4EW2A

The structure of human glycinamide ribonucleotide transformylase in complex with 10s-methylthio-ddathf.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
205
structure length
204
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSRVKLAEHKIFPAALQLVASGTVQLGENGKICWVKEEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biological and Structural Evaluation of 10R- and 10S-Methylthio-DDACTHF Reveals a New Role for Sulfur in Inhibition of Glycinamide Ribonucleotide Transformylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Trifunctional purine biosynthetic protein adenosine-3
total genus 65
structure length 204
sequence length 205
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4ew2A00
4EW1A 4Q12A 3NRBA 3P9XA 4TS4A 3GARA 1ZLYA 4TTSA 4ZZ1A 2YWRA 4ZYXA 4ZYWA 3KCQA 3W7BA 3DA8A 2BLNA 4IQFA 4R8VA 4ZYZA 1MEJA 4ZYTA 1RC1A 1RC0A 5J63A 4TT8A 1CDDA 1YRWA 1ZLXA 3OBIA 4NV1A 3AUFA 1RBQA 4YFVA 4EW3A 1GARA 1ZGHA 3O1LA 4ZZ2A 4ZZ3A 4QPDA 2FMTA 1RBYA 1RBZA 3AV3A 4ZZ0A 5J9FA 2CFIA 5CJJA 4ZYYA 1MEOA 4DS3A 1CDEA 3R8XA 4QPCA 3LOUA 1JKXA 1S3IA 1MENA 2BW0A 3DCJA 4YFYA 2GARA 1C3EA 1GRCA 3N0VA 3TQRA 4S1NA 4ZYVA 1RBMA 3TQQA 4EW2A 3Q0IA 1FMTA 1NJSA 4ZYUA 1C2TA 4PZUA
chains in the Genus database with same CATH superfamily
1CY0A 1U9IA 3DLIA 3R3WA 4EYGA 4XUGB 4QDTA 2YZNA 5HPYB 1QFMA 3W5SA 2BFDA 3O4IA 2WFLB 1R9JA 4S35A 3KAQA 2DQSA 1JJBA 1M6WA 3KVRA 4HAZA 3CF2A 4BNVA 1RD4A 2WWTA 1PJZA 1XVIA 3VR6H 1H2HA 2VJMB 1SU7A 3KQOA 1HURA 1U99A 1CUBA 3M34A 3GX1A 4EHLA 2GLXA 3UTCA 2PCJA 4MQ6A 4XB1A 3WGYA 4P5PA 3IR7A 2A67A 2GK3A 4PX9A 3GUYA 3H0CA 3TAXA 3L0PA 4URUR 4RQTA 4TVKA 1OBCA 3ILYA 4PPNA 1FFDA 3NG1A 2JCYA 4KIJA 4RZ2A 1DRJA 1Q1BA 1PLLA 3ZEAA 4P93A 3WDSA 4AY6A 3K4HA 4Q05A 5CK5A 5DSXA 2X8WA 3D4IA 4C7KA 4PICA 5AHOA 1JUDA 4HKTA 4B35A 3WGGA 1C81A 1TLTA 4ND2A 4O4JF 4C3VA 1Z73A 2PJUA 3VOSA 