4EVVA

Mouse mbd4 glycosylase domain in complex with a g:t mismatch
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
145
structure length
145
Chain Sequence
MKWTPPRSPFNLVQEILFHDPWKLLIATIFLNRTSGKMAIPVLWEFLEKYPSAEVARAADWRDVSELLKPLGLYDLRAKTIIKFSDEYLTKQWRYPIELHGIGKYGNDSYRIFCVNEWKQVHPENHKLNKYHDWLWENHEKLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Methyl-CpG-binding domain protein 4
publication title Excision of thymine and 5-hydroxymethyluracil by the MBD4 DNA glycosylase domain: structural basis and implications for active DNA demethylation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/dna
total genus 41
structure length 145
sequence length 145
ec nomenclature ec 3.2.2.-:
pdb deposition date 2012-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4evvA00
3KTUA 4B23A 1YQKA 1XQPA 1LWVA 1PU8A 2NOFA 2XHIA 1NGNA 4E9HA 3CW7A 1LWYA 4AI4A 1YQMA 2JHJA 3OH6A 2I5WA 4PIIA 1N3AA 5DPKA 1YQRA 1LMZA 1N3CA 1NKUA 1KG3A 4EVVA 2NOHA 2H56A 4EJZA 5AN4A 3FHFA 1YQLA 4EA5A 3G0QA 1P59A 4E9EA 1KG5A 1WEFA 4YPRA 1M3HA 4YPHA 1KG6A 1PU7A 4B24A 1ORNA 4E9GA 1WEGA 2NOIA 4YOQA 1PVSA 3I0WA 2ABKA 1LWWA 3IH7A 4EW0A 4E9FA 3I0XA 1KG2A 3FHGA 1VRLA 2NOBA 1FN7A 2OFIA 1EBMA 1MPGA 3IHOA 1ORPA 1MUDA 4AI5A 3N0UA 3FSPA 1KQJA 2YG9A 1WEIA 1KG7A 4AIAA 2NOZA 3S6IA 3CWAA 2JHNA 1M3QA 1DIZA 1KG4A 3CWSA 4UNFA 1KEAA 4EJYA 4OFEA 4HSBA 4DK9A 5CHZA 1P7MA 2JG6A 4B22A 2OFKA 4UOBA 1RRQA 1XQOA 3OGDA 3CVTA 3D4VA 1RRSA 3KNTA 1N39A 2NOLA 4OFHA 3CVSA 4B21A 3N5NX 1XG7A 3CWTA 3F0ZA 3OH9A 1KO9A 1PU6A 1MUNA 4EW4A 4OFAA 3F10A 2YG8A 1HU0A 1MUYA 5KN8A 3CWUA 5KN9A 4EA4A 2NOEA
chains in the Genus database with same CATH superfamily
3OYGA 3KTUA 4BDYA 4ZTFA 4B23A 1YQKA 1XQPA 1LWVA 1PU8A 4BACA 2NOFA 3R2XC 2XHIA 1NGNA 4E9HA 3CW7A 1LWYA 3L2RA 4AI4A 1YQMA 2JHJA 3OH6A 2I5WA 3OYDA 2W03A 4PIIA 1N3AA 5DPKA 4BDZA 1YQRA 1LMZA 1N3CA 1NKUA 1KG3A 4EVVA 2NOHA 4E7JA 3S3NA 4BE2A 2H56A 3L2WA 4EJZA 5AN4A 3FHFA 1YQLA 4EA5A 3L2QA 3G0QA 1P59A 4E7KA 