4EVVA

Mouse mbd4 glycosylase domain in complex with a g:t mismatch
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
145
structure length
145
Chain Sequence
MKWTPPRSPFNLVQEILFHDPWKLLIATIFLNRTSGKMAIPVLWEFLEKYPSAEVARAADWRDVSELLKPLGLYDLRAKTIIKFSDEYLTKQWRYPIELHGIGKYGNDSYRIFCVNEWKQVHPENHKLNKYHDWLWENHEKLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Methyl-CpG-binding domain protein 4
publication title Excision of thymine and 5-hydroxymethyluracil by the MBD4 DNA glycosylase domain: structural basis and implications for active DNA demethylation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/dna
total genus 41
structure length 145
sequence length 145
ec nomenclature ec 3.2.2.-:
pdb deposition date 2012-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4evvA00
2XHIA 1WEIA 3KTUA 1KG3A 3CWTA 4YOQA 1ORPA 1PU6A 1XQPA 3S6IA 1KO9A 1LWVA 1KEAA 3FSPA 4E9HA 1RRSA 1N39A 3FHGA 4EJYA 4DK9A 4AI5A 2ABKA 2JHNA 3I0XA 3D4VA 4OFEA 3FHFA 1N3CA 3I0WA 4E9EA 2NOIA 4OFAA 1KQJA 1LMZA 1KG2A 4EW0A 2NOHA 1PU8A 1FN7A 4HSBA 2NOLA 3G0QA 3CWUA 2YG9A 1XG7A 1MUYA 4E9GA 1KG6A 4EA4A 1YQRA 3CVSA 4B24A 1ORNA 2YG8A 1EBMA 3N0UA 1M3QA 1MUDA 4B21A 3CW7A 1YQKA 3KNTA 4YPHA 4UOBA 1XQOA 1MPGA 3CWSA 3OH9A 3IH7A 1N3AA 2JHJA 3CVTA 4PIIA 4E9FA 5AN4A 3OH6A 2NOEA 3F10A 1WEGA 4AI4A 2NOZA 1LWYA 2NOFA 1LWWA 4EA5A 3OGDA 1KG4A 1YQMA 1YQLA 4UNFA 2I5WA 2NOBA 3CWAA 3F0ZA 5DPKA 2OFIA 1PU7A 1M3HA 3N5NX 5KN9A 2OFKA 1WEFA 1NGNA 4YPRA 4EW4A 4B23A 4OFHA 2H56A 1P7MA 1VRLA 5CHZA 4AIAA 4B22A 1KG7A 1NKUA 1MUNA 1DIZA 5KN8A 2JG6A 3IHOA 1HU0A 1PVSA 4EVVA 1KG5A 4EJZA 1P59A 1RRQA
chains in the Genus database with same CATH superfamily
2XHIA 4BE1A 4ZTJA 1WEIA 3KTUA 1KG3A 3CWTA 4YOQA 1ORPA 3L2UA 1PU6A 1XQPA 3S6IA 1KO9A 1LWVA 1KEAA 3FSPA 4E9HA 1RRSA 3OS0A 1N39A 3FHGA 4EJYA 3OS2A 4DK9A 4AI5A 2ABKA 2JHNA 3I0XA 3D4VA 4OFEA 2V75A 3FHFA 1N3CA 3I0WA 4E9EA 2NOIA 4OFAA 1KQJA 1LMZA 1KG2A 3LCNA 4EW0A 3OYMA 2NOHA 1PU8A 1FN7A 4HSBA 3OYAA 3OYNA 