA 3ITPA 5KIXA 1JORA 3R3OA 5C3XA 4EQOA 4J1MA 4K2LA 5K5PA 5M9OA 2F0SA 1U9RA 4G57A 2LKVA 4DF7A 5I6WA 5IODA 2EYHA 5J39A 3D8GA 4KY5A 5IGEA 5DAUA 2EY6A 5KEEA 5IGFA 3SK6A 1KDBA 4H7BA 1SYBA
chains in the Genus database with same CATH superfamily
1E2WA 2FINB 2K28A 2ASBA 4LF9Q 1HFGA 5IGDA 1KAAA 5BN5A 1PXUA 4DA2A 2ALYB 1VQJA 3TREA 3PO3B 3QIAA 1ZKOA 4PNYA 3G6JB 2HHHQ 4O1NA 3E3XA 1UEAB 1JE5A 4PQXA 4H02A 4JPBW 4ME5A 1A8VA 2BE5C 3LNNA 1BCPB 2N3SA 2ZJPA 5FO9B 2K03A 1IZ6A 4KHVA 1N8RC 1Y69U 4BY7H 2CFMA 3FPUB 4IPHA 2PI2A 4RHRA 2QEXA 2PMZE 2KHJA 2RF4A 3F2DA 4OX9Q 5FO7B 1NY4A 2E2JB 4R4TA 3QWNA 1WTVA 1VQ8A 2JP1A 2F0EA 1OXUA 2E2IB 3ERQA 1SE8A 3QJYA 1V1PA 1WCMB 4YCUA 4DR3Q 2QCPX 4KMUC 1IKMA 3I91A 2PYKA 3S1QB 2CH4W 1V1OA 1JT8A 3ONAB 4Q0FA 3BDLA 1XWEA 4C3IG 4DUYL 2E2HB 1WVLA 2YU9B 1D5ZC 3NELA 3P7JA 2UU9Q 2EXDA 3AU7A 2F0VA 2E2HH 1TWAH 3OW7A 4BBRG 4CBVA 1F2YA 5KIXA 1LTID 5C0XI 3S2HB 2SEBD 4K5XA 4QB4A 3IFTA 3S14H 1QG7A 1F77A 4DK6C 4A3DG 5E4XA 4IPDA 4CDFC 4MN3A 3R8BA 2NVQH 2JYOA 5ELEA 3PO2B 3P75A 2RVLA 2F0GA 1XPOA 1TR5A 3EROA 1YNJC 5CMDA 3S1MB 1M4VA 5G3LD 5M9OA 1NR2A 1MKHA 2VQFQ 1DJRD 2QW7A 3PSIA 4IJHA 2N78A 5IGFA 2H5XA 4L5SA 2WP8J 2HHHL 5KNCA 1FGBD 4LF6Q 3QO2A 2NUCA 1KNAA 5CGKA 5HGTA 2JN4A 3PF5A 3PUXA 4DGZA 2EY2A 3V2TA 2UXDL 1U5KA 3NXWA 5LL6S 1DM0B 2F52A 3HOZG 4C2MH 1O78A 1I4XA 2Q2UA 1NTGA 3MA2B 4LW1A 5LMNL 4B3SQ 4C3HG 1C7YA 3QR8A 1B44D 1EOVA 2KA7A 3TP8A 2SOBA 2X6GA 3E9IA 1IBLL 2YV5A 2B2WA 2EYFA 3S1NB 3K0XA 3PIPA 2NVTH 3IRBA 1XMOL 2Z4IA 3N6RA 5IE8A 4LJZC 1MSHA 3K6OA 2IX1A 1KHIA 1PH7A 2F1MA 3C1EA 4KK7A 2B2YA 4B9XA 1ESRA 1BVSA 1HZCA 2VUMH 1D1KA 1HR0L 1UUPA 4B3RQ 3RN5A 3RLFA 2K7VA 2M9VA 3DWQA 1EIYB 2Q2TA 1CQFA 4F7XA 4DR2L 2JA6G 1HZBA 2MP1A 4K8JA 3TP6A 2JA7G 3J80c 2K6AA 4L5QA 2R61A 1K83B 4A3MG 4B3MQ 3K81C 1T9HA 1GUWA 1K3BC 2K32A 4OEMB 2F0JA 5J1ZA 1ET9A 2E2DC 3G7LA 2KECA 5EBDA 1HR0W 2FHTA 1BBWA 2MO0A 4DK1A 2JA9A 1A0IA 2E8GA 1NE3A 4CJ0B 4HJ5A 2R92B 4N9TA 1WFQA 5I9OA 1X3FA 3OMGA 3NQTA 2OEOA 1Q82C 2R7ZG 5M3FB 3CCQA 3GTOB 5NUCA 3D4DA 1EFID 2NBFA 1I4QA 1HJPA 1LT3D 1Q46A 4X6AH 1BKBA 1QVGA 3K5NA 1F9RA 1JJ2A 4RH6A 3SHLA 2K5NA 2JEAI 1AEXA 1KAWA 3E9HA 1YHBA 4J8QA 2EDGA 1WOCA 3KLSA 4ZK9B 2J7ZA 4XXEA 3U4ZA 1X6OA 1SBBB 1I3QB 4CDEC 1H9SB 2RQXA 4A3JB 3QOLA 4DPGA 3Q23A 4DR5L 3UDXA 5GROA 2FFKB 5AFWA 1RJTA 1C9OA 3UDGA 3S17B 1D2BA 2NN6I 4X3KA 2WB1B 3JAME 4FF3A 3CCJA 5BN3A 2F0PA 4Y7NB 1ONLA 4KHPL 3I3CA 1KIXA 2F0MA 3SK4A 1GOZA 1MJCA 1SMYD 1YIJA 4JI3Q 1YI2A 1XNRQ 3SDZA 3RNUA 4FO2A 4GKKL 1U0LA 3TBIB 4DR1L 4IQZA 3RN2A 2WKCA 4C3JG 4A93G 4H0LC 3NK9A 1EY5A 5FJ8H 4NXNQ 3CQZH 1E1OA 4JOIA 1G2SA 2F03A 1GO3E 3FKIB 3CC2A 4A3KB 2P5ZX 5IP9H 3U58A 1KTKA 2BE5D 2VL6A 3ULJA 5LMNQ 2PCFB 2WAQG 3NQIA 4DNRB 4C1NK 1S5FD 3T1HQ 5C4XG 3S1QH 2E2IH 1U4LA 5D3DA 2MNAA 3S2DH 4DAPA 3ZJYC 3A55A 4JI4L 4YIJA 4JI8L 1SE3A 3KF6A 2EQSA 2WKDA 4A3DB 5E4WC 4EQNA 4DFAA 3GTMH 5K36H 3J80i 1LABA 4RAUC 2I07B 4TKOB 1GUOA 2R92H 2R3ZA 2TMPA 3AB9A 2F4IA 1HQMC 4BY7B 1MI2A 5C4JB 4GNXB 5M5XH 1BR9A 3I55A 4XQQA 5KNBA 2QA4A 1LTRD 5M3MG 2LMCB 4B3TQ 4L5TA 3UE0A 1SYGA 2Z4HA 3QB3A 5CV8A 1JB7A 3T56B 2A74C 3MHBA 4B08A 1O7LA 4XYQA 3U4VA 3S16B 4UAIA 2D0PA 4JI8Q 3CU7A 1FJGL 1C0AA 2J4XA 5J39A 2E75C 1QZHA 3K80C 1MD2D 3D4WA 3PUZA 1SYFA 2NTSA 4ILWA 1AZQA 2KVMA 4KI0A 4FXKC 4GZYC 4JI6L 2HIVA 5C0XG 3Q24A 1E2ZA 1SNCA 4A3FH 2FMMA 1IKLA 4ABNA 4YWKA 1K73C 2EJGC 1GJXA 4LFAL 5M5WB 1VMCA 5FLXL 5JEAG 1J8IA 1I6HB 4AH6A 1PH1A 3M3YH 4ODGA 4ZYSA 1ENFA 2RCNA 4DAYA 1XTDA 4JBJA 1A3UA 4ZUIA 2PZUA 1EY0A 4WFN3 3IAYA 3A8KE 2Q2IA 1L1OC 3EVQA 3VYRA 3PMFA 1MHWC 2KJXA 3KBXA 1TY0A 5CV5A 2KHSA 2QILA 4IUVA 3F2BA 5D3IB 1ESFA 1A2TA 1VQDA 2HUGA 1L1OA 4PZ6A 2CVRA 1F9SA 2WFWA 4K0KQ 1YJNA 4K5WA 4QMGA 1CUKA 1L1OB 2MHVA 4DV3L 1ICFB 2NVYB 3T1HL 1S4ZA 4CKEA 4K6LA 3I4NH 1S72A 3DHQA 3MEFA 3WOFA 1VQMA 3TP7A 1A63A 3K7UC 5IGGA 3RMHA 1ENCA 2EY1A 4C3HH 2GVAA 4GN4B 4UHVA 2BOSA 2CHBD 1LO5D 4J6HA 4QIWE 3WWVA 1PLFA 1Q8IA 1LT5D 4F87A 5HGQA 5I9PA 3CCMA 2Q2HA 1A3TA 2KEEA 1Q1BA 4GKKQ 4OX9L 2G5DA 5D65A 4DR7L 4LWCA 1JORA 4JG2A 4WJWA 1LTLA 1VCIA 3S1RH 1KC8C 1QB5D 5IYDG 4IFDI 1H9JA 5I6WA 1YJ9A 3F1ZA 1MSGA 1Y14B 5LHY1 4CJ1B 3S1RB 3S9WA 5C0XJ 2B3GA 3W1GA 5E1FA 3H3VC 1AFPA 2D5DA 1HA6A 1N36L 2Z0SA 2XN9C 2HT1A 2A6ED 3BU2A 1L0XB 3F2UA 4A3GH 3HKZB 3KYHC 2UXBL 4RMFA 4P75A 4RKBA 4OWXB 1XJVA 3CC4A 3FMCA 3M7GA 4OIJA 4GNXC 4WORA 1PTOH 2F0NA 1SR3A 5TSSA 4FYDA 2K05A 2VB2X 2QDBA 3GTQH 3PQIA 1JJGA 1EU3A 1N9WA 3HOVH 3I70A 4C3JB 3GQBA 2UXDQ 4JI0Q 4DR1Q 1PYBA 1UE6A 2VY3A 4QCLA 3C3LA 2NZ1D 2B2TC 3ND9A 2OTJA 1EYDA 5CV7A 1T5XD 3S16H 3FP9A 5M3MH 3HOWH 1Q7YC 2LY7A 2M2LA 2K04A 1V1QA 2CWPA 2IJ0A 1PH8A 1KNEA 4PMWA 1IYUA 2ICEC 2EE1A 2YYZA 4BBSG 2I5HA 4GLVB 5KYIA 2GN5A 1IYJB 1I4GA 4DR7Q 3D6WA 4V0BA 4EGVA 3S2HH 5C5MA 2IX3A 1I6HH 4A3BH 1TVXA 1TKWB 3KLRA 1IL2A 4LF7Q 2JE6I 4RCNA 2MQHA 2H4OA 1HNWL 1DOMA 2AHOB 4YHHQ 3JAMi 3A8JE 2WB1G 1IBLQ 4LF8Q 4XQJA 1E2VA 2IX0A 1SROA 5K5PA 1I94L 1NR4A 4G57A 4PZ7A 2V1CC 3S15B 4G4KA 1PFMA 3OYYA 5C4XH 5LMNW 3URYA 4P74A 1NJIC 2XGTA 2F0HA 4KJNA 4LF6L 4FF2A 1VQNA 2CCZA 1SRUA 3EN2A 1Y1WH 1E7ZA 4ZCKA 1SYEA 3OOCA 1OO9B 1EIFA 1TIID 3CP0A 2R93H 4LFBL 3S24A 4A93H 5DEHA 1FNUA 2D0OA 2JSOA 1DYQA 4DV6Q 2HCIA 1N34L 4A76A 2F4VQ 1RTNA 3A7LA 2ZM6Q 3K5MA 1ASZA 2B2WC 1TWGB 2SNMA 1LM0A 1SJED 1UWVA 4GLAC 1KABA 4R4OA 1YHAA 4XT1B 1XMOQ 1S5ED 4L5RC 5F2DA 4JI4Q 1I4RA 2B8FA 4PMCA 4LF9L 1II3A 4A3KH 5ELBA 4LF4L 2GA4B 1EY6A 1HHVA 3C2PA 5DM73 1K0SA 1CKNB 4CKBA 1PH9A 2XRQD 2EYPA 1DXMA 1FJGQ 3OIPA 1JJCB 4R1JA 1L0WA 1O7ZA 2PQAB 3DEOA 4M8AA 1BO0A 2K4KA 1HZAA 5DLQE 3GTOH 4IJLA 1GM5A 2OQKA 1SFOH 1Q12A 1VQ7A 2VQFL 1X65A 3KDFA 2JA5G 2ZM6L 2KEDA 3C1FA 3QG1A 4HAEA 5CV6A 1NUCA 4RKLA 2OTLA 2NWGA 4F8MA 2X6LA 2KHIA 4P72A 1WTOA 2CKZB 1C8CA 4M1UB 4RHSA 1I4HA 4XIGS 3KF6B 1QNKA 2PO4A 3M85A 4HJ7A 3HKZE 1J5EQ 2N55A 3FPPA 4NB3A 4L63B 2MGSA 3BVZA 3D8GA 1DGSA 3H91A 2UU9L 3CXCA 1RIPA 3S15H 3VR2A 1F2ZA 5KNDA 2RHSB 2Z6KA 2Z9HA 4JW0A 1HA5A 2A6HC 4X62Q 4YWMA 1STAA 4GNXA 4RA8A 3HOUH 1PHJA 1H95A 4ZKCB 1TWHB 4YWLA 4CGYB 4HN7A 4UP8A 1BBUA 4DU9A 4QUCA 3SE0A 5COYA 1LLRD 2F0OA 1JICA 2OQ0A 4YHHL 4KKTA 2B63H 1JB3A 1R9TH 4NXNL 3I4LA 3ND8A 3J7A5 1YNND 1RCVD 4A3EG 2UXBQ 4A3BB 1TWFB 2ENBA 4NP5A 4HJ8A 3GTGB 2DNCA 1HNZL 1D7QA 1FNWA 3GTLH 3DWAA 4JI3L 4A3GG 2UUBQ 4LF5L 2BH2A 5ELNA 4AIMA 1VF5C 3TEHB 2F0QA 1B3QA 3TS0A 1B53A 2FXQA 2VUMB 4G7HC 4Q5VA 3QOJA 2NVXB 4NPSA 1ZYRD 2NZOA 3BVGA 2EYMA 4LF5Q 3AFQA 4A3CG 4TSSA 4A3JG 3CCRA 3AMUA 4A3DH 1EEID 3BS1A 3VYSA 1GUNA 3T51B 1WTPA 5IGCA 2KUMA 1CI3M 3KLSX 1IW7D 4DR6Q 1GUSA 3CKIB 1HCZA 5EPKA 1GHJA 1HFNA 2A6EC 1D6EC 4RGOS 5EKLA 4EQ5A 5JJKA 2B2YC 4BXXG 1RODA 1H9SA 4BY1B 2YTXA 3H0GH 2C35B 4HMIA 1BCPC 2VUMG 4A3MB 3L2PA 3OW2A 1H9MA 2IL8A 3FEWX 3PF4A 4OWTB 4CDCC 5M3FG 3RZDH 1XNQQ 1PTOB 2RDHA 1TS4A 3CQZB 4KD3A 1M1KC 4RGNA 3VA5A 1U4PA 1NAPA 3S1NH 4HTHA 2RDGA 5BR8Q 2DJFC 1X9NA 4JBWA 3M7NA 1RHPA 3KLWA 5M5YB 1EYGA 4MTNA 1CHPD 3D3RA 5JEAH 3BYYB 4K0KL 1A62A 1HTPA 4R9WA 2KCMA 1J5EL 4EQOA 2LKVA 2A19A 4JCVE 3HG9A 1MJEA 2UUAL 1L2FA 2XVSA 1QZGA 1FGUA 2WINB 4KY6A 2UXCL 1XXGA 2DGYA 4POFA 3UE1A 4LFCQ 3CPFA 4UP9A 5JPMC 3T1YL 1HR0Q 4DV5Q 3PUWA 4NXMQ 3NEMA 5C44H 5IIFA 1B1ZA 1VQFA 5EKIA 1YHQA 1I5FA 2EJMA 1PH6A 1YBYA 2TSSA 3M3YB 1I6VC 3HOXG 1R9TB 3PO2H 1SFOB 1FNVA 1A6XA 4BBSB 1E24A 2PZTA 3K58A 1E22A 4GN5A 2NB0A 1D1IA 3HZXA 4IOAA 3MAQA 1Z9FA 3D4RA 3OIQA 3VYTA 2KCCA 2DJGC 3FVQA 1QCBD 4GOPC 4ZRZA 3G71A 3FKIH 4JI2L 2B2UA 4DV2Q 2NZHA 2L1BA 3PCOB 4RGTA 2NVYH 3OPOA 3VR3A 2ZJQA 3NTKA 2YTVA 4B3TL 4LFCL 3NTIA 4BXXH 3I56A 1Y1WB 2L11A 3J81c 5IP7G 2B2VC 1PV4A 1S40A 4ZLTF 2E76C 2Z6KC 3HKZG 3GTGH 3P1HA 4RCOA 1OXVA 5EKKA 4JI7Q 1ENAA 3EIVA 1UE1A 2CWAA 4C3JH 2UUCL 4CDDC 2MFIA 3MZ5A 1BQQT 2GVBA 2NVQB 4XTCS 5C3EH 4HR7B 2AUKA 3OHXC 4LMQD 2A69D 3DM3A 4NDXA 5CORA 1AE3A 3KJPA 2EPBA 1Y8OB 2ID0A 2F0SA 2K5WA 4PV1C 3OTOL 1QUQA 5L37A 1UE7A 2DNEA 2JK8A 3CPWA 4BWGB 3DM1A 5IGEA 2EY6A 4LF8L 1H9KA 3H3VI 3KF8B 3HOUG 2QKIC 1CSQA 4IUTA 1TWHH 3GTKB 2I5LX 2JA6B 3J81E 2AWOA 3J7YW 5GAEC 4K6DA 4LNQA 2MUYA 1B70B 2B63G 4DR6L 1HZ9A 3GDEA 2R93G 2OF1A 4NXML 4X64L 2B2UC 3A74A 3HFZB 4QUFA 4FF4A 3AFPA 5KYLA 3RLOA 1PA6A 2VW9A 1PRTB 2OXPA 1L0YB 3EFXD 4LFBQ 1CTMA 1LT4D 5CBAE 1JWUD 2D9UA 2ZT9C 3L3OC 3H09A 4DNIA 1EZ6A 1QJOA 1ML0D 2A73B 3NENA 3HP3A 4HJ9A 2R6GA 