4E9EA 1KG5A 2V75A 1WEFA 4NZGA 4YPRA 3OYMA 1M3HA 4YPHA 1KG6A 1PU7A 4B24A 3OS1A 1ORNA 4E9GA 1WEGA 2NOIA 4BE0A 4YOQA 1PVSA 3I0WA 2ABKA 3L2VA 3OYAA 4IKFA 4E7IA 1LWWA 3IH7A 4EW0A 4E9FA 3I0XA 1KG2A 3FHGA 3VW4A 1VRLA 2NOBA 1FN7A 2OFIA 1EBMA 1MPGA 2JPSA 4ZTJA 3IHOA 1ORPA 1MUDA 3OYLA 4AI5A 3OYJA 3N0UA 3FSPA 1KQJA 2YG9A 1WEIA 3OYFA 1KG7A 4AIAA 2NOZA 3S6IA 3CWAA 2JHNA 4BE1A 1M3QA 5FROA 1DIZA 1KG4A 4E7HA 3CWSA 4UNFA 1KEAA 4EJYA 3OYCA 3OYBA 5FRMA 4OFEA 3OYKA 4HSBA 4DK9A 3NNQA 5CHZA 2W04A 1P7MA 1U84A 2JG6A 2OFKA 4B22A 4UOBA 1RRQA 3L2UA 1XQOA 3OGDA 3CVTA 3D4VA 1RRSA 3OYIA 3KNTA 1N39A 3S3OA 3OS0A 2NOLA 5FRNA 3OYHA 4OFHA 3CVSA 3LCNA 3OYEA 4E7LA 4B21A 3N5NX 1XG7A 3CWTA 3F0ZA 3OH9A 3OYNA 1KO9A 1PU6A 1MUNA 4EW4A 3OY9A 3OS2A 4OFAA 3F10A 2YG8A 1HU0A 1MUYA 5KN8A 3CWUA 5KN9A 4EA4A 3S3MA 2NOEA
chains in the Genus database with same CATH topology
3KTUA 4B23A 1YQKA 1XQPA 1LWVA 1PU8A 2NOFA 2XHIA 1NGNA 4E9HA 3CW7A 1LWYA 4AI4A 1YQMA 2JHJA 3OH6A 2I5WA 4PIIA 1N3AA 5DPKA 1YQRA 1LMZA 1N3CA 1NKUA 1KG3A 4EVVA 2NOHA 2H56A 4EJZA 5AN4A 3FHFA 1YQLA 4EA5A 3G0QA 1P59A 4E9EA 1KG5A 1WEFA 4YPRA 1M3HA 4YPHA 1KG6A 1PU7A 4B24A 1ORNA 4E9GA 1WEGA 2NOIA 4YOQA 1PVSA 3I0WA 2ABKA 1LWWA 3IH7A 4EW0A 4E9FA 3I0XA 1KG2A 3FHGA 1VRLA 2NOBA 1FN7A 2OFIA 1EBMA 1MPGA 3IHOA 1ORPA 1MUDA 4AI5A 3N0UA 3FSPA 1KQJA 2YG9A 1WEIA 1KG7A 4AIAA 2NOZA 3S6IA 3CWAA 2JHNA 1M3QA 1DIZA 1KG4A 3CWSA 4UNFA 1KEAA 4EJYA 4OFEA 4HSBA 4DK9A 5CHZA 1P7MA 2JG6A 4B22A 2OFKA 4UOBA 1RRQA 1XQOA 3OGDA 3CVTA 3D4VA 1RRSA 3KNTA 1N39A 2NOLA 4OFHA 3CVSA 4B21A 3N5NX 1XG7A 3CWTA 3F0ZA 3OH9A 1KO9A 1PU6A 1MUNA 4EW4A 4OFAA 3F10A 2YG8A 1HU0A 1MUYA 5KN8A 3CWUA 5KN9A 4EA4A 2NOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KTU A;  4B23 A;  1YQK A;  1XQP A;  1LWV A;  1PU8 A;  2NOF A;  2XHI A;  1NGN A;  4E9H A;  3CW7 A;  1LWY A;  4AI4 A;  1YQM A;  2JHJ A;  3OH6 A;  2I5W A;  4PII A;  1N3A A;  5DPK A;  1YQR A;  1LMZ A;  1N3C A;  1NKU A;  1KG3 A;  4EVV A;  2NOH A;  2H56 A;  4EJZ A;  