4E7JA 2NOLA 3G0QA 3CWUA 2YG9A 4ZTFA 1XG7A 1MUYA 4E9GA 4BACA 4BE0A 4E7IA 3OS1A 1KG6A 4E7HA 4EA4A 1YQRA 3CVSA 4B24A 1ORNA 4IKFA 3R2XC 3OYKA 3OYLA 2YG8A 1EBMA 3N0UA 1M3QA 1MUDA 3NNQA 4B21A 1YQKA 3OYFA 3CW7A 3OYIA 3KNTA 4YPHA 4BE2A 4UOBA 1XQOA 1MPGA 3CWSA 3OH9A 3L2RA 4E7LA 1U84A 3IH7A 1N3AA 3L2QA 2JHJA 3CVTA 4PIIA 3OYHA 4NZGA 4E9FA 5AN4A 3OH6A 2NOEA 3F10A 2W04A 3OYEA 1WEGA 4AI4A 2NOZA 3OYCA 1LWYA 5FRMA 2NOFA 1LWWA 4EA5A 3OGDA 2W03A 1KG4A 1YQMA 1YQLA 4UNFA 2I5WA 2NOBA 3CWAA 3F0ZA 5DPKA 3OYDA 4BDZA 2OFIA 1PU7A 1M3HA 2JPSA 3N5NX 5KN9A 3VW4A 2OFKA 1WEFA 1NGNA 4YPRA 3OYGA 4EW4A 4B23A 4OFHA 2H56A 3L2VA 1P7MA 1VRLA 5CHZA 4AIAA 4B22A 3L2WA 3S3MA 3OYJA 1KG7A 4BDYA 1NKUA 5FROA 3OY9A 3S3NA 1MUNA 1DIZA 5KN8A 2JG6A 3S3OA 3IHOA 1HU0A 1PVSA 4EVVA 5FRNA 1KG5A 3OYBA 1P59A 4E7KA 4EJZA 1RRQA
chains in the Genus database with same CATH topology
2XHIA 1WEIA 3KTUA 1KG3A 3CWTA 4YOQA 1ORPA 1PU6A 1XQPA 3S6IA 1KO9A 1LWVA 1KEAA 3FSPA 4E9HA 1RRSA 1N39A 3FHGA 4EJYA 4DK9A 4AI5A 2ABKA 2JHNA 3I0XA 3D4VA 4OFEA 3FHFA 1N3CA 3I0WA 4E9EA 2NOIA 4OFAA 1KQJA 1LMZA 1KG2A 4EW0A 2NOHA 1PU8A 1FN7A 4HSBA 2NOLA 3G0QA 3CWUA 2YG9A 1XG7A 1MUYA 4E9GA 1KG6A 4EA4A 1YQRA 3CVSA 4B24A 1ORNA 2YG8A 1EBMA 3N0UA 1M3QA 1MUDA 4B21A 3CW7A 1YQKA 3KNTA 4YPHA 4UOBA 1XQOA 1MPGA 3CWSA 3OH9A 3IH7A 1N3AA 2JHJA 3CVTA 4PIIA 4E9FA 5AN4A 3OH6A 2NOEA 3F10A 1WEGA 4AI4A 2NOZA 1LWYA 2NOFA 1LWWA 4EA5A 3OGDA 1KG4A 1YQMA 1YQLA 4UNFA 2I5WA 2NOBA 3CWAA 3F0ZA 5DPKA 2OFIA 1PU7A 1M3HA 3N5NX 5KN9A 2OFKA 1WEFA 1NGNA 4YPRA 4EW4A 4B23A 4OFHA 2H56A 1P7MA 1VRLA 5CHZA 4AIAA 4B22A 1KG7A 1NKUA 1MUNA 1DIZA 5KN8A 2JG6A 3IHOA 1HU0A 1PVSA 4EVVA 1KG5A 4EJZA 1P59A 1RRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XHI A;  1WEI A;  3KTU A;  1KG3 A;  3CWT A;  4YOQ A;  1ORP A;  1PU6 A;  1XQP A;  3S6I A;  1KO9 A;  1LWV A;  1KEA A;  3FSP A;  4E9H A;  1RRS A;  1N39 A;  3FHG A;  4EJY A;  4DK9 A;  4AI5 A;  2ABK A;  2JHN A;  3I0X A;  3D4V A;  4OFE A;  3FHF A;  1N3C A;  3I0W A;  