4HD8A 4D4KA 1QZUA 1SXJD 2HGSA 5IARA 3VO1A 1WD5A 2HBRA 3HL0A 3S55A 2QRQA 4RFSB 2E37A 3TZBA 1H0SA 1BYUA 1KBOA 3ADKA 3WYDA 1T5IA 5JSZB 2JG3A 1Y4ZA 4YMUA 1GR1A 3Q6MA 4OBWA 1EXMA 3K2QA 4CIXA 5E8JA 1ULAA 3IE0A 1GAQA 5FUMA 4WOCA 1U2RA 1FFEA 3PJFA 3U39A 4D9HA 4D8TA 3KG2A 1RLIA 2YW9A 4XIGS 4BFXA 3ZJVA 4QUEA 3GRVA 4XYEA 3P71T 4JT2A 1KK1A 3ZHYA 1Z13A 2I6TA 1QE0A 2BCJQ 3PJRA 2IPXA 3QX3A 4RS4A 3RRNA 1OB5A 3BWCA 5CM8B 5C8YB 4C01A 3F8TA 4UNSA 2DPHA 3GD7A 4BN4A 1QGZA 3ZU5A 5E1MA 2O8DA 4JYPA 3QJ5A 4TTJA 4QM7A 2VSOA 4QELA 4RZIA 3I9V1 3A31A 1RPTA 2H3EA 2VF5X 2WFMA 3ZBTA 1W6UA 2MJLA 3B3JA 3NOVA 2HDHA 1M1XB 2HIHA 4Q4JA 2Q6TA 4LBVA 4TMXA 2QTTA 3HRIA 1VCNA 1H23A 2OV2A 2DT5A 5H9VA 4D4MA 5I5GA 4E7OA 4L15A 5BSGA 1M1NA 1GQSA 2YN0A 3DDUA 2HWXA 4AJJA 4IPTA 3NBYC 4C4SA 2X2OA 5ITZA 4KEAA 4AMGA 2GEJA 3OLZA 4BJ6A 1C9YA 1NPYA 2HC9A 4IDHA 1IVNA 2GD2A 4XAQA 3T3HA 5KDOA 4CQNA 4FJ2A 1BN7A 4OB6A 4ZK2A 3QGMA 4YDHB 4RIEA 4Y2HA 4G9EA 3RV3A 3ENNA 3ZCPA 1TAGA 3LY7A 1PEAA 1V48A 1OR8A 4FMDF 4UBOA 1AHPA 1EUYA 3LVBA 4PZCA 4G1UC 4A1FA 5IUNC 9MHTA 2YVLA 3A6HA 3I5AA 5JJ5A 1LPOA 1Z35A 2CY0A 1I6LA 2R9VA 5ENVA 1G4UR 3T1HB 5BQOA 1QBGA 1Y7TA 3HFGA 4MWBA 5FUVA 4MV0A 2PQMA 4H77A 2H1IA 4KC0A 3REGA 3W7AA 3SXUB 3U4HA 4AN1A 1S5PA 5J5AA 3TSYA 2EWVA 4IDNA 4MR7A 5AKXA 1PEKE 4W1PA 5HG0A 4OYYA 4AYTA 2MMCA 2JJMA 5DLQC 3N8HA 3W34A 1Z36A 1F4LA 1W1UA 2BDTA 3H4IA 3OOJA 1GADO 4MLCA 4XM1A 4NNPA 3HEBA 3P9CA 1K8ZB 2QUAA 4DY4A 1CJCA 3UOAB 3DKPA 2XVYA 1QYXA 5SZKB 5DBGA 2PX4A 1J8DA 2OD9A 1T5LA 4M37A 1OA0A 3CN7A 1UDCA 1L7XA 1SOAA 2OEPA 4IOKA 5KCMA 4XFDA 3ZY6A 1GGVA 2A33A 2B1RA 1NBAA 1UKBA 4YMHA 4R6XA 3HYTA 4EW2A 5LQMA 5TLSA 5JG7A 3C43A 3IR5A 1QRTA 2OLEA 2VJDA 2PKQO 3AY6A 4KIWA 4EG6A 5F64A 5K2MA 2OZPA 3RS4A 4ARZB 1R5NA 1E32A 4AZ3A 2CLLB 1X1RA 4EKEA 3KOXA 5K4GA 4Z3OA 3VA7A 1QIHA 1U0RA 2HXGA 2CT8A 4G0UA 3W8FA 1NXOA 3WQSB 5BN5A 5T3UA 3MGAA 3LSYA 