2L12A 3HGBA 2K75A 1WTQA 3DXJC 1VQ9A 5GADC 2NTTA 4L8JA 4XYOA 1O80A 3NPPA 2XWBB 4IOCA 3H94A 4AYBB 1V1PB 2VQEL 3HOUB 5I2YA 2PZWA 1PRTD 3BZDB 3G48A 3KK7A 4IPCA 4U68A 4KV6A 4P2CB 2A68D 3GV6A 1E3PA 1IXRA 1GUTA 2PI2E 1W6JA 3H0GB 5IYBG 4IUQA 2VQEQ 4KKSA 3Q8DA 2PW7A 1C4QA 4ID6A 5E7NA 4JVZA 2L9HA 4IUPA 3NSWA 3A5UA 5IT9E 2C9OA 3KOJA 4IALA 1PH3A 1M90C 1Y1VB 5M5XB 1X56A 1PRTF 4X65Q 1Y1WG 3HOWG 1X32A 1NCVA 2ZTEA 5JVH3 2ZXPA 4IZ8A 5FLXc 3CCUA 3TSSA 2IT1A 2F0LA 1Q86C 3CC7A 4AQYL 4DV4L 5C3XA 4OXPA 2RSOA 3CRKC 4JV5L 4X65L 1U9RA 2B2TA 3X3NA 2ES2A 3HKSA 1DOLA 3HOYG 2NN6H 4I7ZC 4H7BA 4IFDG 1JC7A 4AYBG 4X64Q 1XX8A 2XIWA 1LUZA 2OCEA 4OO1G 1SE2A 2QEJC 1KQSA 3J80L 1SNPA 3ER0A 3T4AC 5ELDA 2A8VA 3L7ZC 4C3HB 1RTOA 4A3LH 1V8QA 5CV9A 5J3BA 2YU9H 1TWCB 3TN2A 3A8IE 1FL0A 4OONA 5G3LF 3SGIA 4RG1A 1B2TA 3A56A 2CW0D 1LACA 1TT2A 4BY1H 5T1GA 3TQYA 2JA8B 3R2IA 5H1SE 1XTCD 2PW5A 4HSPA 1EEFD 3STBD 1AN8A 4OIKA 2R7DA 3GTJH 3VR4A 1QVCA 2EIFA 3P20A 4UPAA 1W3SA 1EY4A 2K14A 4R4QA 1P8LA 1STYA 4ZUJA 5C3EB 4IPGA 4HMJA 1A2UA 1PYWD 4J15A 1SDFA 4PG3A 1RF2D 1RKNA 4LK1C 1IBKQ 1Q90A 2F4VL 2VB3X 1EU4A 2DY7A 2PQAA 2JA7B 2K5QA 4B3RL 2EYOA 5GQOA 2G9HD 4X3SA 2EVBA 1QNUA 2A6HD 2LS01 4X3UA 1STGA 1O7YA 3MXNB 3GTKH 5C3EG 3E0JA 1TWAB 3GV3A 3ERSX 2F3WA 2R7ZB 1G2TA 1PFSA 3KUPA 3FDTA 1T5EA 4L6TB 4C2MB 5AJ3Q 1TY2A 2K5DA 1TWCH 2AQ3B 4KJOA 2AUJD 1YNJD 2CH4A 2J0TD 4A3MH 4N9PA 4N8FA 3K7AB 3OTOQ 1CKOA 3CCSA 3RZDB 3WDNA 1LTAD 1PH5A 3U9OA 1UEBA 1VQEA 5CV4A 4C3IH 1VQ6A 4POGA 4DV7L 2O5JC 1SNQA 4TQUS 3J7AV 1HNWQ 3R3OA 1STEA 1B9NA 2E2JH 4R8IA 1VMPA 3PIOA 4JI1Q 4A3CH 2Y0SB 1G6PA 3BYTB 3ICEA 5DAUA 1SEBD 1IBML 1F9QA 5CYUA 2NVXH 1N32L 3NE5B 4HIKA 3HEJA 4FDBA 1YNXA 2HDMA 3K5OA 1X54A 4GKJL 1EYCA 4DV6L 4IURA 1LTTD 1SAPA 2ATWA 3MXPA 3HOZH 5EQ0A 1HXYD 4FXGC 3HOZB 3I4MG 1EY9A 3PO2G 2Q8TA 1Y1VH 4RGMA 1K3RA 1E0BA 2XSCA 2XTIA 2I46A 3C46A 3MXNA 2WAQE 4EQPA 1KD1C 4JI2Q 5C44G 2NVTB 1JOKA 4A3LG 4O42A 1D8LA 4ZQ3A 4R4IA 3ZYYX 3LWUA 5CR3A 4CJ2C 1QILA 1I50B 4JI5L 2EY5A 2AQ2B 5C0XH 2LFNA 3BZCA 3UDFA 5C4ZA 2DY8A 4ULLA 1I50H 5C4XB 1K0RA 1WYDA 1PTOD 4X66Q 4X3TA 1NBWA 4PMBA 1WD0A 2RBMA 1KLGD 3SEBA 4K2KA 3AYHB 4HIMA 2KQ3A 1I4PA 4DV1L 1J6QA 3ULLA 5ISRA 5C44B 2XNAC 4BBRH 3J81i 4DAMA 4I7AA 1PYSB 3T1YQ 4DAYB 3H6MA 4IUNA 3HS0C 4IFDJ 1EY8A 2F0WA 4KN4C 3SR1A 1HUMA 5K36G 4JBKA 3HOXH 4ALPA 4HCSA 3TDQA 1S5BD 4JV5Q 1F2MA 4RWSC 5I4DA 4ZKBB 5EAYA 2RDFA 3TZDA 2JA5H 1VQBA 4KHZA 5FLMG 1JOOA 3K5LA 4GLXA 2EZVA 2IPKD 2PPBC 5C4JH 1BBXC 2EYLA 4R4CA 4AYBE 3DUZA 4V190 1LTSD 3FHWA 5IYBH 4K14A 1MIUA 3J7ZC 2D2CC 3K57A 3HOVB 1XPRA 3TZUA 1CFMA 1LTGD 2E5LL 1YZ6A 1SXTA 1CQVA 2IY5B 1VQLA 1SMXA 5IYDH 4DF7A 3IFDA 1K8OA 2HDLA 5IY0A 1HNXQ 2EYHA 4YCWA 5IWAQ 2JJQA 3KFUA 4GOPB 3CRLC 4FF1A 1EWIA 1GUGA 2C5CA 3S2DB 1O7IA 2BCOA 1PDQA 5JVG3 2JEBI 4JBMA 1PVOA 4JI5Q 3BVMA 2RCFA 4DV0Q 3RZOH 2EJFC 5M3FH 5C6AA 2KCNA 3NHHA 2HD3A 1K28A 4A3GB 4DK0A 1VDZA 1SN8A 4KLKA 2B8GA 4N8X1 3RD4A 3VR5A 1QWYA 5DM63 4A3IH 2E74C 1ASYA 4QGUA 1QUQB 4KHPQ 1RDPD 3K59A 4DV4Q 1C48A 3MTSA 1JWMD 3MFGA 5I6YA 1TWGH 2L5TA 1B8AA 3KF8A 1PZKD 4P71A 5HY6A 2YTYA 1KRSA 1DCZA 5LMUL 1RD9D 1AW7A 3HRZC 3I2ZA 3AEVA 2KBNA 1A15A 4KY7A 3NP8A 4QL5A 1YJWA 5FLXE 1IBMQ 1KRTA 3RUZA 1SSOA 4JI0L 4LUOA 3KBGA 4LFAQ 2DUDA 3PO3H 1XMQQ 1W2BA 1X3GA 5EPJA 1HQRD 3L0OA 3SK5A 4DXFA 2LSSA 2N88A 4E6IA 1D5XC 1ET6A 5JJZA 1IYVA 3I4NB 4X62L 1BDOA 4LF4Q 1B50A 2BH8A 3O13A 2AKWB 1OXXK 2F3IA 2OT2A 3K0YA 4KN7C 5IT9L 2E5LQ 4TRDA 4EX5A 5J22A 1X3QA 2H1EA 4MTKA 3J80E 1KDCA 2N8NA 2JQOA 3VR6A 1G291 1EZ8A 2F0KA 1EQVA 2MJ8A 3NBHA 5C3WA 1G6ZA 3ITPA 4B3ML 4OO1I 3F2CA 3R93A 3G4SA 1TXYA 2O5IC 4J1MA 4IUUA 2L55A 3DEPA 1BCPD 3MC0B 3NBHB 3S1MH 2A1AA 1BNZA 2WAQB 4DR2Q 1WTRA 5KEEA 1NNXA 1KDBA 3HOWB 3E5SA 4A75A 4OO1H 1IW7C 1YITA 3G6EA 3DMUA 2BA1A 3MEHA 1KXLA 4A93B 3HOYH 1HH2P 4A4IA 4JOIC 4H44C 1ZYRC 4BBRB 4XQNA 2AQ1B 1EFWA 4QF4A 2ZJRA 3T53B 1ICWA 3A54A 2WV6D 4JI6Q 1DONA 4A3IG 2HQLA 1UE5A 1LV9A 3JC66 5ELCA 4C3IB 4DV3Q 1JQYD 5A2QE 2O2LD 4BBSH 1PMRA 1HUNA 3K8AA 4DR3L 4O2DA 3Q22A 3W5OA 4DAVA 2F0IA 1WCMH 1FYCA 2L4NA 1BOSA 3A5ZB 3CF5A 4NMZA 2RA4A 1EY7A 3DLLA 1PZJD 3J7AF 1YVCA 1EQRA 3TS2A 4DXGA 2KCTA 2BDOA 2EXZA 1K8AC 2RSNA 4B9WA 2Q8RE 3VDYA 1X55A 5DNFA 4DK3C 2QF7A 3W1BA 1CA6A 4QQBX 4Y7NH 4UDUC 4PZ8A 1PH2A 1VQPA 1TS5A 1N33Q 3KJOA 2V4DA 1N32Q 4CHTB 1GD7A 1MGSA 4JK1C 3BJUA 2Y0SG 3RZOB 1CZGA 2WB1E 2R93B 2RHQB 3E0EA 1NMFA 4P73A 3LGJA 4DKAC 4A3BG 1NSNS 2PNRC 3MWYW 4DV7Q 4A3EB 5M5YH 1PTOF 5HURA 2PQEA 1HRJA 2M00A 1I94Q 3N52A 3GTPH 3VYUA 1LTBD 3ULPA 5CBEE 1Y8PB 4HSVA 3GTJB 4JYAQ 1OXSC 3W2DA 3GP7A 2K33A 2EYJA 4CKCA 2OWOA 4FXDA 4K2LA 3U9SA 1EL0A 1ILPA 1G91A 3IKJA 3CMAA 3CAMA 5IWAL 1HNXL 3RR5A 5BN4A 4LF7L 1FD7D 1SYBA 1S5CD 1TS2A 5C4HA 4MZ9A 2K50A 4BS9A 1Q3LA 1R4PB 3PUVA 4QIWB 4YY3Q 1CK1A 2FJ2A 2R7FA 5A2QL 4OWWB 1EIHA 3I4MH 1FR3A 5JJIA 4TVAB 1N36Q 1XNRL 2BA0A 1SLJA 4MIUA 2XWJB 3CD6A 5LMUQ 1EWHA 1LYLA 1QOHA 2A68C 5FLMH 3J81j 1PTOC 1B7YB 1Q1EA 1AZPA 1PRTC 5C5LA 4C1NI 1JWSD 1BF4A 1UNSA 1F9PA 4WRDA 1CA5A 1J9OA 2UUAQ 4OHJA 5A35A 1B9MA 3CCVA 2Q8IB 1UAPA 1CKMA 2F0UA 4A3IB 2JA5B 2VS1A 4K8IA 1HNZQ 4OL7A 2BDNA 1SYDA 3F8TA 3J81L 2DN8A 1SNOA 1TWFH 4QJFA 2F0FA 5ELFA 1QVFA 3T13A 1DZ1A 5M3MB 5IGBA 2B39A 1BUVT 3V05A 1PFBA 4O0AA 1SMYC 1CZWA 4KTAA 4HCEA 3MFYA 3D0FA 4X66L 2Z6BA 4R8NA 4GN3B 3NBIA 1P16A 2HQEA 1SE4A 4DN4M 4HEDA 1EYAA 1VQAA 1IHZA 4Y52H 4GS3A 2LXJA 4WJ4A 2Z1CA 1CKNA 3HOVG 3W3AA 4U673 4BA1I 4KKUA 1BXTA 4G7OC 1JCKB 3SXHA 3KDFB 1SNMA 2Z8LA 2UUCQ 1V9PA 2ICIA 3CHBD 3I8ZA 5EGTA 3BDOA 3X3MA 1K9MC 3BDCA 3MXGA 3M4QA 4HIDA 1AH9A 5EBCA 1VQ5A 3H0GG 3PV0A 4IN3A 1WI5A 4A3FG 5IT9c 1VQHA 5KGUA 4BY7G 1KDAA 3A7AB 1WJJA 2A69C 3I4NG 1MBYA 1Y1VG 1KL9A 4S3SA 3FRPB 1B3AA 2KOLA 5FKAC 1Z47A 3GTLB 2L15A 1Z6HA 1FVIA 4ZAIA 4YY3L 3JAMc 2HCCA 4C56C 1ZEQX 1ILQA 3OWEB 3SK6A 3I4MB 1I3QH 1OXTA 3B6YA 3EBEA 2K01A 3U50C 3LX0A 4A3FB 2F3VA 2A5HA 2ZXOA 3GD7A 2D62A 5IYCG 4DNTB 1OTCA 4DUYQ 4JYAL 1D5MC 5D14A 2MPMA 2PNHA 1Q8KA 3NTHA 1G8ZD 5KRUA 2L0CA 2N49A 4MHEA 2X69A 3BG3A 1EQQA 4Z9CB 3WOEA 1DOKA 2WIIB 1F2LA 4I65A 2VZAA 4A3EH 2AWNA 5AJ3L 1V43A 3MXUA 4HIOA 4BY1G 1STNA 3SK8A 3GTPB 1JR0D 1VQOA 4DR4Q 1EOTA 2NN6G 3I7FA 2F0TA 3D31A 2K52A 3STBC 1EIGA 2WACA 3JAML 5FK9C 3SVMA 1N33L 3PUYA 1Q81C 1PFNA 1HTLD 4JC0A 2RKSA 2ZTDA 2ZTCA 4FVMA 1VQGA 4UY8C 2CW0C 1SYCA 2VXWA 5FOBB 3AQQA 5JPNC 5JJLA 3CCEA 5CC4A 4GKJQ 1E1TA 3OMCA 3T16A 3VA7A 1IBKL 2MO1A 2EOTA 1PZID 1QE6A 1TQOA 2K5HA 3CMEA 1WCMG 3TP5A 1GKHA 3PO3G 3M4OB 1ZXTA 4DR4L 4A3JH 4JI1L 2F0DA 5GAGC 1STBA 4DV2L 2R92G 2ZXRA 2B63B 1WD1A 4FP5D 1CT1D 2PMZB 1S3OA 4LUVA 3S14B 5BR8L 1EWCA 2JA8H 4XDXA 4FNFA 4B3SL 1R4QB 3OWFA 1HPCA 1WTXA 1B4OA 4OELB 3K7AH 1JOQA 2K1BA 4K5VA 2VNUD 2K5VA 3PGZA 3UDIA 4MNOA 3RLNA 1XYIA 3NWTA 1XMQL 2B2VA 3H15A 1EUJA 1RL2A 2CQOA 1SJHD 4NKLA 3L9AX 3DWPA 3CW2C 2HIXA 2IHFA 2G9DA 2B29A 4JI7L 3R2TA 1JE4A 3A0JA 3UI2A 1TU2B 1BCPF 1VQKA 1K83H 3M4YA 5IODA 2JXMB 4UP7A 1VQ4A 1N34Q 2JA7H 2LXKA 1WTHA 3I90A 4HJAA 2AMCB 4AQYQ 5JEAJ 2Y0SE 2I0QA 3GTMB 4OGQC 4WJ3M 5IP9G 2SDFA 4QY7A 1STHA 4IFDH 4GOPA 1YEZA 3E6ZX 1VQCA 2NYZD 2KENA 1IL8A 3I4OA 2QGQA 5IOCA 3TRZA 5M5WH 3I73A 5FJ8G 5ELOA 3Q0AA 3TMEA 1NMGA 3BZKA 2JA8G 5JAVA 1GHKA 1X3PA 4BA2I 4EVOA 4DV0L 4ME3A 4G7ZC 4KD4A 4NW2A 1PH4A 4XT3B 2I5MX 1Y8NB 1CM9A 3MVVA 1M8AA 2O4XA 1CSPA 3I72A 5IYCH 1U4RA 3PIO3 3D6CA 3NWSA 1CHQD 2IW3A 1G51A 5LL6X 4LUZA 5IP7H 5E3FA 3PIP3 1U4MA 1K8GA 3OSOA 4IO9A 1YNNC 1KLUD 1GVPA 3IL8A 4DV5L 2QDLA 4DUZL 3LWEA 3HOYB 5EJWA 1AP0A 1DD2A 1WTWA 2R7ZH 2IHEA 3M4OH 4F88A 1VS0A 5EPLA 2UXCQ 1W6KA 3V96A 4A3KG 3S17H 4H13C 3FKIG 1X3EA 1LT6D 2IWHA 4DR5Q 1A3VA 2UUBL 1TS3A 3HOXB 4RFBA 2SNSA 1K8MA 3M4PA 4DUZQ 1JMCA 3NUCA 3EJIA 4YCVA 3M9BA 1EQTA 5FO8B 3CCLA 4DV1Q 3GTQB 1VF7A 5JOBA 1AE2A 2XRSD 1SNDA 3GO5A 3EA6A 1XNQL 1Z7TA 4APVA 2CQAA 1H9RA 1VQIA 5GAHC 3H3VH 5I2XA 1GXDC 1S5DD 3EQLC 2FMCA 5T1IA 4KY5A 1XPUA 3Q6SA 4LAAA 2JA6H
chains in the Genus database with same CATH topology