4E9E A;  2NOI A;  4OFA A;  1KQJ A;  1LMZ A;  1KG2 A;  4EW0 A;  2NOH A;  1PU8 A;  1FN7 A;  4HSB A;  2NOL A;  3G0Q A;  3CWU A;  2YG9 A;  1XG7 A;  1MUY A;  4E9G A;  1KG6 A;  4EA4 A;  1YQR A;  3CVS A;  4B24 A;  1ORN A;  2YG8 A;  1EBM A;  3N0U A;  1M3Q A;  1MUD A;  4B21 A;  3CW7 A;  1YQK A;  3KNT A;  4YPH A;  4UOB A;  1XQO A;  1MPG A;  3CWS A;  3OH9 A;  3IH7 A;  1N3A A;  2JHJ A;  3CVT A;  4PII A;  4E9F A;  5AN4 A;  3OH6 A;  2NOE A;  3F10 A;  1WEG A;  4AI4 A;  2NOZ A;  1LWY A;  2NOF A;  1LWW A;  4EA5 A;  3OGD A;  1KG4 A;  1YQM A;  1YQL A;  4UNF A;  2I5W A;  2NOB A;  3CWA A;  3F0Z A;  5DPK A;  2OFI A;  1PU7 A;  1M3H A;  3N5N X;  5KN9 A;  2OFK A;  1WEF A;  1NGN A;  4YPR A;  4EW4 A;  4B23 A;  4OFH A;  2H56 A;  1P7M A;  1VRL A;  5CHZ A;  4AIA A;  4B22 A;  1KG7 A;  1NKU A;  1MUN A;  1DIZ A;  5KN8 A;  2JG6 A;  3IHO A;  1HU0 A;  1PVS A;  4EVV A;  1KG5 A;  4EJZ A;  1P59 A;  1RRQ A; 
#chains in the Genus database with same CATH topology
 2XHI A;  4BE1 A;  4ZTJ A;  1WEI A;  3KTU A;  1KG3 A;  3CWT A;  4YOQ A;  1ORP A;  3L2U A;  1PU6 A;  1XQP A;  3S6I A;  1KO9 A;  1LWV A;  1KEA A;  3FSP A;  4E9H A;  1RRS A;  3OS0 A;  1N39 A;  3FHG A;  4EJY A;  3OS2 A;  4DK9 A;  4AI5 A;  2ABK A;  2JHN A;  3I0X A;  3D4V A;  4OFE A;  2V75 A;  3FHF A;  1N3C A;  3I0W A;  4E9E A;  2NOI A;  4OFA A;  1KQJ A;  1LMZ A;  1KG2 A;  3LCN A;  4EW0 A;  3OYM A;  2NOH A;  1PU8 A;  1FN7 A;  4HSB A;  3OYA A;  3OYN A;  4E7J A;  2NOL A;  3G0Q A;  3CWU A;  2YG9 A;  4ZTF A;  1XG7 A;  1MUY A;  4E9G A;  4BAC A;  4BE0 A;  4E7I A;  3OS1 A;  1KG6 A;  4E7H A;  4EA4 A;  1YQR A;  3CVS A;  4B24 A;  1ORN A;  4IKF A;  3R2X C;  3OYK A;  3OYL A;  2YG8 A;  1EBM A;  3N0U A;  1M3Q A;  1MUD A;  3NNQ A;  4B21 A;  1YQK A;  3OYF A;  3CW7 A;  3OYI A;  3KNT A;  4YPH A;  4BE2 A;  4UOB A;  1XQO A;  1MPG A;  3CWS A;  3OH9 A;  3L2R A;  4E7L A;  1U84 A;  3IH7 A;  1N3A A;  3L2Q A;  2JHJ A;  3CVT A;  4PII A;  3OYH A;  4NZG A;  4E9F A;  5AN4 A;  3OH6 A;  