1H8HA 4OXRA 5JASA 2JLXA 4JJ8A 4G65A 4YMWA 2FFJA 4GX5A 4M46A 3QEKA 1Y4DE 3JQGB 3OCUA 5LOVF 2XGJA 4JDPA 5A2QA 3VFDA 3QWBA 1PJSA 3EUFA 4G25A 4UCFA 4G63A 3FDIA 1Q0RA 4DXDA 1KY3A 3IOYA 2I6FA 2ZPTX 3M9XA 5BSEA 1FTWA 2NGRA 4NBUA 5LYJB 1OBHA 2VLBA 2PUDA 3OU2A 2YWDA 1J9ZA 2OHFA 2DF8A 2PL5A 1W49A 3IQFA 3L8EA 3PFWO 3PJGA 4I6GA 4QO7A 4D81A 1GRQA 4QBKA 2I3GA 1XG5A 4P80A 4XJSA 3QLVC 5J4KA 4MS4A 5ITZB 4KBFA 2OM2A 2H7XA 3DW1X 2BBWA 2FPSA 3W6OA 5C5EA 4LSGA 2GZSA 3A27A 3EXEB 4IDEA 1EI9A 3KYCB 4PO3X 4Q00A 4ZEOA 3ZG6A 3CRNA 5K8LA 2EG9A 1NNEA 3ICOA 1B23P 4BQQA 1ISSA 5HWSA 1GNQA 3P9NA 1RZUA 4EW6A 5JSUA 4EKNB 1IY9A 4F3RA 4RJ2A 5L3ZA 4EPWA 1XZJA 1VECA 2CD7A 3ZHBA 4YRFA 5CRIA 1Z4KA 2C1XA 2QUHA 4F6RA 1ZNWA 4NE7A 2FWBA 1O5OA 3P2KA 3DAOA 4IH1A 1QIIA 1KE2A 4V03A 4ZIRB 3DV2A 5HM8A 3DEIA 4MLZA 1ND5A 1UZNA 3O4HA 3R8CA 3O82A 3X1WA 4ZICA 3D7KA 2A57A 1T34A 2MHCA 3JQBA 4JQCA 3IEXA 5CW2A 3I61A 1UT6A 4JUBA 1CNFA 1PUJA 2DFDA 5GP1A 3C5CA 5JC1A 5JZSA 5KTRA 4HH0A 1Y5LA 2Z58A 1L5SA 3GIWA 4UHKA 2W7TA 2GCNA 3VHQA 5COAA 5A4IS 2HRCA 3OQVA 4YRKA 1YXMA 2BGJA 3M5DA 1G291 2UZ3A 5MF6A 4M60A 3KRTA 3OQOA 3CTMA 3A6DA 1QRUA 3P2OA 2DR0A 2IY7A 3G1WA 4RK5A 3UGQA 3V7WA 2QRPA 4ALKA 5KQPA 2IEIA 3AHFA 4KLRA 3DDZX 5TE9A 1ORWA 3Q7RA 2Q3HA 2QW1A 3KAJA 1MXHA 3EZLA 3Q3HA 3SC3A 3VH2A 5JQGF 1ISGA 3K0KA 5LZ2A 2B3DA 4I1SA 1RIIA 1UDWA 1WXWA 1TOAA 4IOMA 3FSGD 5FDFA 4YJ2A 4DV4B 3DTVD 4BNWA 4K6OA 5C1PA 3DA8A 1EEXB 2G5TA 1NSTA 2KS6A 2WWHA 3W4IA 4YYEA 4O4IB 1KEEA 1SKMA 4CCSA 2Z4RA 3M4YA 5E9JA 2PD3A 2DQZA 3KXPA 4OAQA 1EP2B 1KOFA 1KSFX 5B1SA 5LXTB 5KHAA 4X20A 4ZVPA 1OX5A 5AHWA 4I50F 4W1QA 1ZH2A 2IY8A 2XUKA 5FFFA 3ZW8A 4NZNA 3BREA 2W6MA 5T41A 1L4FA 4NMXB 4KFSA 4YONB 4FYVA 2JIOA 1D7AA 2H2AA 2J59A 3DO5A 4TQUS 4BNDB 1ESZA 1TJ5A 2H00A 4DRYA 3B5IA 4F9FA 2B9VA 2ZIUB 2B37A 4HQRA 2YCBA 1EQ2A 4K6FA 3NT2A 2BF7A 5TRTA 1PBTA 4MRNA 3VPSA 4IGIA 1D03A 