1E2WA 2FINB 2K28A 1HFGA 5IGDA 1KAAA 5BN5A 1PXUA 4DA2A 3PO3B 3QIAA 1ZKOA 4PNYA 3G6JB 4O1NA 1UEAB 4PQXA 4ME5A 2BE5C 3LNNA 1BCPB 5FO9B 2K03A 4KHVA 1Y69U 3FPUB 4RHRA 5FO7B 2E2JB 3QWNA 1WTVA 2JP1A 2F0EA 1OXUA 2E2IB 3ERQA 3QJYA 1V1PA 1WCMB 2QCPX 4KMUC 1IKMA 3I91A 2PYKA 3S1QB 1V1OA 3ONAB 4Q0FA 3BDLA 1XWEA 4C3IG 2E2HB 1WVLA 2YU9B 1D5ZC 3P7JA 3AU7A 2F0VA 3OW7A 4CBVA 1F2YA 5KIXA 1LTID 5C0XI 3S2HB 2SEBD 4K5XA 4QB4A 3IFTA 1QG7A 1F77A 5E4XA 4MN3A 3R8BA 2JYOA 5ELEA 3PO2B 3P75A 2RVLA 2F0GA 1TR5A 3EROA 1YNJC 5CMDA 3S1MB 1M4VA 5G3LD 5M9OA 1NR2A 1DJRD 5IGFA 2WP8J 5KNCA 1FGBD 3QO2A 2NUCA 1KNAA 5CGKA 5HGTA 3PUXA 4DGZA 2EY2A 3V2TA 3NXWA 5LL6S 1DM0B 1O78A 1I4XA 3MA2B 4C3HG 1B44D 2KA7A 3TP8A 2SOBA 2X6GA 2B2WA 2EYFA 3S1NB 2Z4IA 3N6RA 4LJZC 1MSHA 3K6OA 2IX1A 2F1MA 3C1EA 4KK7A 2B2YA 4B9XA 1ESRA 1D1KA 1UUPA 3RLFA 2K7VA 2M9VA 3DWQA 1CQFA 4F7XA 2MP1A 4K8JA 3TP6A 2K6AA 2R61A 1K83B 1GUWA 2K32A 2F0JA 5J1ZA 1ET9A 2E2DC 3G7LA 2KECA 5EBDA 2FHTA 4DK1A 4CJ0B 2R92B 4N9TA 5I9OA 3OMGA 3NQTA 2OEOA 5M3FB 3GTOB 5NUCA 3D4DA 1EFID 2NBFA 1I4QA 1LT3D 3K5NA 1F9RA 4RH6A 3SHLA 2JEAI 1AEXA 4J8QA 2EDGA 3KLSA 4ZK9B 2J7ZA 4XXEA 1SBBB 1I3QB 1H9SB 2RQXA 4A3JB 3QOLA 3Q23A 2FFKB 5AFWA 1RJTA 3S17B 1D2BA 2NN6I 4X3KA 3JAME 2WB1B 4FF3A 5BN3A 2F0PA 4Y7NB 1ONLA 3I3CA 2F0MA 3SK4A 1GOZA 1SMYD 3SDZA 4FO2A 3TBIB 4IQZA 2WKCA 4C3JG 4H0LC 3NK9A 1EY5A 1G2SA 2F03A 3FKIB 4A3KB 1KTKA 2BE5D 2PCFB 3NQIA 4DNRB 4C1NK 1S5FD 1U4LA 5D3DA 4DAPA 3A55A 4YIJA 1SE3A 2WKDA 4A3DB 5E4WC 4EQNA 4DFAA 5K36H 4TKOB 4RAUC 1LABA 2I07B 1GUOA 2R3ZA 2TMPA 3AB9A 2F4IA 1HQMC 4BY7B 1MI2A 5C4JB 1BR9A 4XQQA 5KNBA 1LTRD 2LMCB 1SYGA 2Z4HA 3QB3A 5CV8A 3T56B 4B08A 2A74C 3MHBA 1O7LA 4XYQA 3S16B 4UAIA 3CU7A 2J4XA 5J39A 2E75C 1MD2D 3D4WA 3PUZA 1SYFA 2NTSA 4ILWA 1AZQA 2KVMA 4KI0A 4FXKC 4GZYC 5C0XG 3Q24A 1E2ZA 1SNCA 2FMMA 1IKLA 4ABNA 2EJGC 1GJXA 5M5WB 1VMCA 5FLXL 5JEAG 1J8IA 1I6HB 4ODGA 4ZYSA 1ENFA 4DAYA 4ZUIA 1A3UA 2PZUA 1EY0A 4WFN3 3IAYA 3A8KE 3EVQA 3VYRA 3PMFA 2KJXA 3KBXA 1TY0A 5CV5A 2KHSA 2QILA 4IUVA 5D3IB 1ESFA 1A2TA 2HUGA 2CVRA 1F9SA 4K5WA 4QMGA 2MHVA 2NVYB 1S4ZA 4CKEA 4K6LA 3DHQA 3WOFA 3TP7A 5IGGA 3RMHA 1ENCA 2EY1A 2BOSA 2CHBD 1LO5D 4J6HA 1PLFA 1Q8IA 1LT5D 4F87A 5I9PA 1A3TA 2KEEA 1Q1BA 5D65A 1JORA 4WJWA 1VCIA 1QB5D 4IFDI 1H9JA 5I6WA 1MSGA 5LHY1 4CJ1B 3S1RB 3S9WA 5C0XJ 5E1FA 3H3VC 1AFPA 2D5DA 1HA6A 2XN9C 2A6ED 1L0XB 3F2UA 3HKZB 4RKBA 3FMCA 3M7GA 4OIJA 4WORA 1PTOH 2F0NA 5TSSA 4FYDA 2K05A 2VB2X 2QDBA 1EU3A 3I70A 4C3JB 3GQBA 4QCLA 3C3LA 2NZ1D 2B2TC 3ND9A 1EYDA 5CV7A 1T5XD 2LY7A 2M2LA 2K04A 2IJ0A 1KNEA 4PMWA 1IYUA 2ICEC 2EE1A 2YYZA 5KYIA 1I4GA 3D6WA 4V0BA 4EGVA 5C5MA 2IX3A 1TVXA 1TKWB 3KLRA 2JE6I 4RCNA 2H4OA 1DOMA 3A8JE 4XQJA 1E2VA 2IX0A 5K5PA 1NR4A 4G57A 3S15B 4G4KA 1PFMA 3URYA 2F0HA 4KJNA 4FF2A 1SYEA 3OOCA 1OO9B 1TIID 5DEHA 1FNUA 2JSOA 1DYQA 2HCIA 1RTNA 3A7LA 3K5MA 2B2WC 1TWGB 2SNMA 1SJED 1KABA 4XT1B 1S5ED 5F2DA 1I4RA 2B8FA 4PMCA 1II3A 5ELBA 2GA4B 1EY6A 1HHVA 3C2PA 5DM73 4CKBA 2XRQD 2EYPA 1DXMA 3OIPA 1O7ZA 3DEOA 1BO0A 4M8AA 1Q12A 2KEDA 3C1FA 3QG1A 4HAEA 5CV6A 1NUCA 4RKLA 2NWGA 4F8MA 2X6LA 1WTOA 1C8CA 4M1UB 4RHSA 1I4HA 4XIGS 1QNKA 2PO4A 3M85A 2N55A 3FPPA 4L63B 2MGSA 3BVZA 3D8GA 3H91A 3VR2A 1F2ZA 5KNDA 1HA5A 2A6HC 1STAA 4RA8A 4ZKCB 1TWHB 4CGYB 4HN7A 4DU9A 4QUCA 3SE0A 5COYA 1LLRD 2F0OA 1JICA 4KKTA 1JB3A 3I4LA 3ND8A 1YNND 1RCVD 4A3BB 1TWFB 2ENBA 4NP5A 3GTGB 2DNCA 1FNWA 3DWAA 1VF5C 2F0QA 1B53A 2VUMB 4G7HC 4Q5VA 3QOJA 2NVXB 1ZYRD 3BVGA 2EYMA 4TSSA 3AMUA 1EEID 3BS1A 3VYSA 1GUNA 3T51B 1WTPA 5IGCA 2KUMA 1CI3M 3KLSX 1IW7D 1GUSA 3CKIB 1HCZA 5EPKA 1GHJA 1HFNA 2A6EC 1D6EC 4RGOS 5EKLA 2B2YC 1RODA 1H9SA 4BY1B 4HMIA 1BCPC 4A3MB 1H9MA 2IL8A 3FEWX 1PTOB 2RDHA 1TS4A 3CQZB 4KD3A 4RGNA 3VA5A 1U4PA 1NAPA 4HTHA 2RDGA 3M7NA 4JBWA 1RHPA 5M5YB 5JEAH 1CHPD 3D3RA 3BYYB 1HTPA 4R9WA 4EQOA 2LKVA 3HG9A 2XVSA 2WINB 4KY6A 1XXGA 5JPMC 3PUWA 5IIFA 1B1ZA 5EKIA 2EJMA 2TSSA 3M3YB 1I6VC 1R9TB 1SFOB 1FNVA 1A6XA 4BBSB 2PZTA 3K58A 2NB0A 1D1IA 3HZXA 3MAQA 3D4RA 3OIQA 3VYTA 2KCCA 3FVQA 1QCBD 4ZRZA 2B2UA 2L1BA 4RGTA 3VR3A 3OPOA 3NTKA 3NTIA 1Y1WB 2L11A 2B2VC 4ZLTF 2E76C 3P1HA 4RCOA 1OXVA 5EKKA 1ENAA 3MZ5A 1BQQT 2NVQB 4XTCS 4HR7B 2AUKA 3OHXC 4LMQD 2A69D 4NDXA 5CORA 2EPBA 1Y8OB 2ID0A 4PV1C 2F0SA 2K5WA 2DNEA 4BWGB 3DM1A 5IGEA 2EY6A 1H9KA 2QKIC 4IUTA 3GTKB 2JA6B 3J81E 2AWOA 3J7YW 4K6DA 2MUYA 2OF1A 2B2UC 4QUFA 4FF4A 5KYLA 1PRTB 2OXPA 1L0YB 3EFXD 1CTMA 1LT4D 5CBAE 1JWUD 2D9UA 2ZT9C 3L3OC 3H09A 1EZ6A 1QJOA 1ML0D 2A73B 3HP3A 2R6GA 2L12A 3HGBA 1WTQA 3DXJC 2NTTA 4L8JA 4XYOA 1O80A 3NPPA 2XWBB 3H94A 4AYBB 1V1PB 3HOUB 5I2YA 2PZWA 1PRTD 3BZDB 3KK7A 4U68A 4KV6A 4P2CB 2A68D 3GV6A 1GUTA 1W6JA 3H0GB 4IUQA 4KKSA 2PW7A 1C4QA 4ID6A 2L9HA 4IUPA 3NSWA 5IT9E 2C9OA 4IALA 1Y1VB 5M5XB 1PRTF 1X32A 1NCVA 5JVH3 2ZXPA 4IZ8A 3TSSA 2IT1A 2F0LA 5C3XA 2RSOA 3CRKC 1U9RA 2B2TA 3X3NA 1DOLA 2NN6H 4I7ZC 4H7BA 4IFDG 1JC7A 1XX8A 2XIWA 4OO1G 1SE2A 2QEJC 3J80L 1SNPA 3T4AC 5ELDA 3L7ZC 4C3HB 1RTOA 1V8QA 5CV9A 1TWCB 3TN2A 3A8IE 5G3LF 1B2TA 2CW0D 3A56A 1LACA 1TT2A 5T1GA 2JA8B 3R2IA 1XTCD 2PW5A 4HSPA 1EEFD 1AN8A 4OIKA 3VR4A 3P20A 1EY4A 1STYA 4ZUJA 5C3EB 4HMJA 1A2UA 1PYWD 1SDFA 1RF2D 1RKNA 4LK1C 1Q90A 2VB3X 1EU4A 2DY7A 2JA7B 2K5QA 2EYOA 2G9HD 4X3SA 2EVBA 1QNUA 2A6HD 2LS01 4X3UA 1STGA 1O7YA 3E0JA 1TWAB 3GV3A 2F3WA 2R7ZB 1G2TA 3KUPA 3FDTA 1T5EA 4L6TB 4C2MB 1TY2A 2K5DA 2AQ3B 4KJOA 2AUJD 1YNJD 2J0TD 4N9PA 3K7AB 3RZDB 3WDNA 1LTAD 3U9OA 5CV4A 2O5JC 1SNQA 4TQUS 3J7AV 3R3OA 1STEA 1B9NA 4R8IA 1VMPA 2Y0SB 3BYTB 5DAUA 1SEBD 1F9QA 5CYUA 3NE5B 3HEJA 2HDMA 3K5OA 1EYCA 4IURA 1LTTD 1SAPA 3MXPA 5EQ0A 1HXYD 4FXGC 3HOZB 1EY9A 2Q8TA 4RGMA 1E0BA 2XSCA 2I46A 3C46A 3MXNA 4EQPA 2NVTB 1JOKA 4O42A 4ZQ3A 3ZYYX 3LWUA 5CR3A 4CJ2C 1QILA 1I50B 2EY5A 2AQ2B 5C0XH 2LFNA 5C4ZA 2DY8A 4ULLA 5C4XB 1PTOD 4X3TA 4PMBA 1WD0A 2RBMA 1KLGD 3SEBA 4K2KA 2KQ3A 1I4PA 5ISRA 5C44B 2XNAC 3H6MA 4IUNA 3HS0C 4IFDJ 1EY8A 2F0WA 4KN4C 3SR1A 1HUMA 5K36G 4HCSA 3TDQA 1S5BD 1F2MA 4RWSC 5I4DA 4ZKBB 2RDFA 3TZDA 4KHZA 1JOOA 3K5LA 2EZVA 2IPKD 2PPBC 1BBXC 2EYLA 3DUZA 4V190 1LTSD 4K14A 2D2CC 3HOVB 3K57A 3TZUA 1CFMA 1LTGD 1SXTA 1CQVA 4DF7A 3IFDA 1K8OA 2HDLA 2EYHA 3CRLC 4FF1A 1GUGA 2C5CA 3S2DB 2BCOA 1PDQA 5JVG3 2JEBI 3BVMA 2EJFC 5C6AA 2KCNA 3NHHA 4A3GB 4DK0A 1VDZA 2B8GA 3RD4A 3VR5A 1QWYA 5DM63 2E74C 1RDPD 3K59A 1C48A 3MTSA 1JWMD 3MFGA 5I6YA 2L5TA 3KF8A 1PZKD 1DCZA 1RD9D 1AW7A 3HRZC 1A15A 4KY7A 3NP8A 5FLXE 3RUZA 1SSOA 3KBGA 5EPJA 1HQRD 3SK5A 4DXFA 2N88A 4E6IA 1D5XC 1ET6A 5JJZA 1IYVA 3I4NB 1BDOA 1B50A 3O13A 1OXXK 2OT2A 3K0YA 4KN7C 5IT9L 4TRDA 5J22A 1X3QA 2H1EA 3J80E 1KDCA 3VR6A 1G291 1EZ8A 2F0KA 1EQVA 2MJ8A 3NBHA 5C3WA 1G6ZA 3ITPA 4OO1I 3R93A 2O5IC 4J1MA 4IUUA 2L55A 1BCPD 3DEPA 3MC0B 1BNZA 2WAQB 1WTRA 5KEEA 1KDBA 3HOWB 3E5SA 4OO1H 1IW7C 3DMUA 2BA1A 3MEHA 4A93B 4H44C 1ZYRC 4BBRB 4XQNA 2AQ1B 4QF4A 3T53B 1ICWA 3A54A 2WV6D 1DONA 1LV9A 5ELCA 4C3IB 1JQYD 5A2QE 2O2LD 1PMRA 1HUNA 3Q22A 4DAVA 2F0IA 1FYCA 2L4NA 1BOSA 4NMZA 2RA4A 1EY7A 1PZJD 3J7AF 4DXGA 2BDOA 2EXZA 2RSNA 4B9WA 2Q8RE 5DNFA 2QF7A 1CA6A 4UDUC 1TS5A 2V4DA 4CHTB 1MGSA 4JK1C 3RZOB 1CZGA 2R93B 1NSNS 2PNRC 3MWYW 4A3EB 1PTOF 5HURA 2PQEA 1HRJA 2M00A 3N52A 3VYUA 1LTBD 5CBEE 1Y8PB 4HSVA 3GTJB 1OXSC 3W2DA 3GP7A 2K33A 2EYJA 4CKCA 4FXDA 4K2LA 3U9SA 1EL0A 1ILPA 1G91A 3IKJA 5BN4A 1SYBA 1FD7D 1S5CD 1TS2A 5C4HA 4BS9A 1Q3LA 1R4PB 3PUVA 4QIWB 1CK1A 2FJ2A 1EIHA 5A2QL 1FR3A 2BA0A 4MIUA 2XWJB 1EWHA 1QOHA 2A68C 1PTOC 1Q1EA 1AZPA 1PRTC 5C5LA 4C1NI 1JWSD 1BF4A 1UNSA 1F9PA 4WRDA 1CA5A 1J9OA 4OHJA 5A35A 1B9MA 2Q8IB 1UAPA 2F0UA 4A3IB 2JA5B 4K8IA 2BDNA 4OL7A 1SYDA 3J81L 2DN8A 1SNOA 2F0FA 5ELFA 3T13A 1DZ1A 5M3MB 5IGBA 2B39A 1BUVT 3V05A 1PFBA 1SMYC 1CZWA 4KTAA 4HCEA 3MFYA 4R8NA 3NBIA 2HQEA 1SE4A 4DN4M 4HEDA 1EYAA 1IHZA 2Z1CA 3W3AA 4U673 4BA1I 4KKUA 1BXTA 4G7OC 1JCKB 3SXHA 1SNMA 2Z8LA 3I8ZA 2ICIA 3CHBD 5EGTA 3BDOA 3X3MA 3BDCA 3MXGA 5EBCA 3PV0A 4IN3A 5KGUA 1KDAA 3A7AB 2A69C 1MBYA 4S3SA 3FRPB 1B3AA 2KOLA 5FKAC 1Z47A 3GTLB 1Z6HA 4ZAIA 2HCCA 4C56C 1ZEQX 1ILQA 3OWEB 3SK6A 3I4MB 1OXTA 2K01A 3LX0A 4A3FB 2F3VA 2A5HA 2ZXOA 3GD7A 2D62A 4DNTB 1D5MC 5D14A 2MPMA 3NTHA 1G8ZD 5KRUA 2L0CA 4MHEA 2X69A 3BG3A 4Z9CB 3WOEA 1DOKA 2WIIB 1F2LA 4I65A 2AWNA 1V43A 3MXUA 1STNA 3SK8A 3GTPB 1JR0D 1EOTA 2NN6G 2F0TA 3D31A 1EIGA 2WACA 3JAML 5FK9C 3SVMA 3PUYA 1PFNA 1HTLD 2RKSA 4FVMA 2CW0C 1SYCA 2VXWA 5FOBB 5JPNC 5CC4A 3OMCA 3T16A 3VA7A 2EOTA 1PZID 1QE6A 1TQOA 3TP5A 3M4OB 1ZXTA 2F0DA 1STBA 2ZXRA 2B63B 1WD1A 4FP5D 1CT1D 2PMZB 3S14B 1EWCA 4XDXA 4FNFA 1R4QB 3OWFA 1HPCA 1WTXA 1B4OA 1JOQA 2K1BA 4K5VA 2VNUD 1XYIA 3NWTA 2B2VA 1SJHD 4NKLA 3L9AX 3DWPA 2G9DA 3R2TA 