2NOE A;  3F10 A;  2W04 A;  3OYE A;  1WEG A;  4AI4 A;  2NOZ A;  3OYC A;  1LWY A;  5FRM A;  2NOF A;  1LWW A;  4EA5 A;  3OGD A;  2W03 A;  1KG4 A;  1YQM A;  1YQL A;  4UNF A;  2I5W A;  2NOB A;  3CWA A;  3F0Z A;  5DPK A;  3OYD A;  4BDZ A;  2OFI A;  1PU7 A;  1M3H A;  2JPS A;  3N5N X;  5KN9 A;  3VW4 A;  2OFK A;  1WEF A;  1NGN A;  4YPR A;  3OYG A;  4EW4 A;  4B23 A;  4OFH A;  2H56 A;  3L2V A;  1P7M A;  1VRL A;  5CHZ A;  4AIA A;  4B22 A;  3L2W A;  3S3M A;  3OYJ A;  1KG7 A;  4BDY A;  1NKU A;  5FRO A;  3OY9 A;  3S3N A;  1MUN A;  1DIZ A;  5KN8 A;  2JG6 A;  3S3O A;  3IHO A;  1HU0 A;  1PVS A;  4EVV A;  5FRN A;  1KG5 A;  3OYB A;  1P59 A;  4E7K A;  4EJZ A;  1RRQ A; 
#chains in the Genus database with same CATH homology
 2XHI A;  1WEI A;  3KTU A;  1KG3 A;  3CWT A;  4YOQ A;  1ORP A;  1PU6 A;  1XQP A;  3S6I A;  1KO9 A;  1LWV A;  1KEA A;  3FSP A;  4E9H A;  1RRS A;  1N39 A;  3FHG A;  4EJY A;  4DK9 A;  4AI5 A;  2ABK A;  2JHN A;  3I0X A;  3D4V A;  4OFE A;  3FHF A;  1N3C A;  3I0W A;  4E9E A;  2NOI A;  4OFA A;  1KQJ A;  1LMZ A;  1KG2 A;  4EW0 A;  2NOH A;  1PU8 A;  1FN7 A;  4HSB A;  2NOL A;  3G0Q A;  3CWU A;  2YG9 A;  1XG7 A;  1MUY A;  4E9G A;  1KG6 A;  4EA4 A;  1YQR A;  3CVS A;  4B24 A;  1ORN A;  2YG8 A;  1EBM A;  3N0U A;  1M3Q A;  1MUD A;  4B21 A;  3CW7 A;  1YQK A;  3KNT A;  4YPH A;  4UOB A;  1XQO A;  1MPG A;  3CWS A;  3OH9 A;  3IH7 A;  1N3A A;  2JHJ A;  3CVT A;  4PII A;  4E9F A;  5AN4 A;  3OH6 A;  2NOE A;  3F10 A;  1WEG A;  4AI4 A;  2NOZ A;  1LWY A;  2NOF A;  1LWW A;  4EA5 A;  3OGD A;  1KG4 A;  1YQM A;  1YQL A;  4UNF A;  2I5W A;  2NOB A;  3CWA A;  3F0Z A;  5DPK A;  2OFI A;  1PU7 A;  1M3H A;  3N5N X;  5KN9 A;  2OFK A;  1WEF A;  1NGN A;  4YPR A;  4EW4 A;  4B23 A;  4OFH A;  2H56 A;  1P7M A;  1VRL A;  5CHZ A;  4AIA A;  4B22 A;  1KG7 A;  1NKU A;  1MUN A;  1DIZ A;  5KN8 A;  2JG6 A;  3IHO A;  1HU0 A;  1PVS A;  4EVV A;  1KG5 A;  4EJZ A;  1P59 A;  1RRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...