3PE3A 1PBNA 2I4IA 2H4WA 1MORA 2PQ2A 2VCEA 3OBBA 1Z5WA 3Q6IA 2WABA 3UQZA 3ZLVA 5T4HA 2VXOA 3LUKA 5IVHA 1RXUA 2AVDA 4CEIB 1QVZA 2JRCA 3RBXA 4WINA 4UDYX 2CZGA 3SIPA 2GUWA 2BAGA 3DEYX 3VSEA 1XMPA 4D96A 1T4MA 3NLLA 1K27A 4DB4A 1QKJA 4C7BA 9LDBA 1XTUA 1HBJA 2PLFA 1NVMB 4DYVA 3DPIA 2B25A 3DWEX 2OZEA 2CLDX 2AB0A 4H7PA 2IYAA 3DE6X 5AK6A 3UUEA 1EDEA 2ZJFA 3EA5A 1T0HB 1JHVA 3C8HA 1I2MA 4JC4A 3DB1A 4ENUA 1WB4A 2ISCA 3DE2X 2PIDA 2HJ9A 2YMMA 1S8FA 5KYVA 1URPA 3D4LA 3PNSA 3V8RA 1G6Q1 1AO3A 1O95D 4RVFA 5IH7A 1YZKA 3IOEA 1G4AE 5B7QA 5DE3A 1JFVA 1M34B 5JZOA 2VPTA 1W34A 3IULA 1SZJG 3MJTA 3KPWA 5DTRA 3UK0A 2G9RA 4BVBA 4TLEA 4V3CA 3BUSA 3LHSA 4Z9BA 1HYHA 1RVDA 3NBXX 3UXMA 3P20A 1MENA 1YE5A 4LZWA 4MUAA 4S2EA 4MUXA 4TZ0A 1BN6A 3JU3A 4GPTA 4Q1DA 3ND9A 2P0EA 4NV3A 1YL7A 1XTPA 3IBFA 2P9GA 2ZWPA 1SELA 4HEA1 1DAMA 4PONA 3R5JA 1Z0JA 3QY0A 1OI4A 3VPAA 2GXAA 1QLWA 3OPYB 1P2GA 4KHZA 3MBKA 2R6GA 2BFEA 3ZDDA 2PUAA 3A9CA 3WWDA 4L57A 2R4UA 2X5NA 5BQPA 3GWZA 3NAZA 3REQB 3FWZA 1I80A 4P32A 1YBHA 2X9LA 3T7DA 4D99A 5CFQA 3VC1A 2HF8A 2P2CA 4MPJA 5DIFA 2WI8A 5HCIA 1N8SA 3ICQB 4TTVA 1ZUHA 3NOXA 4R81A 2MSDB 1ZQ9A 3E9ZA 3NNSA 4HN4B 2X0KA 3U9SA 4JYCA 2IA5A 2HSEA 4C0KA 4CMEC 2QTCA 4BQIA 2G77B 3U19A 4MVYA 1WW3A 1M2GA 5KJFA 3JQPA 4BQOA 1FTSA 1D6NA 1M9NA 3LBHA 2KB0A 5FEMA 1Y5RA 1O94A 2QTRA 5IAJA 4EELA 3B7WA 1V1RA 1QC5A 1MTOA 1GVHA 2RHRA 3V5NA 3TSWA 1DQZA 4JLUA 4RMJA 2I34A 3PENA 1KP3A 2J33A 3KHTA 3NBMA 4R9UC 4I19A 1A3CA 1L7EA 3FX2A 2YFQA 3G59A 4LXGA 1BMFD 3ZV4A 4RPIA 1O9HA 4I46A 4AG3A 3C8DA 1Z74A 1JAIA 4L4SA 1KI4A 4IQ4A 4AUKA 1KSHA 1R3UA 2I80A 4WKBA 3UAYA 3GFSA 1J1ZA 1KYVA 4ENTA 1JIVA 3ETGA 3OPMA 1IQUA 1NDUA 4YH1A 5AKHA 2R7KA 2W6QA 4RCZA 5BV7A 2OG2A 2QLLA 3FYCA 3RGGA 4BIMA 3QI2A 1NF3A 3A1CA 1II8B 4A8JB 2W8BB 4H7DA 1MFZA 1Y80A 4EM6A 5ELXA 3U56A 3ZC3A 3MWLA 4MV5A 3UPTA 1NMXA 4GE0A 1H93A 3C14C 2XCQA 4Y7DA 4LJSA 3EPPA 