5AN4 A;  3FHF A;  1YQL A;  4EA5 A;  3G0Q A;  1P59 A;  4E9E A;  1KG5 A;  1WEF A;  4YPR A;  1M3H A;  4YPH A;  1KG6 A;  1PU7 A;  4B24 A;  1ORN A;  4E9G A;  1WEG A;  2NOI A;  4YOQ A;  1PVS A;  3I0W A;  2ABK A;  1LWW A;  3IH7 A;  4EW0 A;  4E9F A;  3I0X A;  1KG2 A;  3FHG A;  1VRL A;  2NOB A;  1FN7 A;  2OFI A;  1EBM A;  1MPG A;  3IHO A;  1ORP A;  1MUD A;  4AI5 A;  3N0U A;  3FSP A;  1KQJ A;  2YG9 A;  1WEI A;  1KG7 A;  4AIA A;  2NOZ A;  3S6I A;  3CWA A;  2JHN A;  1M3Q A;  1DIZ A;  1KG4 A;  3CWS A;  4UNF A;  1KEA A;  4EJY A;  4OFE A;  4HSB A;  4DK9 A;  5CHZ A;  1P7M A;  2JG6 A;  4B22 A;  2OFK A;  4UOB A;  1RRQ A;  1XQO A;  3OGD A;  3CVT A;  3D4V A;  1RRS A;  3KNT A;  1N39 A;  2NOL A;  4OFH A;  3CVS A;  4B21 A;  3N5N X;  1XG7 A;  3CWT A;  3F0Z A;  3OH9 A;  1KO9 A;  1PU6 A;  1MUN A;  4EW4 A;  4OFA A;  3F10 A;  2YG8 A;  1HU0 A;  1MUY A;  5KN8 A;  3CWU A;  5KN9 A;  4EA4 A;  2NOE A; 
#chains in the Genus database with same CATH topology
 3OYG A;  3KTU A;  4BDY A;  4ZTF A;  4B23 A;  1YQK A;  1XQP A;  1LWV A;  1PU8 A;  4BAC A;  2NOF A;  3R2X C;  2XHI A;  1NGN A;  4E9H A;  3CW7 A;  1LWY A;  3L2R A;  4AI4 A;  1YQM A;  2JHJ A;  3OH6 A;  2I5W A;  3OYD A;  2W03 A;  4PII A;  1N3A A;  5DPK A;  4BDZ A;  1YQR A;  1LMZ A;  1N3C A;  1NKU A;  1KG3 A;  4EVV A;  2NOH A;  4E7J A;  3S3N A;  4BE2 A;  2H56 A;  3L2W A;  4EJZ A;  5AN4 A;  3FHF A;  1YQL A;  4EA5 A;  3L2Q A;  3G0Q A;  1P59 A;  4E7K A;  4E9E A;  1KG5 A;  2V75 A;  1WEF A;  4NZG A;  4YPR A;  3OYM A;  1M3H A;  4YPH A;  1KG6 A;  1PU7 A;  4B24 A;  3OS1 A;  1ORN A;  4E9G A;  1WEG A;  2NOI A;  4BE0 A;  4YOQ A;  1PVS A;  3I0W A;  2ABK A;  3L2V A;  3OYA A;  4IKF A;  4E7I A;  1LWW A;  3IH7 A;  4EW0 A;  4E9F A;  3I0X A;  1KG2 A;  3FHG A;  3VW4 A;  1VRL A;  2NOB A;  1FN7 A;  2OFI A;  1EBM A;  1MPG A;  2JPS A;  4ZTJ A;  3IHO A;  1ORP A;  1MUD A;  3OYL A;  4AI5 A;  3OYJ A;  3N0U A;  3FSP A;  1KQJ A;  2YG9 A;  1WEI A;  3OYF A;  1KG7 A;  4AIA A;  2NOZ A;  