1JE4A 3UI2A 1TU2B 1BCPF 3M4YA 5IODA 2JXMB 3I90A 5JEAJ 3GTMB 4OGQC 2SDFA 1STHA 4IFDH 3E6ZX 2NYZD 1IL8A 5IOCA 3I73A 3Q0AA 3TMEA 5JAVA 1GHKA 1X3PA 4BA2I 4EVOA 4G7ZC 4KD4A 4NW2A 4XT3B 1Y8NB 1CM9A 3MVVA 1M8AA 2O4XA 3I72A 1U4RA 3PIO3 3D6CA 3NWSA 1CHQD 2IW3A 5LL6X 5E3FA 3PIP3 1U4MA 3OSOA 1YNNC 1KLUD 3IL8A 3LWEA 3HOYB 5EJWA 1AP0A 1DD2A 1WTWA 4F88A 5EPLA 1W6KA 3V96A 4H13C 1LT6D 2IWHA 1A3VA 1TS3A 3HOXB 4RFBA 2SNSA 1K8MA 3NUCA 3EJIA 1EQTA 5FO8B 3GTQB 1VF7A 5JOBA 2XRSD 1SNDA 3GO5A 3EA6A 1Z7TA 2CQAA 1H9RA 5I2XA 1GXDC 1S5DD 2FMCA 3EQLC 5T1IA 4KY5A 3Q6SA 4LAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4H A;  4KY6 A;  2F0H A;  4KJN A;  3QOL A;  3S9W A;  3D4W A;  3E5S A;  1F2Z A;  5E1F A;  1SYF A;  3HEJ A;  2NUC A;  3LX0 A;  5CGK A;  5HGT A;  2F3V A;  1STA A;  5IGD A;  1KAA A;  3DMU A;  1STH A;  4K6D A;  1SNP A;  1EYC A;  3MEH A;  4DGZ A;  1SNC A;  2EY2 A;  3MXP A;  4MIU A;  3V2T A;  4DU9 A;  5IOC A;  1SYE A;  3NXW A;  5KRU A;  4PNY A;  2F0P A;  2OF1 A;  2F0O A;  4RKB A;  5C6A A;  3NHH A;  5CV9 A;  5IIF A;  2F0M A;  4QF4 A;  3SK4 A;  5C5L A;  4I65 A;  5DEH A;  4WOR A;  4ME5 A;  3TME A;  1EY9 A;  2F0N A;  5KYL A;  3TP8 A;  1TT2 A;  2SOB A;  5JAV A;  4WRD A;  2EYF A;  1STN A;  4EVO A;  3SK8 A;  2OXP A;  2SNM A;  4KHV A;  2QDB A;  2PW5 A;  4KD4 A;  2ENB A;  4ODG A;  4NP5 A;  4EQP A;  2F0U A;  1KAB A;  2PZT A;  3NK9 A;  4K8I A;  1EY5 A;  2F0T A;  5I6Y A;  4OL7 A;  1SYD A;  1JOK A;  1A3U A;  2O4X A;  2PZU A;  1EY0 A;  1SNO A;  3C1E A;  3HZX A;  3MVV A;  5CR3 A;  4ZQ3 A;  2F0F A;  1EZ6 A;  2WAC A;  1EY4 A;  4B9X A;  2EY5 A;  3EVQ A;  3D6C A;  3T13 A;  2F0I A;  1STY A;  2RKS A;  4ZUJ A;  3PMF A;  5F2D A;  5C4Z A;  5IGB A;  2F0Q A;  4LAA A;  2F0E A;  4PMC A;  4NMZ A;  5E3F A;  1EY7 A;  1EYD A;  1SYC A;  3ERQ A;  4HMJ A;  1II3 A;  1A2U A;  3NP8 A;  2KHS A;  4KTA A;  4KY7 A;  3QOJ A;  5CV7 A;  5CV5 A;  5CC4 A;  4F7X A;  1RKN A;  3OMC A;  3T16 A;  1EY6 A;  4K8J A;  1A2T A;  2EYM A;  3OSO A;  4PMB A;  3TP6 A;  3RUZ A;  2EXZ A;  4R8N A;  1TQO A;  3TP5 A;  2RBM A;  2HQE A;  4B9W A;  2PYK A;  4K5W A;  1EYA A;  4K2K A;  1IHZ A;  2PZW A;  4YIJ A;  4QMG A;  2EYP A;  2EYO A;  2KQ3 A;  2F0J A;  5J1Z A;  4KV6 A;  5IGC A;  3BDL A;  5KYI A;  2F0D A;  1STG A;  4EQN A;  1STB A;  5ISR A;  4DFA A;  3SK5 A;  3DHQ A;  4N9T A;  3H6M A;  2F3W A;  4IUN A;  5EKL A;  1EY8 A;  2F0W A;  3SXH A;  1SNM A;  4E6I A;  3SR1 A;  3TP7 A;  2F0V A;  5IGG A;  5C5M A;  1ENC A;  1F2Y A;  2EY1 A;  3OMG A;  4HMI A;  5I9O A;  2PW7 A;  3NQT A;  2OEO A;  1A3V A;  1F2M A;  4ID6 A;  5EGT A;  3OWF A;  4ZUI A;  5NUC A;  3BDC A;  3D4D A;  4K5X A;  4QB4 A;  1JOQ A;  3C1F A;  2RDF A;  3P1H A;  4J6H A;  4K5V A;  4KJO A;  2SNS A;  5EKK A;  1NSN S;  1JOO A;  4IAL A;  1ENA A;  1NUC A;  4RKL A;  4N9P A;  4KD3 A;  4TRD A;  5CV6 A;  3VA5 A;  5HUR A;  5J22 A;  2PQE A;  3EJI A;  3NUC A;  2EYL A;  4F8M A;  4HTH A;  5KGU A;  3P75 A;  2M00 A;  5I9P A;  3SHL A;  1KDC A;  1KDA A;  3MZ5 A;  1A3T A;  5JOB A;  1SYG A;  3QB3 A;  1EZ8 A;  4K14 A;  5CV8 A;  2F0G A;  2F0K A;  3U9O A;  1SND A;  4NKL A;  3MHB A;  1AEX A;  4S3S A;  5CV4 A;  1TR5 A;  1EQV A;  3ERO A;  4IZ8 A;  5C3W A;  2EYJ A;  2F0L A;  1SNQ A;  4NDX A;  3ITP A;  5KIX A;  1JOR A;  3R3O A;  5C3X A;  4EQO A;  4J1M A;  4K2L A;  5K5P A;  5M9O A;  2F0S A;  1U9R A;  4G57 A;  2LKV A;  4DF7 A;  5I6W A;  5IOD A;  2EYH A;  5J39 A;  3D8G A;  4KY5 A;  5IGE A;  5DAU A;  2EY6 A;  5KEE A;  5IGF A;  3SK6 A;  1KDB A;  4H7B A;  1SYB A; 
#chains in the Genus database with same CATH topology
 1E2W A;  2FIN B;  2K28 A;  2ASB A;  4LF9 Q;  1HFG A;  5IGD A;  1KAA A;  5BN5 A;  1PXU A;  4DA2 A;  2ALY B;  1VQJ A;  3TRE A;  3PO3 B;  3QIA A;  1ZKO A;  4PNY A;  3G6J B;  2HHH Q;  4O1N A;  3E3X A;  1UEA B;  1JE5 A;  4PQX A;  4H02 A;  4JPB W;  4ME5 A;  1A8V A;  2BE5 C;  3LNN A;  1BCP B;  2N3S A;  2ZJP A;  5FO9 B;  2K03 A;  1IZ6 A;  4KHV A;  1N8R C;  1Y69 U;  4BY7 H;  2CFM A;  3FPU B;  4IPH A;  2PI2 A;  4RHR A;  2QEX A;  2PMZ E;  2KHJ A;  2RF4 A;  3F2D A;  4OX9 Q;  5FO7 B;  1NY4 A;  2E2J B;  4R4T A;  3QWN A;  1WTV A;  1VQ8 A;  2JP1 A;  2F0E A;  1OXU A;  2E2I B;  3ERQ A;  1SE8 A;  3QJY A;  1V1P A;  1WCM B;  4YCU A;  4DR3 Q;  2QCP X;  4KMU C;  1IKM A;  3I91 A;  2PYK A;  3S1Q B;  2CH4 W;  1V1O A;  1JT8 A;  3ONA B;  4Q0F A;  3BDL A;  1XWE A;  4C3I G;  4DUY L;  2E2H B;  1WVL A;  2YU9 B;  1D5Z C;  3NEL A;  3P7J A;  2UU9 Q;  2EXD A;  3AU7 A;  2F0V A;  2E2H H;  1TWA H;  3OW7 A;  4BBR G;  4CBV A;  1F2Y A;  5KIX A;  1LTI D;  5C0X I;  3S2H B;  2SEB D;  4K5X A;  4QB4 A;  3IFT A;  3S14 H;  1QG7 A;  1F77 A;  4DK6 C;  4A3D G;  5E4X A;  4IPD A;  4CDF C;  4MN3 A;  3R8B A;  2NVQ H;  2JYO A;  5ELE A;  3PO2 B;  3P75 A;  2RVL A;  2F0G A;  1XPO A;  1TR5 A;  3ERO A;  1YNJ C;  5CMD A;  3S1M B;  1M4V A;  5G3L D;  5M9O A;  1NR2 A;  1MKH A;  2VQF Q;  1DJR D;  2QW7 A;  3PSI A;  4IJH A;  2N78 A;  5IGF A;  2H5X A;  4L5S A;  2WP8 J;  2HHH L;  5KNC A;  1FGB D;  4LF6 Q;  3QO2 A;  2NUC A;  1KNA A;  5CGK A;  5HGT A;  2JN4 A;  3PF5 A;  3PUX A;  4DGZ A;  2EY2 A;  3V2T A;  2UXD L;  1U5K A;  3NXW A;  5LL6 S;  1DM0 B;  2F52 A;  3HOZ G;  4C2M H;  1O78 A;  1I4X A;  2Q2U A;  1NTG A;  3MA2 B;  4LW1 A;  5LMN L;  4B3S Q;  4C3H G;  1C7Y A;  3QR8 A;  1B44 D;  1EOV A;  2KA7 A;  3TP8 A;  2SOB A;  2X6G A;  3E9I A;  1IBL L;  2YV5 A;  2B2W A;  2EYF A;  3S1N B;  3K0X A;  3PIP A;  2NVT H;  3IRB A;  1XMO L;  2Z4I A;  3N6R A;  5IE8 A;  4LJZ C;  1MSH A;  3K6O A;  2IX1 A;  1KHI A;  1PH7 A;  2F1M A;  3C1E A;  4KK7 A;  2B2Y A;  4B9X A;  1ESR A;  1BVS A;  1HZC A;  2VUM H;  1D1K A;  1HR0 L;  1UUP A;  4B3R Q;  3RN5 A;  3RLF A;  2K7V A;  2M9V A;  3DWQ A;  1EIY B;  2Q2T A;  1CQF A;  4F7X A;  4DR2 L;  2JA6 G;  1HZB A;  2MP1 A;  4K8J A;  3TP6 A;  2JA7 G;  3J80 c;  2K6A A;  4L5Q A;  2R61 A;  1K83 B;  4A3M G;  4B3M Q;  3K81 C;  1T9H A;  1GUW A;  1K3B C;  2K32 A;  4OEM B;  2F0J A;  5J1Z A;  1ET9 A;  2E2D C;  3G7L A;  2KEC A;  5EBD A;  1HR0 W;  2FHT A;  1BBW A;  2MO0 A;  4DK1 A;  2JA9 A;  1A0I A;  2E8G A;  1NE3 A;  4CJ0 B;  4HJ5 A;  2R92 B;  4N9T A;  1WFQ A;  5I9O A;  1X3F A;  3OMG A;  3NQT A;  2OEO A;  1Q82 C;  2R7Z G;  5M3F B;  3CCQ A;  3GTO B;  5NUC A;  3D4D A;  1EFI D;  2NBF A;  1I4Q A;  1HJP A;  1LT3 D;  1Q46 A;  4X6A H;  1BKB A;  1QVG A;  3K5N A;  1F9R A;  1JJ2 A;  4RH6 A;  3SHL A;  2K5N A;  2JEA I;  1AEX A;  1KAW A;  3E9H A;  1YHB A;  4J8Q A;  2EDG A;  1WOC A;  3KLS A;  4ZK9 B;  2J7Z A;  4XXE A;  3U4Z A;  1X6O A;  1SBB B;  1I3Q B;  4CDE C;  1H9S B;  2RQX A;  4A3J B;  3QOL A;  4DPG A;  3Q23 A;  4DR5 L;  3UDX A;  5GRO A;  2FFK B;  5AFW A;  1RJT A;  1C9O A;  3UDG A;  3S17 B;  1D2B A;  2NN6 I;  4X3K A;  2WB1 B;  3JAM E;  4FF3 A;  3CCJ A;  5BN3 A;  2F0P A;  4Y7N B;  1ONL A;  4KHP L;  3I3C A;  1KIX A;  2F0M A;  3SK4 A;  1GOZ A;  1MJC A;  1SMY D;  1YIJ A;  4JI3 Q;  1YI2 A;  1XNR Q;  3SDZ A;  3RNU A;  4FO2 A;  4GKK L;  1U0L A;  3TBI B;  4DR1 L;  4IQZ A;  3RN2 A;  2WKC A;  4C3J G;  4A93 G;  4H0L C;  3NK9 A;  1EY5 A;  5FJ8 H;  4NXN Q;  3CQZ H;  1E1O A;  4JOI A;  1G2S A;  2F03 A;  1GO3 E;  3FKI B;  3CC2 A;  4A3K B;  2P5Z X;  5IP9 H;  3U58 A;  1KTK A;  2BE5 D;  2VL6 A;  3ULJ A;  5LMN Q;  2PCF B;  2WAQ G;  3NQI A;  4DNR B;  4C1N K;  1S5F D;  3T1H Q;  5C4X G;  3S1Q H;  2E2I H;  1U4L A;  5D3D A;  2MNA A;  3S2D H;  4DAP A;  3ZJY C;  3A55 A;  4JI4 L;  4YIJ A;  4JI8 L;  1SE3 A;  3KF6 A;  2EQS A;  2WKD A;  4A3D B;  5E4W C;  4EQN A;  4DFA A;  3GTM H;  5K36 H;  3J80 i;  1LAB A;  4RAU C;  2I07 B;  4TKO B;  1GUO A;  2R92 H;  2R3Z A;  2TMP A;  3AB9 A;  2F4I A;  1HQM C;  4BY7 B;  1MI2 A;  5C4J B;  4GNX B;  5M5X H;  1BR9 A;  3I55 A;  4XQQ A;  5KNB A;  2QA4 A;  1LTR D;  5M3M G;  2LMC B;  4B3T Q;  4L5T A;  3UE0 A;  1SYG A;  2Z4H A;  3QB3 A;  5CV8 A;  1JB7 A;  3T56 B;  2A74 C;  3MHB A;  4B08 A;  1O7L A;  4XYQ A;  3U4V A;  3S16 B;  4UAI A;  2D0P A;  4JI8 Q;  3CU7 A;  1FJG L;  1C0A A;  2J4X A;  5J39 A;  2E75 C;  1QZH A;  3K80 C;  1MD2 D;  3D4W A;  3PUZ A;  1SYF A;  2NTS A;  4ILW A;  1AZQ A;  2KVM A;  4KI0 A;  4FXK C;  4GZY C;  4JI6 L;  2HIV A;  5C0X G;  3Q24 A;  1E2Z A;  1SNC A;  4A3F H;  2FMM A;  1IKL A;  4ABN