4HDOB 3SICE 2HPHA 5KYKA 4B6FA 1I2DA 5F2EA 2IQIA 2YBDA 3IODA 4E32A 1ST3A 2IYEA 4MW5A 5B53A 2M6LA 4FMBB 2C5LA 4QUDA 3HWRA 1TJYA 4JDUA 2YIDA 4QOFA 4UE2A 2J67A 4G6ZA 1SQSA 2I2BA 4HLUA 4UM9D 4F4DA 3ZJTA 2HMTA 3IPYA 5EJ9A 1QO0A 4JLKA 4N3NA 3LX4A 3K53A 3O2SB 1TLLA 4YWHA 4FMDB 3UJAA 3K0CC 5AW9A 1HSOA 4MS1A 1CJUC 4R05A 1ZLYA 1F20A 3LUHA 2C7RA 1XPRA 4MYTA 4DA0A 3LUAA 2ZREA 1LZKA 1UOEA 3B89A 3OJ0A 3DNFA 3GRYA 4PPFA 5G0SA 1QGED 3D1VA 2CHVA 4D8YA 1UZUA 1OC2A 2MINB 1JKJB 2YIMA 5JYBA 2V4UA 2IV3A 2I8AA 1ELOA 4FYWA 3RC1A 1JWBB 4TYQA 2ZSHA 3MPOA 1W8DA 3M7IA 1NLZA 5FWDA 1E99A 5SY4A 3W8EA 1ZR4A 4RPJA 3SHQA 3D8UA 4LBZA 4Y30A 4WK6A 2O2ZA 3BCRA 4NYJR 5AM4A 5EIWA 3WRXC 4C7XA 1WU7A 2N47A 3KNZA 4R68A 2ZU0C 4AK9A 3V6LA 1M8GA 4MUYA 1ULTA 3EOZA 3KJXA 1PYGA 3WRXA 1LCIA 2CC2A 1CX9B 4UTNA 2CBGA 2VDWB 4QEDA 5JXGA 3PPWA 5H82A 4UEQA 5F9MA 4CI0B 3KOWA 2Q45A 3CJRA 3E0QA 2QQGA 2M98A 4Y6PA 1C14A 1EGMB 3IAM6 3ZWDA 3Q0EA 1NFFA 2Z8YA 2OL4A 3B13B 4ZU1X 2R6DA 1M73E 1Q15A 2IIBA 1M8FA 1IJBA 1U5BB 4L9WA 4WLUA 3RUFA 4YAKA 3OZRA 2FPGB 2D1RA 3CKKA 1GSIA 2JC3A 2O3QA 4D44A 3JQCA 4OBXA 3JQ8B 2ZBPA 3B2QA 3Q87B 1WZNA 1GNLA 4XH9B 2EHDA 1D04A 1PD1A 1UEJA 4GKAA 1E4VA 1UP6A 1C1HA 1BO6A 2PZBA 3WV4A 4Q19A 1V3VA 2D2FA 5DISB 1HA3A 2GPNA 3L02A 3QU2A 4JL8A 1SPBS 3PHBE 4IUDS 5CFNA 5ICMA 1XDSA 5A9RA 1W75A 4ISCA 1NDHA 5EHZA 4ANFA 2HXSA 4FX2A 3V80A 3SS9X 4F92B 1BDJA 4N41A 2VRBA 4L4RA 3RABA 1DQPA 4F7DA 2J45A 3R5XA 5KTOA 1E5TA 2YY6A 1JG6A 1I3CA 3IMEA 1YOVB 1TNDA 3UB2A 1V6AA 2NPOA 2WAOA 4S04A 3DZBA 1R88A 1ZGHA 1M6HA 4D3ZA 3BWDD 4DVJA 3VKHA 3CSUA 1YO6A 5HIMA 3IEMA 1LH0A 2R5WA 2YRXA 1TKBA 2R60A 5FXMA 2IIVA 2GXSA 3CNEA 4BVEA 3N2GB 3LY8A 2BRUA 5T7BA 3EVBA 3M33A 5J2TF 4EB3A 5EJMA 3A9WA 1YBMA 4KUHA 4LE0A 1KEKA 2VPZA 1J99A 2EJBA 3RUCA 4F72A 3CZRA 1I7NA 4M7RA 1AH2A 1SUSA 4LCEA 1DMSA 2VT3A 2DPMA 1R0BA 2FGJA 2PD4A 2R8BA 1O0SA 3HUFA 3G9XA 