3S6I A;  3CWA A;  2JHN A;  4BE1 A;  1M3Q A;  5FRO A;  1DIZ A;  1KG4 A;  4E7H A;  3CWS A;  4UNF A;  1KEA A;  4EJY A;  3OYC A;  3OYB A;  5FRM A;  4OFE A;  3OYK A;  4HSB A;  4DK9 A;  3NNQ A;  5CHZ A;  2W04 A;  1P7M A;  1U84 A;  2JG6 A;  2OFK A;  4B22 A;  4UOB A;  1RRQ A;  3L2U A;  1XQO A;  3OGD A;  3CVT A;  3D4V A;  1RRS A;  3OYI A;  3KNT A;  1N39 A;  3S3O A;  3OS0 A;  2NOL A;  5FRN A;  3OYH A;  4OFH A;  3CVS A;  3LCN A;  3OYE A;  4E7L A;  4B21 A;  3N5N X;  1XG7 A;  3CWT A;  3F0Z A;  3OH9 A;  3OYN A;  1KO9 A;  1PU6 A;  1MUN A;  4EW4 A;  3OY9 A;  3OS2 A;  4OFA A;  3F10 A;  2YG8 A;  1HU0 A;  1MUY A;  5KN8 A;  3CWU A;  5KN9 A;  4EA4 A;  3S3M A;  2NOE A; 
#chains in the Genus database with same CATH homology
 3KTU A;  4B23 A;  1YQK A;  1XQP A;  1LWV A;  1PU8 A;  2NOF A;  2XHI A;  1NGN A;  4E9H A;  3CW7 A;  1LWY A;  4AI4 A;  1YQM A;  2JHJ A;  3OH6 A;  2I5W A;  4PII A;  1N3A A;  5DPK A;  1YQR A;  1LMZ A;  1N3C A;  1NKU A;  1KG3 A;  4EVV A;  2NOH A;  2H56 A;  4EJZ A;  5AN4 A;  3FHF A;  1YQL A;  4EA5 A;  3G0Q A;  1P59 A;  4E9E A;  1KG5 A;  1WEF A;  4YPR A;  1M3H A;  4YPH A;  1KG6 A;  1PU7 A;  4B24 A;  1ORN A;  4E9G A;  1WEG A;  2NOI A;  4YOQ A;  1PVS A;  3I0W A;  2ABK A;  1LWW A;  3IH7 A;  4EW0 A;  4E9F A;  3I0X A;  1KG2 A;  3FHG A;  1VRL A;  2NOB A;  1FN7 A;  2OFI A;  1EBM A;  1MPG A;  3IHO A;  1ORP A;  1MUD A;  4AI5 A;  3N0U A;  3FSP A;  1KQJ A;  2YG9 A;  1WEI A;  1KG7 A;  4AIA A;  2NOZ A;  3S6I A;  3CWA A;  2JHN A;  1M3Q A;  1DIZ A;  1KG4 A;  3CWS A;  4UNF A;  1KEA A;  4EJY A;  4OFE A;  4HSB A;  4DK9 A;  5CHZ A;  1P7M A;  2JG6 A;  4B22 A;  2OFK A;  4UOB A;  1RRQ A;  1XQO A;  3OGD A;  3CVT A;  3D4V A;  1RRS A;  3KNT A;  1N39 A;  2NOL A;  4OFH A;  3CVS A;  4B21 A;  3N5N X;  1XG7 A;  3CWT A;  3F0Z A;  3OH9 A;  1KO9 A;  1PU6 A;  1MUN A;  4EW4 A;  4OFA A;  3F10 A;  2YG8 A;  1HU0 A;  1MUY A;  5KN8 A;  3CWU A;  5KN9 A;  4EA4 A;  2NOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...