4EW0A

Mouse mbd4 glycosylase domain in complex with a g:5hmu (5-hydroxymethyluracil) mismatch
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
143
Chain Sequence
WTPPRSPFNLVQEILFHDPWKLLIATIFLNRTSGKMAIPVLWEFLEKYPSAEVARAADWRDVSELLKPLGLYDLRAKTIIKFSDEYLTKQWRYPIELHGIGKYGNDSYRIFCVNEWKQVHPENHKLNKYHDWLWENHEKLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Methyl-CpG-binding domain protein 4
publication title Excision of thymine and 5-hydroxymethyluracil by the MBD4 DNA glycosylase domain: structural basis and implications for active DNA demethylation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/dna
total genus 43
structure length 143
sequence length 143
ec nomenclature ec 3.2.2.-:
pdb deposition date 2012-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4ew0A00
5DPKA 4E9EA 1PU6A 2H56A 3OGDA 4B22A 1VRLA 1HU0A 4UNFA 4UOBA 4HSBA 4B23A 3CVTA 1LWVA 2NOEA 1N3AA 1XQPA 4E9GA 1MPGA 3KTUA 5CHZA 4PIIA 1DIZA 2NOZA 1M3HA 2JG6A 1KG7A 1YQKA 2NOFA 3CWTA 1XG7A 3KNTA 1N39A 1M3QA 3S6IA 1YQMA 3F0ZA 1KG6A 3I0WA 3D4VA 2OFIA 2XHIA 4E9HA 4EW4A 3FHFA 4EJYA 1EBMA 3OH6A 1KG4A 4OFEA 3G0QA 1PU8A 1PU7A 3I0XA 3F10A 3N0UA 2YG8A 3CW7A 3IH7A 4B21A 1RRSA 1MUNA 4DK9A 3OH9A 4OFHA 3FSPA 1LWYA 1N3CA 5KN9A 1KG2A 2OFKA 4AI4A 2NOLA 1WEGA 3CWAA 1ORPA 1XQOA 3FHGA 1KEAA 1RRQA 4B24A 2JHNA 4AI5A 1KG5A 1LWWA 3CWUA 1FN7A 4EJZA 3CWSA 2I5WA 1KQJA 1LMZA 4YPRA 1P7MA 4YPHA 1MUDA 1WEFA 4AIAA 4EA4A 1P59A 4YOQA 1MUYA 2YG9A 3IHOA 1KO9A 4E9FA 4EW0A 2NOBA 2NOIA 4EA5A 1NKUA 1WEIA 1PVSA 1YQLA 4EVVA 3CVSA 2NOHA 5KN8A 1NGNA 3N5NX 4OFAA 2ABKA 1YQRA 1ORNA 1KG3A 5AN4A 2JHJA
chains in the Genus database with same CATH superfamily
5DPKA 4E9EA 1PU6A 2H56A 3S3MA 3OGDA 4B22A 3R2XC 1VRLA 1HU0A 4UNFA 4UOBA 4HSBA 4B23A 3CVTA 1LWVA 2NOEA 1N3AA 1XQPA 4E9GA 1MPGA 4E7IA 3KTUA 5CHZA 3L2QA 5FRMA 4PIIA 3L2UA 3OS1A 1DIZA 2NOZA 1M3HA 3OYBA 2JG6A 1KG7A 1YQKA 4BE2A 4E7KA 3L2VA 2NOFA 3CWTA 4IKFA 1XG7A 3KNTA 1N39A 1M3QA 3S6IA 1YQMA 2V75A 3F0ZA 