A;  4YWK A;  1K73 C;  2EJG C;  1GJX A;  4LFA L;  5M5W B;  1VMC A;  5FLX L;  5JEA G;  1J8I A;  1I6H B;  4AH6 A;  1PH1 A;  3M3Y H;  4ODG A;  4ZYS A;  1ENF A;  2RCN A;  4DAY A;  1XTD A;  4JBJ A;  1A3U A;  4ZUI A;  2PZU A;  1EY0 A;  4WFN 3;  3IAY A;  3A8K E;  2Q2I A;  1L1O C;  3EVQ A;  3VYR A;  3PMF A;  1MHW C;  2KJX A;  3KBX A;  1TY0 A;  5CV5 A;  2KHS A;  2QIL A;  4IUV A;  3F2B A;  5D3I B;  1ESF A;  1A2T A;  1VQD A;  2HUG A;  1L1O A;  4PZ6 A;  2CVR A;  1F9S A;  2WFW A;  4K0K Q;  1YJN A;  4K5W A;  4QMG A;  1CUK A;  1L1O B;  2MHV A;  4DV3 L;  1ICF B;  2NVY B;  3T1H L;  1S4Z A;  4CKE A;  4K6L A;  3I4N H;  1S72 A;  3DHQ A;  3MEF A;  3WOF A;  1VQM A;  3TP7 A;  1A63 A;  3K7U C;  5IGG A;  3RMH A;  1ENC A;  2EY1 A;  4C3H H;  2GVA A;  4GN4 B;  4UHV A;  2BOS A;  2CHB D;  1LO5 D;  4J6H A;  4QIW E;  3WWV A;  1PLF A;  1Q8I A;  1LT5 D;  4F87 A;  5HGQ A;  5I9P A;  3CCM A;  2Q2H A;  1A3T A;  2KEE A;  1Q1B A;  4GKK Q;  4OX9 L;  2G5D A;  5D65 A;  4DR7 L;  4LWC A;  1JOR A;  4JG2 A;  4WJW A;  1LTL A;  1VCI A;  3S1R H;  1KC8 C;  1QB5 D;  5IYD G;  4IFD I;  1H9J A;  5I6W A;  1YJ9 A;  3F1Z A;  1MSG A;  1Y14 B;  5LHY 1;  4CJ1 B;  3S1R B;  3S9W A;  5C0X J;  2B3G A;  3W1G A;  5E1F A;  3H3V C;  1AFP A;  2D5D A;  1HA6 A;  1N36 L;  2Z0S A;  2XN9 C;  2HT1 A;  2A6E D;  3BU2 A;  1L0X B;  3F2U A;  4A3G H;  3HKZ B;  3KYH C;  2UXB L;  4RMF A;  4P75 A;  4RKB A;  4OWX B;  1XJV A;  3CC4 A;  3FMC A;  3M7G A;  4OIJ A;  4GNX C;  4WOR A;  1PTO H;  2F0N A;  1SR3 A;  5TSS A;  4FYD A;  2K05 A;  2VB2 X;  2QDB A;  3GTQ H;  3PQI A;  1JJG A;  1EU3 A;  1N9W A;  3HOV H;  3I70 A;  4C3J B;  3GQB A;  2UXD Q;  4JI0 Q;  4DR1 Q;  1PYB A;  1UE6 A;  2VY3 A;  4QCL A;  3C3L A;  2NZ1 D;  2B2T C;  3ND9 A;  2OTJ A;  1EYD A;  5CV7 A;  1T5X D;  3S16 H;  3FP9 A;  5M3M H;  3HOW H;  1Q7Y C;  2LY7 A;  2M2L A;  2K04 A;  1V1Q A;  2CWP A;  2IJ0 A;  1PH8 A;  1KNE A;  4PMW A;  1IYU A;  2ICE C;  2EE1 A;  2YYZ A;  4BBS G;  2I5H A;  4GLV B;  5KYI A;  2GN5 A;  1IYJ B;  1I4G A;  4DR7 Q;  3D6W A;  4V0B A;  4EGV A;  3S2H H;  5C5M A;  2IX3 A;  1I6H H;  4A3B H;  1TVX A;  1TKW B;  3KLR A;  1IL2 A;  4LF7 Q;  2JE6 I;  4RCN A;  2MQH A;  2H4O A;  1HNW L;  1DOM A;  2AHO B;  4YHH Q;  3JAM i;  3A8J E;  2WB1 G;  1IBL Q;  4LF8 Q;  4XQJ A;  1E2V A;  2IX0 A;  1SRO A;  5K5P A;  1I94 L;  1NR4 A;  4G57 A;  4PZ7 A;  2V1C C;  3S15 B;  4G4K A;  1PFM A;  3OYY A;  5C4X H;  5LMN W;  3URY A;  4P74 A;  1NJI C;  2XGT A;  2F0H A;  4KJN A;  4LF6 L;  4FF2 A;  1VQN A;  2CCZ A;  1SRU A;  3EN2 A;  1Y1W H;  1E7Z A;  4ZCK A;  1SYE A;  3OOC A;  1OO9 B;  1EIF A;  1TII D;  3CP0 A;  2R93 H;  4LFB L;  3S24 A;  4A93 H;  5DEH A;  1FNU A;  2D0O A;  2JSO A;  1DYQ A;  4DV6 Q;  2HCI A;  1N34 L;  4A76 A;  2F4V Q;  1RTN A;  3A7L A;  2ZM6 Q;  3K5M A;  1ASZ A;  2B2W C;  1TWG B;  2SNM A;  1LM0 A;  1SJE D;  1UWV A;  4GLA C;  1KAB A;  4R4O A;  1YHA A;  4XT1 B;  1XMO Q;  1S5E D;  4L5R C;  5F2D A;  4JI4 Q;  1I4R A;  2B8F A;  4PMC A;  4LF9 L;  1II3 A;  4A3K H;  5ELB A;  4LF4 L;  2GA4 B;  1EY6 A;  1HHV A;  3C2P A;  5DM7 3;  1K0S A;  1CKN B;  4CKB A;  1PH9 A;  2XRQ D;  2EYP A;  1DXM A;  1FJG Q;  3OIP A;  1JJC B;  4R1J A;  1L0W A;  1O7Z A;  2PQA B;  3DEO A;  4M8A A;  1BO0 A;  2K4K A;  1HZA A;  5DLQ E;  3GTO H;  4IJL A;  1GM5 A;  2OQK A;  1SFO H;  1Q12 A;  1VQ7 A;  2VQF L;  1X65 A;  3KDF A;  2JA5 G;  2ZM6 L;  2KED A;  3C1F A;  3QG1 A;  4HAE A;  5CV6 A;  1NUC A;  4RKL A;  2OTL A;  2NWG A;  4F8M A;  2X6L A;  2KHI A;  4P72 A;  1WTO A;  2CKZ B;  1C8C A;  4M1U B;  4RHS A;  1I4H A;  4XIG S;  3KF6 B;  1QNK A;  2PO4 A;  3M85 A;  4HJ7 A;  3HKZ E;  1J5E Q;  2N55 A;  3FPP A;  4NB3 A;  4L63 B;  2MGS A;  3BVZ A;  3D8G A;  1DGS A;  3H91 A;  2UU9 L;  3CXC A;  1RIP A;  3S15 H;  3VR2 A;  1F2Z A;  5KND A;  2RHS B;  2Z6K A;  2Z9H A;  4JW0 A;  1HA5 A;  2A6H C;  4X62 Q;  4YWM A;  1STA A;  4GNX A;  4RA8 A;  3HOU H;  1PHJ A;  1H95 A;  4ZKC B;  1TWH B;  4YWL A;  4CGY B;  4HN7 A;  4UP8 A;  1BBU A;  4DU9 A;  4QUC A;  3SE0 A;  5COY A;  1LLR D;  2F0O A;  1JIC A;  2OQ0 A;  4YHH L;  4KKT A;  2B63 H;  1JB3 A;  1R9T H;  4NXN L;  3I4L A;  3ND8 A;  3J7A 5;  1YNN D;  1RCV D;  4A3E G;  2UXB Q;  4A3B B;  1TWF B;  2ENB A;  4NP5 A;  4HJ8 A;  3GTG B;  2DNC A;  1HNZ L;  1D7Q A;  1FNW A;  3GTL H;  3DWA A;  4JI3 L;  4A3G G;  2UUB Q;  4LF5 L;  2BH2 A;  5ELN A;  4AIM A;  1VF5 C;  3TEH B;  2F0Q A;  1B3Q A;  3TS0 A;  1B53 A;  2FXQ A;  2VUM B;  4G7H C;  4Q5V A;  3QOJ A;  2NVX B;  4NPS A;  1ZYR D;  2NZO A;  3BVG A;  2EYM A;  4LF5 Q;  3AFQ A;  4A3C G;  4TSS A;  4A3J G;  3CCR A;  3AMU A;  4A3D H;  1EEI D;  3BS1 A;  3VYS A;  1GUN A;  3T51 B;  1WTP A;  5IGC A;  2KUM A;  1CI3 M;  3KLS X;  1IW7 D;  4DR6 Q;  1GUS A;  3CKI B;  1HCZ A;  5EPK A;  1GHJ A;  1HFN A;  2A6E C;  1D6E C;  4RGO S;  5EKL A;  4EQ5 A;  5JJK A;  2B2Y C;  4BXX G;  1ROD A;  1H9S A;  4BY1 B;  2YTX A;  3H0G H;  2C35 B;  4HMI A;  1BCP C;  2VUM G;  4A3M B;  3L2P A;  3OW2 A;  1H9M A;  2IL8 A;  3FEW X;  3PF4 A;  4OWT B;  4CDC C;  5M3F G;  3RZD H;  1XNQ Q;  1PTO B;  2RDH A;  1TS4 A;  3CQZ B;  4KD3 A;  1M1K C;  4RGN A;  3VA5 A;  1U4P A;  1NAP A;  3S1N H;  4HTH A;  2RDG A;  5BR8 Q;  2DJF C;  1X9N A;  4JBW A;  3M7N A;  1RHP A;  3KLW A;  5M5Y B;  1EYG A;  4MTN A;  1CHP D;  3D3R A;  5JEA H;  3BYY B;  4K0K L;  1A62 A;  1HTP A;  4R9W A;  2KCM A;  1J5E L;  4EQO A;  2LKV A;  2A19 A;  4JCV E;  3HG9 A;  1MJE A;  2UUA L;  1L2F A;  2XVS A;  1QZG A;  1FGU A;  2WIN B;  4KY6 A;  2UXC L;  1XXG A;  2DGY A;  4POF A;  3UE1 A;  4LFC Q;  3CPF A;  4UP9 A;  5JPM C;  3T1Y L;  1HR0 Q;  4DV5 Q;  3PUW A;  4NXM Q;  3NEM A;  5C44 H;  5IIF A;  1B1Z A;  1VQF A;  5EKI A;  1YHQ A;  1I5F A;  2EJM A;  1PH6 A;  1YBY A;  2TSS A;  3M3Y B;  1I6V C;  3HOX G;  1R9T B;  3PO2 H;  1SFO B;  1FNV A;  1A6X A;  4BBS B;  1E24 A;  2PZT A;  3K58 A;  1E22 A;  4GN5 A;  2NB0 A;  1D1I A;  3HZX A;  4IOA A;  3MAQ A;  1Z9F A;  3D4R A;  3OIQ A;  3VYT A;  2KCC A;  2DJG C;  3FVQ A;  1QCB D;  4GOP C;  4ZRZ A;  3G71 A;  3FKI H;  4JI2 L;  2B2U A;  4DV2 Q;  2NZH A;  2L1B A;  3PCO B;  4RGT A;  2NVY H;  3OPO A;  3VR3 A;  2ZJQ A;  3NTK A;  2YTV A;  4B3T L;  4LFC L;  3NTI A;  4BXX H;  3I56 A;  1Y1W B;  2L11 A;  3J81 c;  5IP7 G;  2B2V C;  1PV4 A;  1S40 A;  4ZLT F;  2E76 C;  2Z6K C;  3HKZ G;  3GTG H;  3P1H A;  4RCO A;  1OXV A;  5EKK A;  4JI7 Q;  1ENA A;  3EIV A;  1UE1 A;  2CWA A;  4C3J H;  2UUC L;  4CDD C;  2MFI A;  3MZ5 A;  1BQQ T;  2GVB A;  2NVQ B;  4XTC S;  5C3E H;  4HR7 B;  2AUK A;  3OHX C;  4LMQ D;  2A69 D;  3DM3 A;  4NDX A;  5COR A;  1AE3 A;  3KJP A;  2EPB A;  1Y8O B;  2ID0 A;  2F0S A;  2K5W A;  4PV1 C;  3OTO L;  1QUQ A;  5L37 A;  1UE7 A;  2DNE A;  2JK8 A;  3CPW A;  4BWG B;  3DM1 A;  5IGE A;  2EY6 A;  4LF8 L;  1H9K A;  3H3V I;  3KF8 B;  3HOU G;  2QKI C;  1CSQ A;  4IUT A;  1TWH H;  3GTK B;  2I5L X;  2JA6 B;  3J81 E;  2AWO A;  3J7Y W;  5GAE C;  4K6D A;  4LNQ A;  2MUY A;  1B70 B;  2B63 G;  4DR6 L;  1HZ9 A;  3GDE A;  2R93 G;  2OF1 A;  4NXM L;  4X64 L;  2B2U C;  3A74 A;  3HFZ B;  4QUF A;  4FF4 A;  3AFP A;  5KYL A;  3RLO A;  1PA6 A;  2VW9 A;  1PRT B;  2OXP A;  1L0Y B;  3EFX D;  4LFB Q;  1CTM A;  1LT4 D;  5CBA E;  1JWU D;  2D9U A;  2ZT9 C;  3L3O C;  3H09 A;  4DNI A;  1EZ6 A;  1QJO A;  1ML0 D;  2A73 B;  3NEN A;  3HP3 A;  4HJ9 A;  2R6G A;  2L12 A;  3HGB A;  2K75 A;  1WTQ A;  3DXJ C;  1VQ9 A;  5GAD C;  2NTT A;  4L8J A;  4XYO A;  1O80 A;  3NPP A;  2XWB B;  4IOC A;  3H94 A;  4AYB B;  1V1P B;  2VQE L;  3HOU B;  5I2Y A;  2PZW A;  1PRT D;  3BZD B;  3G48 A;  3KK7 A;  4IPC A;  4U68 A;  4KV6 A;  4P2C B;  2A68 D;  3GV6 A;  1E3P A;  1IXR A;  1GUT A;  2PI2 E;  1W6J A;  3H0G B;  5IYB G;  4IUQ A;  2VQE Q;  4KKS A;  3Q8D A;  2PW7 A;  1C4Q A;  4ID6 A;  5E7N A;  4JVZ A;  2L9H A;  4IUP A;  3NSW A;  3A5U A;  5IT9 E;  2C9O A;  3KOJ A;  4IAL A;  1PH3 A;  1M90 C;  1Y1V B;  5M5X B;  1X56 A;  1PRT F;  4X65 Q;  1Y1W G;  3HOW G;  1X32 A;  1NCV A;  2ZTE A;  5JVH 3;  2ZXP A;  4IZ8 A;  5FLX c;  3CCU A;  3TSS A;  2IT1 A;  2F0L A;  1Q86 C;  3CC7 A;  4AQY L;  4DV4 L;  5C3X A;  4OXP A;  2RSO A;  3CRK C;  4JV5 L;  4X65 L;  1U9R A;  2B2T A;  3X3N A;  2ES2 A;  3HKS A;  1DOL A;  3HOY G;  2NN6 H;  4I7Z C;  