4EVXA

Crystal structure of putative phage endolysin from s. enterica
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
97
structure length
94
Chain Sequence
b'RFSSAIAFIQWQGLSLEYRDRQGNWVIGYGHMLTPDETLTFITPDQAEAFLLDDLNSCDILLQNCLPELNDRFQRETLIALMFSIGHQRFLSLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative phage endolysin
publication title Crystal structure of putative phage endolysin from S. enterica
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Structural genomics, unknown function
total genus 23
structure length 94
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.910.40 Alpha Beta 2-Layer Sandwich Protein Binding, DinI Protein; Chain A Protein Binding, DinI Protein; Chain A 4evxA00
4EVXA
chains in the Genus database with same CATH superfamily
1DKIA 1U2MA 4EVXA 3BB7A 4KQTA 1PVJA 1SG2A 1GHHA
chains in the Genus database with same CATH topology
1DKIA 3BB7A 1PVJA 4EVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EVX A; 
#chains in the Genus database with same CATH topology
 1DKI A;  1U2M A;  4EVX A;  3BB7 A;  4KQT A;  1PVJ A;  1SG2 A;  1GHH A; 
#chains in the Genus database with same CATH homology
 1DKI A;  3BB7 A;  1PVJ A;  4EVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...