4E7LA 1KG6A 3I0WA 3D4VA 2OFIA 2XHIA 4E9HA 4EW4A 3OYJA 3FHFA 4EJYA 1EBMA 3OH6A 2W04A 3S3NA 1KG4A 4OFEA 3G0QA 3OY9A 1PU8A 3VW4A 1PU7A 4BE0A 3I0XA 3F10A 3N0UA 2YG8A 3OYKA 3CW7A 5FROA 3IH7A 3OYFA 4B21A 3OS2A 1RRSA 1MUNA 3OYAA 4DK9A 3OH9A 3OYHA 4OFHA 3FSPA 1LWYA 1N3CA 4E7HA 5KN9A 1KG2A 2OFKA 4AI4A 2NOLA 1WEGA 3CWAA 1ORPA 1XQOA 3FHGA 1KEAA 4BDYA 3OYDA 1RRQA 4B24A 2JHNA 4AI5A 1KG5A 4ZTJA 1LWWA 3LCNA 3CWUA 1U84A 1FN7A 4EJZA 4BDZA 3CWSA 2I5WA 5FRNA 3OYEA 1KQJA 1LMZA 3OYGA 4YPRA 1P7MA 3OS0A 3OYNA 4YPHA 1MUDA 1WEFA 4AIAA 3NNQA 3OYMA 2W03A 4EA4A 1P59A 4YOQA 1MUYA 2YG9A 3IHOA 4E7JA 1KO9A 2JPSA 4E9FA 4NZGA 4EW0A 2NOBA 3L2RA 2NOIA 4EA5A 1NKUA 1WEIA 1PVSA 3S3OA 4BACA 1YQLA 4EVVA 4ZTFA 3L2WA 3CVSA 2NOHA 3OYIA 5KN8A 1NGNA 3N5NX 4OFAA 2ABKA 1YQRA 1ORNA 1KG3A 5AN4A 3OYCA 4BE1A 2JHJA 3OYLA
chains in the Genus database with same CATH topology
5DPKA 4E9EA 1PU6A 2H56A 3OGDA 4B22A 1VRLA 1HU0A 4UNFA 4UOBA 4HSBA 4B23A 3CVTA 1LWVA 2NOEA 1N3AA 1XQPA 4E9GA 1MPGA 3KTUA 5CHZA 4PIIA 1DIZA 2NOZA 1M3HA 2JG6A 1KG7A 1YQKA 2NOFA 3CWTA 1XG7A 3KNTA 1N39A 1M3QA 3S6IA 1YQMA 3F0ZA 1KG6A 3I0WA 3D4VA 2OFIA 2XHIA 4E9HA 4EW4A 3FHFA 4EJYA 1EBMA 3OH6A 1KG4A 4OFEA 3G0QA 1PU8A 1PU7A 3I0XA 3F10A 3N0UA 2YG8A 3CW7A 3IH7A 4B21A 1RRSA 1MUNA 4DK9A 3OH9A 4OFHA 3FSPA 1LWYA 1N3CA 5KN9A 1KG2A 2OFKA 4AI4A 2NOLA 1WEGA 3CWAA 1ORPA 1XQOA 3FHGA 1KEAA 1RRQA 4B24A 2JHNA 4AI5A 1KG5A 1LWWA 3CWUA 1FN7A 4EJZA 3CWSA 2I5WA 1KQJA 1LMZA 4YPRA 1P7MA 4YPHA 1MUDA 1WEFA 4AIAA 4EA4A 1P59A 4YOQA 1MUYA 2YG9A 3IHOA 1KO9A 4E9FA 4EW0A 2NOBA 2NOIA 4EA5A 1NKUA 1WEIA 1PVSA 1YQLA 4EVVA 3CVSA 2NOHA 5KN8A 1NGNA 3N5NX 4OFAA 2ABKA 1YQRA 1ORNA 1KG3A 5AN4A 2JHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DPK A;  4E9E A;  1PU6 A;  2H56 A;  3OGD A;  4B22 A;  1VRL A;  1HU0 A;  4UNF A;  4UOB A;  4HSB A;  4B23 A;  3CVT A;  1LWV A;  2NOE A;  1N3A A;  1XQP A;  4E9G A;  1MPG A;  3KTU A;  5CHZ A;  4PII A;  1DIZ A;  2NOZ A;  1M3H A;  2JG6 A;  1KG7 A;  1YQK A;  2NOF