4H7B A;  4IFD G;  1JC7 A;  4AYB G;  4X64 Q;  1XX8 A;  2XIW A;  1LUZ A;  2OCE A;  4OO1 G;  1SE2 A;  2QEJ C;  1KQS A;  3J80 L;  1SNP A;  3ER0 A;  3T4A C;  5ELD A;  2A8V A;  3L7Z C;  4C3H B;  1RTO A;  4A3L H;  1V8Q A;  5CV9 A;  5J3B A;  2YU9 H;  1TWC B;  3TN2 A;  3A8I E;  1FL0 A;  4OON A;  5G3L F;  3SGI A;  4RG1 A;  1B2T A;  3A56 A;  2CW0 D;  1LAC A;  1TT2 A;  4BY1 H;  5T1G A;  3TQY A;  2JA8 B;  3R2I A;  5H1S E;  1XTC D;  2PW5 A;  4HSP A;  1EEF D;  3STB D;  1AN8 A;  4OIK A;  2R7D A;  3GTJ H;  3VR4 A;  1QVC A;  2EIF A;  3P20 A;  4UPA A;  1W3S A;  1EY4 A;  2K14 A;  4R4Q A;  1P8L A;  1STY A;  4ZUJ A;  5C3E B;  4IPG A;  4HMJ A;  1A2U A;  1PYW D;  4J15 A;  1SDF A;  4PG3 A;  1RF2 D;  1RKN A;  4LK1 C;  1IBK Q;  1Q90 A;  2F4V L;  2VB3 X;  1EU4 A;  2DY7 A;  2PQA A;  2JA7 B;  2K5Q A;  4B3R L;  2EYO A;  5GQO A;  2G9H D;  4X3S A;  2EVB A;  1QNU A;  2A6H D;  2LS0 1;  4X3U A;  1STG A;  1O7Y A;  3MXN B;  3GTK H;  5C3E G;  3E0J A;  1TWA B;  3GV3 A;  3ERS X;  2F3W A;  2R7Z B;  1G2T A;  1PFS A;  3KUP A;  3FDT A;  1T5E A;  4L6T B;  4C2M B;  5AJ3 Q;  1TY2 A;  2K5D A;  1TWC H;  2AQ3 B;  4KJO A;  2AUJ D;  1YNJ D;  2CH4 A;  2J0T D;  4A3M H;  4N9P A;  4N8F A;  3K7A B;  3OTO Q;  1CKO A;  3CCS A;  3RZD B;  3WDN A;  1LTA D;  1PH5 A;  3U9O A;  1UEB A;  1VQE A;  5CV4 A;  4C3I H;  1VQ6 A;  4POG A;  4DV7 L;  2O5J C;  1SNQ A;  4TQU S;  3J7A V;  1HNW Q;  3R3O A;  1STE A;  1B9N A;  2E2J H;  4R8I A;  1VMP A;  3PIO A;  4JI1 Q;  4A3C H;  2Y0S B;  1G6P A;  3BYT B;  3ICE A;  5DAU A;  1SEB D;  1IBM L;  1F9Q A;  5CYU A;  2NVX H;  1N32 L;  3NE5 B;  4HIK A;  3HEJ A;  4FDB A;  1YNX A;  2HDM A;  3K5O A;  1X54 A;  4GKJ L;  1EYC A;  4DV6 L;  4IUR A;  1LTT D;  1SAP A;  2ATW A;  3MXP A;  3HOZ H;  5EQ0 A;  1HXY D;  4FXG C;  3HOZ B;  3I4M G;  1EY9 A;  3PO2 G;  2Q8T A;  1Y1V H;  4RGM A;  1K3R A;  1E0B A;  2XSC A;  2XTI A;  2I46 A;  3C46 A;  3MXN A;  2WAQ E;  4EQP A;  1KD1 C;  4JI2 Q;  5C44 G;  2NVT B;  1JOK A;  4A3L G;  4O42 A;  1D8L A;  4ZQ3 A;  4R4I A;  3ZYY X;  3LWU A;  5CR3 A;  4CJ2 C;  1QIL A;  1I50 B;  4JI5 L;  2EY5 A;  2AQ2 B;  5C0X H;  2LFN A;  3BZC A;  3UDF A;  5C4Z A;  2DY8 A;  4ULL A;  1I50 H;  5C4X B;  1K0R A;  1WYD A;  1PTO D;  4X66 Q;  4X3T A;  1NBW A;  4PMB A;  1WD0 A;  2RBM A;  1KLG D;  3SEB A;  4K2K A;  3AYH B;  4HIM A;  2KQ3 A;  1I4P A;  4DV1 L;  1J6Q A;  3ULL A;  5ISR A;  5C44 B;  2XNA C;  4BBR H;  3J81 i;  4DAM A;  4I7A A;  1PYS B;  3T1Y Q;  4DAY B;  3H6M A;  4IUN A;  3HS0 C;  4IFD J;  1EY8 A;  2F0W A;  4KN4 C;  3SR1 A;  1HUM A;  5K36 G;  4JBK A;  3HOX H;  4ALP A;  4HCS A;  3TDQ A;  1S5B D;  4JV5 Q;  1F2M A;  4RWS C;  5I4D A;  4ZKB B;  5EAY A;  2RDF A;  3TZD A;  2JA5 H;  1VQB A;  4KHZ A;  5FLM G;  1JOO A;  3K5L A;  4GLX A;  2EZV A;  2IPK D;  2PPB C;  5C4J H;  1BBX C;  2EYL A;  4R4C A;  4AYB E;  3DUZ A;  4V19 0;  1LTS D;  3FHW A;  5IYB H;  4K14 A;  1MIU A;  3J7Z C;  2D2C C;  3K57 A;  3HOV B;  1XPR A;  3TZU A;  1CFM A;  1LTG D;  2E5L L;  1YZ6 A;  1SXT A;  1CQV A;  2IY5 B;  1VQL A;  1SMX A;  5IYD H;  4DF7 A;  3IFD A;  1K8O A;  2HDL A;  5IY0 A;  1HNX Q;  2EYH A;  4YCW A;  5IWA Q;  2JJQ A;  3KFU A;  4GOP B;  3CRL C;  4FF1 A;  1EWI A;  1GUG A;  2C5C A;  3S2D B;  1O7I A;  2BCO A;  1PDQ A;  5JVG 3;  2JEB I;  4JBM A;  1PVO A;  4JI5 Q;  3BVM A;  2RCF A;  4DV0 Q;  3RZO H;  2EJF C;  5M3F H;  5C6A A;  2KCN A;  3NHH A;  2HD3 A;  1K28 A;  4A3G B;  4DK0 A;  1VDZ A;  1SN8 A;  4KLK A;  2B8G A;  4N8X 1;  3RD4 A;  3VR5 A;  1QWY A;  5DM6 3;  4A3I H;  2E74 C;  1ASY A;  4QGU A;  1QUQ B;  4KHP Q;  1RDP D;  3K59 A;  4DV4 Q;  1C48 A;  3MTS A;  1JWM D;  3MFG A;  5I6Y A;  1TWG H;  2L5T A;  1B8A A;  3KF8 A;  1PZK D;  4P71 A;  5HY6 A;  2YTY A;  1KRS A;  1DCZ A;  5LMU L;  1RD9 D;  1AW7 A;  3HRZ C;  3I2Z A;  3AEV A;  2KBN A;  1A15 A;  4KY7 A;  3NP8 A;  4QL5 A;  1YJW A;  5FLX E;  1IBM Q;  1KRT A;  3RUZ A;  1SSO A;  4JI0 L;  4LUO A;  3KBG A;  4LFA Q;  2DUD A;  3PO3 H;  1XMQ Q;  1W2B A;  1X3G A;  5EPJ A;  1HQR D;  3L0O A;  3SK5 A;  4DXF A;  2LSS A;  2N88 A;  4E6I A;  1D5X C;  1ET6 A;  5JJZ A;  1IYV A;  3I4N B;  4X62 L;  1BDO A;  4LF4 Q;  1B50 A;  2BH8 A;  3O13 A;  2AKW B;  1OXX K;  2F3I A;  2OT2 A;  3K0Y A;  4KN7 C;  5IT9 L;  2E5L Q;  4TRD A;  4EX5 A;  5J22 A;  1X3Q A;  2H1E A;  4MTK A;  3J80 E;  1KDC A;  2N8N A;  2JQO A;  3VR6 A;  1G29 1;  1EZ8 A;  2F0K A;  1EQV A;  2MJ8 A;  3NBH A;  5C3W A;  1G6Z A;  3ITP A;  4B3M L;  4OO1 I;  3F2C A;  3R93 A;  3G4S A;  1TXY A;  2O5I C;  4J1M A;  4IUU A;  2L55 A;  3DEP A;  1BCP D;  3MC0 B;  3NBH B;  3S1M H;  2A1A A;  1BNZ A;  2WAQ B;  4DR2 Q;  1WTR A;  5KEE A;  1NNX A;  1KDB A;  3HOW B;  3E5S A;  4A75 A;  4OO1 H;  1IW7 C;  1YIT A;  3G6E A;  3DMU A;  2BA1 A;  3MEH A;  1KXL A;  4A93 B;  3HOY H;  1HH2 P;  4A4I A;  4JOI C;  4H44 C;  1ZYR C;  4BBR B;  4XQN A;  2AQ1 B;  1EFW A;  4QF4 A;  2ZJR A;  3T53 B;  1ICW A;  3A54 A;  2WV6 D;  4JI6 Q;  1DON A;  4A3I G;  2HQL A;  1UE5 A;  1LV9 A;  3JC6 6;  5ELC A;  4C3I B;  4DV3 Q;  1JQY D;  5A2Q E;  2O2L D;  4BBS H;  1PMR A;  1HUN A;  3K8A A;  4DR3 L;  4O2D A;  3Q22 A;  3W5O A;  4DAV A;  2F0I A;  1WCM H;  1FYC A;  2L4N A;  1BOS A;  3A5Z B;  3CF5 A;  4NMZ A;  2RA4 A;  1EY7 A;  3DLL A;  1PZJ D;  3J7A F;  1YVC A;  1EQR A;  3TS2 A;  4DXG A;  2KCT A;  2BDO A;  2EXZ A;  1K8A C;  2RSN A;  4B9W A;  2Q8R E;  3VDY A;  1X55 A;  5DNF A;  4DK3 C;  2QF7 A;  3W1B A;  1CA6 A;  4QQB X;  4Y7N H;  4UDU C;  4PZ8 A;  1PH2 A;  1VQP A;  1TS5 A;  1N33 Q;  3KJO A;  2V4D A;  1N32 Q;  4CHT B;  1GD7 A;  1MGS A;  4JK1 C;  3BJU A;  2Y0S G;  3RZO B;  1CZG A;  2WB1 E;  2R93 B;  2RHQ B;  3E0E A;  1NMF A;  4P73 A;  3LGJ A;  4DKA C;  4A3B G;  1NSN S;  2PNR C;  3MWY W;  4DV7 Q;  4A3E B;  5M5Y H;  1PTO F;  5HUR A;  2PQE A;  1HRJ A;  2M00 A;  1I94 Q;  3N52 A;  3GTP H;  3VYU A;  1LTB D;  3ULP A;  5CBE E;  1Y8P B;  4HSV A;  3GTJ B;  4JYA Q;  1OXS C;  3W2D A;  3GP7 A;  2K33 A;  2EYJ A;  4CKC A;  2OWO A;  4FXD A;  4K2L A;  3U9S A;  1EL0 A;  1ILP A;  1G91 A;  3IKJ A;  3CMA A;  3CAM A;  5IWA L;  1HNX L;  3RR5 A;  5BN4 A;  4LF7 L;  1FD7 D;  1SYB A;  1S5C D;  1TS2 A;  5C4H A;  4MZ9 A;  2K50 A;  4BS9 A;  1Q3L A;  1R4P B;  3PUV A;  4QIW B;  4YY3 Q;  1CK1 A;  2FJ2 A;  2R7F A;  5A2Q L;  4OWW B;  1EIH A;  3I4M H;  1FR3 A;  5JJI A;  4TVA B;  1N36 Q;  1XNR L;  2BA0 A;  1SLJ A;  4MIU A;  2XWJ B;  3CD6 A;  5LMU Q;  1EWH A;  1LYL A;  1QOH A;  2A68 C;  5FLM H;  3J81 j;  1PTO C;  1B7Y B;  1Q1E A;  1AZP A;  1PRT C;  5C5L A;  4C1N I;  1JWS D;  1BF4 A;  1UNS A;  1F9P A;  4WRD A;  1CA5 A;  1J9O A;  2UUA Q;  4OHJ A;  5A35 A;  1B9M A;  3CCV A;  2Q8I B;  1UAP A;  1CKM A;  2F0U A;  4A3I B;  2JA5 B;  2VS1 A;  4K8I A;  1HNZ Q;  4OL7 A;  2BDN A;  1SYD A;  3F8T A;  3J81 L;  2DN8 A;  1SNO A;  1TWF H;  4QJF A;  2F0F A;  5ELF A;  1QVF A;  3T13 A;  1DZ1 A;  5M3M B;  5IGB A;  2B39 A;  1BUV T;  3V05 A;  1PFB A;  4O0A A;  1SMY C;  1CZW A;  4KTA A;  4HCE A;  3MFY A;  3D0F A;  4X66 L;  2Z6B A;  4R8N A;  4GN3 B;  3NBI A;  1P16 A;  2HQE A;  1SE4 A;  4DN4 M;  4HED A;  1EYA A;  1VQA A;  1IHZ A;  4Y52 H;  4GS3 A;  2LXJ A;  4WJ4 A;  2Z1C A;  1CKN A;  3HOV G;  3W3A A;  4U67 3;  4BA1 I;  4KKU A;  1BXT A;  4G7O C;  1JCK B;  3SXH A;  3KDF B;  1SNM A;  2Z8L A;  2UUC Q;  1V9P A;  2ICI A;  3CHB D;  3I8Z A;  5EGT A;  3BDO A;  3X3M A;  1K9M C;  3BDC A;  3MXG A;  3M4Q A;  4HID A;  1AH9 A;  5EBC A;  1VQ5 A;  3H0G G;  3PV0 A;  4IN3 A;  1WI5 A;  4A3F G;  5IT9 c;  1VQH A;  5KGU A;  4BY7 G;  1KDA A;  3A7A B;  1WJJ A;  2A69 C;  3I4N G;  1MBY A;  1Y1V G;  1KL9 A;  4S3S A;  3FRP B;  1B3A A;  2KOL A;  5FKA C;  1Z47 A;  3GTL B;  2L15 A;  1Z6H A;  1FVI A;  4ZAI A;  4YY3 L;  3JAM c;  2HCC A;  4C56 C;  1ZEQ X;  1ILQ A;  3OWE B;  3SK6 A;  3I4M B;  1I3Q H;  1OXT A;  3B6Y A;  3EBE A;  2K01 A;  3U50 C;  3LX0 A;  4A3F B;  2F3V A;  2A5H A;  2ZXO A;  3GD7 A;  2D62 A;  5IYC G;  4DNT B;  1OTC A;  4DUY Q;  4JYA L;  1D5M C;  5D14 A;  2MPM A;  2PNH A;  1Q8K A;  3NTH A;  1G8Z D;  5KRU A;  2L0C A;  2N49 A;  4MHE A;  2X69 A;  3BG3 A;  1EQQ A;  4Z9C B;  3WOE A;  1DOK A;  2WII B;  1F2L A;  4I65 A;  2VZA A;  4A3E H;  2AWN A;  5AJ3 L;  1V43 A;  3MXU A;  4HIO A;  4BY1 G;  1STN A;  3SK8 