A;  3CWT A;  1XG7 A;  3KNT A;  1N39 A;  1M3Q A;  3S6I A;  1YQM A;  3F0Z A;  1KG6 A;  3I0W A;  3D4V A;  2OFI A;  2XHI A;  4E9H A;  4EW4 A;  3FHF A;  4EJY A;  1EBM A;  3OH6 A;  1KG4 A;  4OFE A;  3G0Q A;  1PU8 A;  1PU7 A;  3I0X A;  3F10 A;  3N0U A;  2YG8 A;  3CW7 A;  3IH7 A;  4B21 A;  1RRS A;  1MUN A;  4DK9 A;  3OH9 A;  4OFH A;  3FSP A;  1LWY A;  1N3C A;  5KN9 A;  1KG2 A;  2OFK A;  4AI4 A;  2NOL A;  1WEG A;  3CWA A;  1ORP A;  1XQO A;  3FHG A;  1KEA A;  1RRQ A;  4B24 A;  2JHN A;  4AI5 A;  1KG5 A;  1LWW A;  3CWU A;  1FN7 A;  4EJZ A;  3CWS A;  2I5W A;  1KQJ A;  1LMZ A;  4YPR A;  1P7M A;  4YPH A;  1MUD A;  1WEF A;  4AIA A;  4EA4 A;  1P59 A;  4YOQ A;  1MUY A;  2YG9 A;  3IHO A;  1KO9 A;  4E9F A;  4EW0 A;  2NOB A;  2NOI A;  4EA5 A;  1NKU A;  1WEI A;  1PVS A;  1YQL A;  4EVV A;  3CVS A;  2NOH A;  5KN8 A;  1NGN A;  3N5N X;  4OFA A;  2ABK A;  1YQR A;  1ORN A;  1KG3 A;  5AN4 A;  2JHJ A; 
#chains in the Genus database with same CATH topology
 5DPK A;  4E9E A;  1PU6 A;  2H56 A;  3S3M A;  3OGD A;  4B22 A;  3R2X C;  1VRL A;  1HU0 A;  4UNF A;  4UOB A;  4HSB A;  4B23 A;  3CVT A;  1LWV A;  2NOE A;  1N3A A;  1XQP A;  4E9G A;  1MPG A;  4E7I A;  3KTU A;  5CHZ A;  3L2Q A;  5FRM A;  4PII A;  3L2U A;  3OS1 A;  1DIZ A;  2NOZ A;  1M3H A;  3OYB A;  2JG6 A;  1KG7 A;  1YQK A;  4BE2 A;  4E7K A;  3L2V A;  2NOF A;  3CWT A;  4IKF A;  1XG7 A;  3KNT A;  1N39 A;  1M3Q A;  3S6I A;  1YQM A;  2V75 A;  3F0Z A;  4E7L A;  1KG6 A;  3I0W A;  3D4V A;  2OFI A;  2XHI A;  4E9H A;  4EW4 A;  3OYJ A;  3FHF A;  4EJY A;  1EBM A;  3OH6 A;  2W04 A;  3S3N A;  1KG4 A;  4OFE A;  3G0Q A;  3OY9 A;  1PU8 A;  3VW4 A;  1PU7 A;  4BE0 A;  3I0X A;  3F10 A;  3N0U A;  2YG8 A;  3OYK A;  3CW7 A;  5FRO A;  3IH7 A;  3OYF A;  4B21 A;  3OS2 A;  1RRS A;  1MUN A;  3OYA A;  4DK9 A;  3OH9 A;  3OYH A;  4OFH A;  3FSP A;  1LWY A;  1N3C A;  4E7H A;  5KN9 A;  1KG2 A;  2OFK A;  4AI4 A;  2NOL A;  1WEG A;  3CWA A;  1ORP A;  1XQO A;  3FHG A;  1KEA A;  4BDY A;  3OYD A;  1RRQ A;  4B24 A;  2JHN A;  4AI5 A;  1KG5 A;  4ZTJ A;  1LWW A;  3LCN A;  3CWU A;  1U84 A;  1FN7 A;  4EJZ A;  4BDZ A;  3CWS A;  2I5W A;  5FRN A;  3OYE A;  1KQJ A;  1LMZ A;  3OYG A;  4YPR A;  1P7M A;  3OS0 A;  3OYN A;  4YPH A;  1MUD A;  1WEF A;  4AIA A;  3NNQ A;  3OYM A;  2W03 A;  4EA4 A;  1P59 A;  4YOQ A;  1MUY A;  2YG9 A;  3IHO A;  4E7J A;  1KO9 A;  2JPS A;  4E9F A;  4NZG A;  4EW0 A;  2NOB A;  3L2R A;  2NOI A;  4EA5 A;  1NKU A;  1WEI A;  1PVS A;  3S3O A;  4BAC A;  1YQL A;  4EVV A;  4ZTF A;  3L2W A;  3CVS A;  2NOH A;  3OYI A;  5KN8 A;  1NGN A;  3N5N X;  4OFA A;  2ABK A;  1YQR A;  1ORN A;  1KG3 A;  5AN4 A;  3OYC A;  4BE1 A;  2JHJ A;  3OYL A; 
#chains in the Genus database with same CATH homology
 5DPK A;  4E9E A;  1PU6 A;  2H56 A;  3OGD A;  4B22 A;  1VRL A;  1HU0 A;  4UNF A;  4UOB A;  4HSB A;  4B23 A;  3CVT A;  1LWV A;  2NOE A;  1N3A A;  1XQP A;  4E9G A;  1MPG A;  3KTU A;  5CHZ A;  4PII A;  1DIZ A;  2NOZ A;  1M3H A;  2JG6 A;  1KG7 A;  1YQK A;  2NOF A;  3CWT A;  1XG7 A;  3KNT A;  1N39 A;  1M3Q A;  3S6I A;  1YQM A;  3F0Z A;  1KG6 A;  3I0W A;  3D4V A;  2OFI A;  2XHI A;  4E9H A;  4EW4 A;  3FHF A;  4EJY A;  1EBM A;  3OH6 A;  1KG4 A;  4OFE A;  3G0Q A;  1PU8 A;  1PU7 A;  3I0X A;  3F10 A;  3N0U A;  2YG8 A;  3CW7 A;  3IH7 A;  4B21 A;  1RRS A;  1MUN A;  4DK9 A;  3OH9 A;  4OFH A;  3FSP A;  1LWY A;  1N3C A;  5KN9 A;  1KG2 A;  2OFK A;  4AI4 A;  2NOL A;  1WEG A;  3CWA A;  1ORP A;  1XQO A;  3FHG A;  1KEA A;  1RRQ A;  4B24 A;  2JHN A;  4AI5 A;  1KG5 A;  1LWW A;  3CWU A;  1FN7 A;  4EJZ A;  3CWS A;  2I5W A;  1KQJ A;  1LMZ A;  4YPR A;  1P7M A;  4YPH A;  1MUD A;  1WEF A;  4AIA A;  4EA4 A;  1P59 A;  4YOQ A;  1MUY A;  2YG9 A;  3IHO A;  1KO9 A;  4E9F A;  4EW0 A;  2NOB A;  2NOI A;  4EA5 A;  1NKU A;  1WEI A;  1PVS A;  1YQL A;  4EVV A;  3CVS A;  2NOH A;  5KN8 A;  1NGN A;  3N5N X;  4OFA A;  2ABK A;  1YQR A;  1ORN A;  1KG3 A;  5AN4 A;  2JHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...