A;  3GTP B;  1JR0 D;  1VQO A;  4DR4 Q;  1EOT A;  2NN6 G;  3I7F A;  2F0T A;  3D31 A;  2K52 A;  3STB C;  1EIG A;  2WAC A;  3JAM L;  5FK9 C;  3SVM A;  1N33 L;  3PUY A;  1Q81 C;  1PFN A;  1HTL D;  4JC0 A;  2RKS A;  2ZTD A;  2ZTC A;  4FVM A;  1VQG A;  4UY8 C;  2CW0 C;  1SYC A;  2VXW A;  5FOB B;  3AQQ A;  5JPN C;  5JJL A;  3CCE A;  5CC4 A;  4GKJ Q;  1E1T A;  3OMC A;  3T16 A;  3VA7 A;  1IBK L;  2MO1 A;  2EOT A;  1PZI D;  1QE6 A;  1TQO A;  2K5H A;  3CME A;  1WCM G;  3TP5 A;  1GKH A;  3PO3 G;  3M4O B;  1ZXT A;  4DR4 L;  4A3J H;  4JI1 L;  2F0D A;  5GAG C;  1STB A;  4DV2 L;  2R92 G;  2ZXR A;  2B63 B;  1WD1 A;  4FP5 D;  1CT1 D;  2PMZ B;  1S3O A;  4LUV A;  3S14 B;  5BR8 L;  1EWC A;  2JA8 H;  4XDX A;  4FNF A;  4B3S L;  1R4Q B;  3OWF A;  1HPC A;  1WTX A;  1B4O A;  4OEL B;  3K7A H;  1JOQ A;  2K1B A;  4K5V A;  2VNU D;  2K5V A;  3PGZ A;  3UDI A;  4MNO A;  3RLN A;  1XYI A;  3NWT A;  1XMQ L;  2B2V A;  3H15 A;  1EUJ A;  1RL2 A;  2CQO A;  1SJH D;  4NKL A;  3L9A X;  3DWP A;  3CW2 C;  2HIX A;  2IHF A;  2G9D A;  2B29 A;  4JI7 L;  3R2T A;  1JE4 A;  3A0J A;  3UI2 A;  1TU2 B;  1BCP F;  1VQK A;  1K83 H;  3M4Y A;  5IOD A;  2JXM B;  4UP7 A;  1VQ4 A;  1N34 Q;  2JA7 H;  2LXK A;  1WTH A;  3I90 A;  4HJA A;  2AMC B;  4AQY Q;  5JEA J;  2Y0S E;  2I0Q A;  3GTM B;  4OGQ C;  4WJ3 M;  5IP9 G;  2SDF A;  4QY7 A;  1STH A;  4IFD H;  4GOP A;  1YEZ A;  3E6Z X;  1VQC A;  2NYZ D;  2KEN A;  1IL8 A;  3I4O A;  2QGQ A;  5IOC A;  3TRZ A;  5M5W H;  3I73 A;  5FJ8 G;  5ELO A;  3Q0A A;  3TME A;  1NMG A;  3BZK A;  2JA8 G;  5JAV A;  1GHK A;  1X3P A;  4BA2 I;  4EVO A;  4DV0 L;  4ME3 A;  4G7Z C;  4KD4 A;  4NW2 A;  1PH4 A;  4XT3 B;  2I5M X;  1Y8N B;  1CM9 A;  3MVV A;  1M8A A;  2O4X A;  1CSP A;  3I72 A;  5IYC H;  1U4R A;  3PIO 3;  3D6C A;  3NWS A;  1CHQ D;  2IW3 A;  1G51 A;  5LL6 X;  4LUZ A;  5IP7 H;  5E3F A;  3PIP 3;  1U4M A;  1K8G A;  3OSO A;  4IO9 A;  1YNN C;  1KLU D;  1GVP A;  3IL8 A;  4DV5 L;  2QDL A;  4DUZ L;  3LWE A;  3HOY B;  5EJW A;  1AP0 A;  1DD2 A;  1WTW A;  2R7Z H;  2IHE A;  3M4O H;  4F88 A;  1VS0 A;  5EPL A;  2UXC Q;  1W6K A;  3V96 A;  4A3K G;  3S17 H;  4H13 C;  3FKI G;  1X3E A;  1LT6 D;  2IWH A;  4DR5 Q;  1A3V A;  2UUB L;  1TS3 A;  3HOX B;  4RFB A;  2SNS A;  1K8M A;  3M4P A;  4DUZ Q;  1JMC A;  3NUC A;  3EJI A;  4YCV A;  3M9B A;  1EQT A;  5FO8 B;  3CCL A;  4DV1 Q;  3GTQ B;  1VF7 A;  5JOB A;  1AE2 A;  2XRS D;  1SND A;  3GO5 A;  3EA6 A;  1XNQ L;  1Z7T A;  4APV A;  2CQA A;  1H9R A;  1VQI A;  5GAH C;  3H3V H;  5I2X A;  1GXD C;  1S5D D;  3EQL C;  2FMC A;  5T1I A;  4KY5 A;  1XPU A;  3Q6S A;  4LAA A;  2JA6 H; 
#chains in the Genus database with same CATH homology
 1E2W A;  2FIN B;  2K28 A;  1HFG A;  5IGD A;  1KAA A;  5BN5 A;  1PXU A;  4DA2 A;  3PO3 B;  3QIA A;  1ZKO A;  4PNY A;  3G6J B;  4O1N A;  1UEA B;  4PQX A;  4ME5 A;  2BE5 C;  3LNN A;  1BCP B;  5FO9 B;  2K03 A;  4KHV A;  1Y69 U;  3FPU B;  4RHR A;  5FO7 B;  2E2J B;  3QWN A;  1WTV A;  2JP1 A;  2F0E A;  1OXU A;  2E2I B;  3ERQ A;  3QJY A;  1V1P A;  1WCM B;  2QCP X;  4KMU C;  1IKM A;  3I91 A;  2PYK A;  3S1Q B;  1V1O A;  3ONA B;  4Q0F A;  3BDL A;  1XWE A;  4C3I G;  2E2H B;  1WVL A;  2YU9 B;  1D5Z C;  3P7J A;  3AU7 A;  2F0V A;  3OW7 A;  4CBV A;  1F2Y A;  5KIX A;  1LTI D;  5C0X I;  3S2H B;  2SEB D;  4K5X A;  4QB4 A;  3IFT A;  1QG7 A;  1F77 A;  5E4X A;  4MN3 A;  3R8B A;  2JYO A;  5ELE A;  3PO2 B;  3P75 A;  2RVL A;  2F0G A;  1TR5 A;  3ERO A;  1YNJ C;  5CMD A;  3S1M B;  1M4V A;  5G3L D;  5M9O A;  1NR2 A;  1DJR D;  5IGF A;  2WP8 J;  5KNC A;  1FGB D;  3QO2 A;  2NUC A;  1KNA A;  5CGK A;  5HGT A;  3PUX A;  4DGZ A;  2EY2 A;  3V2T A;  3NXW A;  5LL6 S;  1DM0 B;  1O78 A;  1I4X A;  3MA2 B;  4C3H G;  1B44 D;  2KA7 A;  3TP8 A;  2SOB A;  2X6G A;  2B2W A;  2EYF A;  3S1N B;  2Z4I A;  3N6R A;  4LJZ C;  1MSH A;  3K6O A;  2IX1 A;  2F1M A;  3C1E A;  4KK7 A;  2B2Y A;  4B9X A;  1ESR A;  1D1K A;  1UUP A;  3RLF A;  2K7V A;  2M9V A;  3DWQ A;  1CQF A;  4F7X A;  2MP1 A;  4K8J A;  3TP6 A;  2K6A A;  2R61 A;  1K83 B;  1GUW A;  2K32 A;  2F0J A;  5J1Z A;  1ET9 A;  2E2D C;  3G7L A;  2KEC A;  5EBD A;  2FHT A;  4DK1 A;  4CJ0 B;  2R92 B;  4N9T A;  5I9O A;  3OMG A;  3NQT A;  2OEO A;  5M3F B;  3GTO B;  5NUC A;  3D4D A;  1EFI D;  2NBF A;  1I4Q A;  1LT3 D;  3K5N A;  1F9R A;  4RH6 A;  3SHL A;  2JEA I;  1AEX A;  4J8Q A;  2EDG A;  3KLS A;  4ZK9 B;  2J7Z A;  4XXE A;  1SBB B;  1I3Q B;  1H9S B;  2RQX A;  4A3J B;  3QOL A;  3Q23 A;  2FFK B;  5AFW A;  1RJT A;  3S17 B;  1D2B A;  2NN6 I;  4X3K A;  3JAM E;  2WB1 B;  4FF3 A;  5BN3 A;  2F0P A;  4Y7N B;  1ONL A;  3I3C A;  2F0M A;  3SK4 A;  1GOZ A;  1SMY D;  3SDZ A;  4FO2 A;  3TBI B;  4IQZ A;  2WKC A;  4C3J G;  4H0L C;  3NK9 A;  1EY5 A;  1G2S A;  2F03 A;  3FKI B;  4A3K B;  1KTK A;  2BE5 D;  2PCF B;  3NQI A;  4DNR B;  4C1N K;  1S5F D;  1U4L A;  5D3D A;  4DAP A;  3A55 A;  4YIJ A;  1SE3 A;  2WKD A;  4A3D B;  5E4W C;  4EQN A;  4DFA A;  5K36 H;  4TKO B;  4RAU C;  1LAB A;  2I07 B;  1GUO A;  2R3Z A;  2TMP A;  3AB9 A;  2F4I A;  1HQM C;  4BY7 B;  1MI2 A;  5C4J B;  1BR9 A;  4XQQ A;  5KNB A;  1LTR D;  2LMC B;  1SYG A;  2Z4H A;  3QB3 A;  5CV8 A;  3T56 B;  4B08 A;  2A74 C;  3MHB A;  1O7L A;  4XYQ A;  3S16 B;  4UAI A;  3CU7 A;  2J4X A;  5J39 A;  2E75 C;  1MD2 D;  3D4W A;  3PUZ A;  1SYF A;  2NTS A;  4ILW A;  1AZQ A;  2KVM A;  4KI0 A;  4FXK C;  4GZY C;  5C0X G;  3Q24 A;  1E2Z A;  1SNC A;  2FMM A;  1IKL A;  4ABN A;  2EJG C;  1GJX A;  5M5W B;  1VMC A;  5FLX L;  5JEA G;  1J8I A;  1I6H B;  4ODG A;  4ZYS A;  1ENF A;  4DAY A;  4ZUI A;  1A3U A;  2PZU A;  1EY0 A;  4WFN 3;  3IAY A;  3A8K E;  3EVQ A;  3VYR A;  3PMF A;  2KJX A;  3KBX A;  1TY0 A;  5CV5 A;  2KHS A;  2QIL A;  4IUV A;  5D3I B;  1ESF A;  1A2T A;  2HUG A;  2CVR A;  1F9S A;  4K5W A;  4QMG A;  2MHV A;  2NVY B;  1S4Z A;  4CKE A;  4K6L A;  3DHQ A;  3WOF A;  3TP7 A;  5IGG A;  3RMH A;  1ENC A;  2EY1 A;  2BOS A;  2CHB D;  1LO5 D;  4J6H A;  1PLF A;  1Q8I A;  1LT5 D;  4F87 A;  5I9P A;  1A3T A;  2KEE A;  1Q1B A;  5D65 A;  1JOR A;  4WJW A;  1VCI A;  1QB5 D;  4IFD I;  1H9J A;  5I6W A;  1MSG A;  5LHY 1;  4CJ1 B;  3S1R B;  3S9W A;  5C0X J;  5E1F A;  3H3V C;  1AFP A;  2D5D A;  1HA6 A;  2XN9 C;  2A6E D;  1L0X B;  3F2U A;  3HKZ B;  4RKB A;  3FMC A;  3M7G A;  4OIJ A;  4WOR A;  1PTO H;  2F0N A;  5TSS A;  4FYD A;  2K05 A;  2VB2 X;  2QDB A;  1EU3 A;  3I70 A;  4C3J B;  3GQB A;  4QCL A;  3C3L A;  2NZ1 D;  2B2T C;  3ND9 A;  1EYD A;  5CV7 A;  1T5X D;  2LY7 A;  2M2L A;  2K04 A;  2IJ0 A;  1KNE A;  4PMW A;  1IYU A;  2ICE C;  2EE1 A;  2YYZ A;  5KYI A;  1I4G A;  3D6W A;  4V0B A;  4EGV A;  5C5M A;  2IX3 A;  1TVX A;  1TKW B;  3KLR A;  2JE6 I;  4RCN A;  2H4O A;  1DOM A;  3A8J E;  4XQJ A;  1E2V A;  2IX0 A;  5K5P A;  1NR4 A;  4G57 A;  3S15 B;  4G4K A;  1PFM A;  3URY A;  2F0H A;  4KJN A;  4FF2 A;  1SYE A;  3OOC A;  1OO9 B;  1TII D;  5DEH A;  1FNU A;  2JSO A;  1DYQ A;  2HCI A;  1RTN A;  3A7L A;  3K5M A;  2B2W C;  1TWG B;  2SNM A;  1SJE D;  1KAB A;  4XT1 B;  1S5E D;  5F2D A;  1I4R A;  2B8F A;  4PMC A;  1II3 A;  5ELB A;  2GA4 B;  1EY6 A;  1HHV A;  3C2P A;  5DM7 3;  4CKB A;  2XRQ D;  2EYP A;  1DXM A;  3OIP A;  1O7Z A;  3DEO A;  1BO0 A;  4M8A A;  1Q12 A;  2KED A;  3C1F A;  3QG1 A;  4HAE A;  5CV6 A;  1NUC A;  4RKL A;  2NWG A;  4F8M A;  2X6L A;  1WTO A;  1C8C A;  4M1U B;  4RHS A;  1I4H A;  4XIG S;  1QNK A;  2PO4 A;  3M85 A;  2N55 A;  3FPP A;  4L63 B;  2MGS A;  3BVZ A;  3D8G A;  3H91 A;  3VR2 A;  1F2Z A;  5KND A;  1HA5 A;  2A6H C;  1STA A;  4RA8 A;  4ZKC B;  1TWH B;  4CGY B;  4HN7 A;  4DU9 A;  4QUC A;  3SE0 A;  5COY A;  1LLR D;  2F0O A;  1JIC A;  4KKT A;  1JB3 A;  3I4L A;  3ND8 A;  1YNN D;  1RCV D;  4A3B B;  1TWF B;  2ENB A;  4NP5 A;  3GTG B;  2DNC A;  1FNW A;  3DWA A;  1VF5 C;  2F0Q A;  1B53 A;  2VUM B;  4G7H C;  4Q5V A;  3QOJ A;  2NVX B;  1ZYR D;  3BVG A;  2EYM A;  4TSS A;  3AMU A;  1EEI D;  3BS1 A;  3VYS A;  1GUN A;  3T51 B;  1WTP A;  5IGC A;  2KUM A;  1CI3 M;  3KLS X;  1IW7 D;  1GUS A;  3CKI B;  1HCZ A;  5EPK A;  1GHJ A;  1HFN A;  2A6E C;  1D6E C;  4RGO S;  5EKL A;  2B2Y C;  1ROD A;  1H9S A;  4BY1 B;  4HMI A;  1BCP C;  4A3M B;  1H9M A;  2IL8 A;  3FEW X;  1PTO B;  2RDH A;  1TS4 A;  3CQZ B;  4KD3 A;  4RGN A;  3VA5 A;  1U4P A;  1NAP A;  4HTH A;  2RDG A;  3M7N A;  4JBW A;  1RHP A;  5M5Y B;  5JEA H;  1CHP D;  3D3R A;  3BYY B;  1HTP A;  4R9W A;  4EQO A;  2LKV A;  3HG9 A;  2XVS A;  2WIN B;  4KY6 A;  1XXG A;  5JPM C;  3PUW A;  5IIF A;  1B1Z A;  5EKI A;  2EJM A;  2TSS A;  3M3Y B;  1I6V C;  1R9T B;  1SFO B;  1FNV A;  1A6X A;  4BBS B;  2PZT A;  3K58 A;  2NB0 A;  1D1I A;  3HZX A;  3MAQ A;  3D4R A;  3OIQ A;  3VYT A;  2KCC A;  3FVQ A;  1QCB D;  4ZRZ A;  2B2U A;  2L1B A;  4RGT A;  3VR3 A;  3OPO A;  3NTK A;  3NTI A;  1Y1W B;  2L11 A;  2B2V C;  4ZLT F;  2E76 C;  3P1H A;  4RCO A;  1OXV A;  5EKK A;  1ENA A;  3MZ5 A;  1BQQ T;  2NVQ B;  4XTC S;  4HR7 B;  2AUK A;  3OHX C;  4LMQ D;  2A69 D;  4NDX A;  5COR A;  2EPB A;  1Y8O B;  2ID0 A;  4PV1 C;  2F0S A;  2K5W A;  2DNE A;  4BWG B;  3DM1 A;  5IGE A;  2EY6 A;  1H9K A;  2QKI C;  4IUT A;  3GTK B;  2JA6 B;  3J81 E;  2AWO A;  3J7Y W;  4K6D A;  2MUY A;  2OF1 A;  2B2U C;  4QUF A;  4FF4 A;  5KYL A;  1PRT B;  2OXP A;  1L0Y B;  3EFX D;  1CTM A;  1LT4 D;  5CBA E;  1JWU D;  2D9U A;  2ZT9 C;  3L3O C;  3H09 A;  1EZ6 A;  1QJO A;  1ML0 D;  2A73 B;  3HP3 A;  2R6G A;  2L12 A;  3HGB A;  1WTQ A;  3DXJ C;  2NTT A;  4L8J A;  4XYO A;  1O80 A;  3NPP A;  2XWB B;  3H94 A;  4AYB B;  1V1P B;  3HOU B;  5I2Y A;  2PZW A;  1PRT D;  3BZD B;  3KK7 A;  4U68 A;  4KV6 A;  4P2C B;  2A68 D;  3GV6 A;  1GUT A;  1W6J A;  3H0G B;  4IUQ A;  4KKS A;  2PW7 A;  1C4Q A;  4ID6 A;  2L9H A;  4IUP A;  3NSW A;  5IT9 E;  2C9O A;  4IAL A;  1Y1V B;  5M5X B;  1PRT F;  1X32 A;  1NCV A;  5JVH 3;  2ZXP A;  4IZ8 A;  3TSS A;  2IT1 A;  2F0L A;  5C3X A;  2RSO A;  3CRK C;  1U9R A;  2B2T A;  3X3N A;  1DOL A;  2NN6 H;  4I7Z C;  4H7B A;  4IFD G;  1JC7 A;  1XX8 A;  2XIW A;  4OO1 G;  1SE2 A;  2QEJ C;  3J80 L;  1SNP A;  3T4A C;  5ELD A;  3L7Z C;  4C3H B;  1RTO A;  1V8Q A;  5CV9 A;  1TWC B;  3TN2 A;  3A8I E;  5G3L F;  1B2T A;  2CW0 D;  3A56 A;  1LAC A;  1TT2 A;  5T1G A;  2JA8 B;  3R2I A;  1XTC D;  2PW5 A;  4HSP A;  1EEF D;  1AN8 A;  4OIK A;  3VR4 A;  3P20 A;  1EY4 A;  1STY A;  4ZUJ A;  5C3E B;  4HMJ A;  1A2U A;  1PYW D;  1SDF A;  1RF2 D;  1RKN A;  4LK1 C;  1Q90 A;  2VB3 X;  1EU4 A;  2DY7 A;  2JA7 B;  2K5Q A;  2EYO A;  2G9H D;  4X3S A;  2EVB A;  1QNU A;  2A6H D;  2LS0 1;  4X3U A;  1STG A;  1O7Y A;  3E0J A;  1TWA B;  3GV3 A;  2F3W A;  2R7Z B;  1G2T A;  3KUP A;  3FDT A;  1T5E A;  4L6T B;  4C2M B;  1TY2 A;  2K5D A;  2AQ3 B;  4KJO A;  2AUJ D;  1YNJ D;  2J0T D;  4N9P A;  3K7A B;  3RZD B;  3WDN A;  1LTA D;  3U9O A;  5CV4 A;  2O5J C;  1SNQ A;  4TQU S;  3J7A V;  3R3O A;  1STE A;  1B9N A;  4R8I A;  1VMP A;  2Y0S B;  3BYT B;  5DAU A;  1SEB D;  1F9Q A;  5CYU A;  3NE5 B;  3HEJ A;  2HDM A;  3K5O A;  1EYC A;  4IUR A;  1LTT D;  1SAP A;  3MXP A;  5EQ0 A;  1HXY D;  4FXG C;  3HOZ B;  1EY9 A;  2Q8T A;  4RGM A;  1E0B A;  2XSC A;  2I46 A;  3C46 A;  3MXN A;  4EQP A;  2NVT B;  1JOK A;  4O42 A;  4ZQ3 A;  3ZYY X;  3LWU A;  5CR3 A;  4CJ2 C;  1QIL A;  1I50 B;  2EY5 A;  2AQ2 B;  5C0X H;  2LFN A;  5C4Z A;  2DY8 A;  4ULL A;  5C4X B;  1PTO D;  4X3T A;  4PMB A;  1WD0 A;  2RBM A;  1KLG D;  3SEB A;  4K2K A;  2KQ3 A;  1I4P A;  5ISR A;  5C44 B;  2XNA C;  3H6M A;  4IUN A;  3HS0 C;  4IFD J;  1EY8 A;  2F0W A;  4KN4 C;  3SR1 A;  1HUM A;  5K36 G;  4HCS A;  3TDQ A;  1S5B D;  1F2M A;  4RWS C;  5I4D A;  4ZKB B;  2RDF A;  3TZD A;  4KHZ A;  1JOO A;  3K5L A;  2EZV A;  2IPK D;  2PPB C;  1BBX C;  2EYL A;  3DUZ A;  4V19 0;  1LTS D;  4K14 A;  2D2C C;  3HOV B;  3K57 A;  3TZU A;  1CFM A;  1LTG D;  1SXT A;  1CQV A;  4DF7 A;  3IFD A;  1K8O A;  2HDL A;  2EYH A;  3CRL C;  4FF1 A;  1GUG A;  2C5C A;  3S2D B;  2BCO A;  1PDQ A;  5JVG 3;  2JEB I;  3BVM A;  2EJF C;  5C6A A;  2KCN A;  3NHH A;  4A3G B;  4DK0 A;  1VDZ A;  2B8G A;  3RD4 A;  3VR5 A;  1QWY A;  5DM6 3;  2E74 C;  1RDP D;  3K59 A;  1C48 A;  3MTS A;  1JWM D;  3MFG A;  5I6Y A;  2L5T A;  3KF8 A;  1PZK D;  1DCZ A;  1RD9 D;  1AW7 A;  3HRZ C;  1A15 A;  4KY7 A;  3NP8 A;  5FLX E;  3RUZ A;  1SSO A;  3KBG A;  5EPJ A;  1HQR D;  3SK5 A;  4DXF A;  2N88 A;  4E6I A;  1D5X C;  1ET6 A;  5JJZ A;  1IYV A;  3I4N B;  1BDO A;  1B50 A;  3O13 A;  1OXX K;  2OT2 A;  3K0Y A;  4KN7 C;  5IT9 L;  4TRD A;  5J22 A;  1X3Q A;  2H1E A;  3J80 E;  1KDC A;  3VR6 A;  1G29 1;  1EZ8 A;  2F0K A;  1EQV A;  2MJ8 A;  3NBH A;  5C3W A;  1G6Z A;  3ITP A;  4OO1 I;  3R93 A;  2O5I C;  4J1M A;  4IUU A;  2L55 A;  1BCP D;  3DEP A;  3MC0 B;  1BNZ A;  2WAQ B;  1WTR A;  5KEE A;  1KDB A;  3HOW B;  3E5S A;  4OO1 H;  1IW7 C;  3DMU A;  2BA1 A;  3MEH A;  4A93 B;  4H44 C;  1ZYR C;  4BBR B;  4XQN A;  2AQ1 B;  4QF4 A;  3T53 B;  1ICW A;  3A54 A;  2WV6 D;  1DON A;  1LV9 A;  5ELC A;  4C3I B;  1JQY D;  5A2Q E;  2O2L D;  1PMR A;  1HUN A;  3Q22 A;  4DAV A;  2F0I A;  1FYC A;  2L4N A;  1BOS A;  4NMZ A;  2RA4 A;  1EY7 A;  1PZJ D;  3J7A F;  4DXG A;  2BDO A;  2EXZ A;  2RSN A;  4B9W A;  2Q8R E;  5DNF A;  2QF7 A;  1CA6 A;  4UDU C;  1TS5 A;  2V4D A;  4CHT B;  1MGS A;  4JK1 C;  3RZO B;  1CZG A;  2R93 B;  1NSN S;  2PNR C;  3MWY W;  4A3E B;  1PTO F;  5HUR A;  2PQE A;  1HRJ A;  2M00 A;  3N52 A;  3VYU A;  1LTB D;  5CBE E;  1Y8P B;  4HSV A;  3GTJ B;  1OXS C;  3W2D A;  3GP7 A;  2K33 A;  2EYJ A;  4CKC A;  4FXD A;  4K2L A;  3U9S A;  1EL0 A;  1ILP A;  1G91 A;  3IKJ A;  5BN4 A;  1SYB A;  1FD7 D;  1S5C D;  1TS2 A;  5C4H A;  4BS9 A;  1Q3L A;  1R4P B;  3PUV A;  4QIW B;  1CK1 A;  2FJ2 A;  1EIH A;  5A2Q L;  1FR3 A;  2BA0 A;  4MIU A;  2XWJ B;  1EWH A;  1QOH A;  2A68 C;  1PTO C;  1Q1E A;  1AZP A;  1PRT C;  5C5L A;  4C1N I;  1JWS D;  1BF4 A;  1UNS A;  1F9P A;  4WRD A;  1CA5 A;  1J9O A;  4OHJ A;  5A35 A;  1B9M A;  2Q8I B;  1UAP A;  2F0U A;  4A3I B;  2JA5 B;  4K8I A;  2BDN A;  4OL7 A;  1SYD A;  3J81 L;  2DN8 A;  1SNO A;  2F0F A;  5ELF A;  3T13 A;  1DZ1 A;  5M3M B;  5IGB A;  2B39 A;  1BUV T;  3V05 A;  1PFB A;  1SMY C;  1CZW A;  4KTA A;  4HCE A;  3MFY A;  4R8N A;  3NBI A;  2HQE A;  1SE4 A;  4DN4 M;  4HED A;  1EYA A;  1IHZ A;  2Z1C A;  3W3A A;  4U67 3;  4BA1 I;  4KKU A;  1BXT A;  4G7O C;  1JCK B;  3SXH A;  1SNM A;  2Z8L A;  3I8Z A;  2ICI A;  3CHB D;  5EGT A;  3BDO A;  3X3M A;  3BDC A;  3MXG A;  5EBC A;  3PV0 A;  4IN3 A;  5KGU A;  1KDA A;  3A7A B;  2A69 C;  1MBY A;  4S3S A;  3FRP B;  1B3A A;  2KOL A;  5FKA C;  1Z47 A;  3GTL B;  1Z6H A;  4ZAI A;  2HCC A;  4C56 C;  1ZEQ X;  1ILQ A;  3OWE B;  3SK6 A;  3I4M B;  1OXT A;  2K01 A;  3LX0 A;  4A3F B;  2F3V A;  2A5H A;  2ZXO A;  3GD7 A;  2D62 A;  4DNT B;  1D5M C;  5D14 A;  2MPM A;  3NTH A;  1G8Z D;  5KRU A;  2L0C A;  4MHE A;  2X69 A;  3BG3 A;  4Z9C B;  3WOE A;  1DOK A;  2WII B;  1F2L A;  4I65 A;  2AWN A;  1V43 A;  3MXU A;  1STN A;  3SK8 A;  3GTP B;  1JR0 D;  1EOT A;  2NN6 G;  2F0T A;  3D31 A;  1EIG A;  2WAC A;  3JAM L;  5FK9 C;  3SVM A;  3PUY A;  1PFN A;  1HTL D;  2RKS A;  4FVM A;  2CW0 C;  1SYC A;  2VXW A;  5FOB B;  5JPN C;  5CC4 A;  3OMC A;  3T16 A;  3VA7 A;  2EOT A;  1PZI D;  1QE6 A;  1TQO A;  3TP5 A;  3M4O B;  1ZXT A;  2F0D A;  1STB A;  2ZXR A;  2B63 B;  1WD1 A;  4FP5 D;  1CT1 D;  2PMZ B;  3S14 B;  1EWC A;  4XDX A;  4FNF A;  1R4Q B;  3OWF A;  1HPC A;  1WTX A;  1B4O A;  1JOQ A;  2K1B A;  4K5V A;  2VNU D;  1XYI A;  3NWT A;  2B2V A;  1SJH D;  4NKL A;  3L9A X;  3DWP A;  2G9D A;  3R2T A;  1JE4 A;  3UI2 A;  1TU2 B;  1BCP F;  3M4Y A;  5IOD A;  2JXM B;  3I90 A;  5JEA J;  3GTM B;  4OGQ C;  2SDF A;  1STH A;  4IFD H;  3E6Z X;  2NYZ D;  1IL8 A;  5IOC A;  3I73 A;  3Q0A A;  3TME A;  5JAV A;  1GHK A;  1X3P A;  4BA2 I;  4EVO A;  4G7Z C;  4KD4 A;  4NW2 A;  4XT3 B;  1Y8N B;  1CM9 A;  3MVV A;  1M8A A;  2O4X A;  3I72 A;  1U4R A;  3PIO 3;  3D6C A;  3NWS A;  1CHQ D;  2IW3 A;  5LL6 X;  5E3F A;  3PIP 3;  1U4M A;  3OSO A;  1YNN C;  1KLU D;  3IL8 A;  3LWE A;  3HOY B;  5EJW A;  1AP0 A;  1DD2 A;  1WTW A;  4F88 A;  5EPL A;  1W6K A;  3V96 A;  4H13 C;  1LT6 D;  2IWH A;  1A3V A;  1TS3 A;  3HOX B;  4RFB A;  2SNS A;  1K8M A;  3NUC A;  3EJI A;  1EQT A;  5FO8 B;  3GTQ B;  1VF7 A;  5JOB A;  2XRS D;  1SND A;  3GO5 A;  3EA6 A;  1Z7T A;  2CQA A;  1H9R A;  5I2X A;  1GXD C;  1S5D D;  2FMC A;  3EQL C;  5T1I A;  4KY5 A;  3Q6S A;  4LAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...