1TU3A 3QKUA 4DKXA 4YCLA 2VSXA 1R3DA 3KP1A 3W79A 2PFKA 1X1QA 3DEFA 3PWZA 4LMPA 2XDWA 1N5OX 3LRPA 5EMHA 3AGQA 3A0RB 2EFCB 4DLNA 3IBYA 5I47A 3KOOA 3SZMA 5DEIA 4ZZ3A 1CTQA 1IJFA 3N2KA 4FFPA 3FB1A 4R7TA 2R3SA 5BYAA 4V0OA 4UM7A 4LHXA 4R9NA 4BASA 2VQDA 5L9AA 2I4TA 1U3CA 2GPAA 3UAGA 1K5DA 3RAGA 3B6EA 1P4AA 3HO6A 3GLSA 5HJ2A 5KJ6A 5LKRA 2WWGA 2ZIFA 3KTFA 2XRFA 3K96A 4EHHA 2CNBA 2ZETA 4DIOA 3T1OA 1X8JA 1LY1A 2YQ5A 1XTBA 2O52A 4RKYA 1WTAA 5ENZA 1HLDA 2Z3ZA 3W4KA 4BJ5A 3A6JA 2F43B 3T0IA 4LYAA 2A9FA 1F8FA 2AQKA 1V5WA 3ORQA 3W6ZA 1JEJA 1YR3A 1NBEA 4RD1A 3VBCA 5A0VA 4ZI7F 4DUPA 1KYWA 3AI3A 2J5QA 2NTEA 2QVGA 1G5TA 4XSVA 5JNTA 3VZPA 1DRUA 3W8NA 2F3QA 2F67A 2OP1A 4QPCA 2WJVA 2EF0A 2PL9A 4I4CA 4ZVUA 1JG1A 3Q9NA 2C0QA 1XK7A 5C2JB 6NULA 2PLNA 2XAAA 5TMBA 4Z4QA 4LXIA 1JHZA 1ZRMA 2AUTA 1U7DA 3C6XA 4G24A 4WE3A 5IKPA 3OX1A 5EIAA 3BEOA 4DMHA 1YZNA 2RCYA 1UDXA 3HI4A 2FPWA 3NM4A 5JXHA 2QNIA 1LV7A 5MN4A 4OMUA 3GBVA 3EJWA 4KN8A 1SUAA 1DXHA 5TIIA 3OZBA 2QVZX 1L4MA 2WU1A 4TQ9A 4X1YA 2V3CC 2WDPA 4ZPXA 3LPDA 5HM6A 3K09A 4NC9A 2JLRA 3K1ZA 1TLFA 1E5DA 1O9GA 2ON6A 2UYGA 1AUQA 4M1TA 3SZUA 2FQYA 4OQZA 2Y27A 3ACBA 4IZIA 4HF7A 4HYQA 4RSRA 4A16A 2PVPA 4AXBA 1M0SA 3LCMA 4PYMA 3BL8A 4M1OA 1U1GA 2XA1A 4YHBA 5JSYA 4H3VA 1WP9A 4I50A 3G89A 5C53B 1NT2A 1ZM4A 1UBEA 1YB2A 2RCNA 1YI1A 3HHEA 5JSFA 1P1FA 1RYZA 4HEHA 4ARUA 2M6KA 5A4AA 3EUEA 4JVMA 3CEMA 1W30A 1N6RA 2LXNA 2NQTA 3QVUA 5G0WA 1FW6A 1S0UA 3ACDA 2AEMA 3CH7A 3GH1A 1Y48E 3MMZA 4FQ5A 1M5UA 1IH8A 3IAS6 4LYHA 1EHYA 2YFYA 4RA6B 3VYTB 4Z4HA 1IDN1 3F6CA 1UBTS 5IANA 3EYWA 2YXNA 3GPIA 3AERA 1JXMA 1VOTA 2NUAA 4QYWA 3L8ZA 3ZJ5A 4CVNA 5JJCA 4FGLA 2O2DA 4MVWA 4MS3B 3DDHA 4DDKA 1AS3A 1C9DB 1X19A 2PT9A 3T1VA 1N92A 1BCSA 1JHRA 1TE2A 4UREA 1GUZA 3MT7A 4XX0A 5CJ2A 1TTPB 4G56A 4YRLA 5BNFA 3FNRA 2J0SA 1PFKA 1Y1LA 4OA5A 1CR1A 3H3XA 2UZ1A 3RREA 4KR2A 2Q9AA 5CGQB 3OZ7A 2F3RA 2RBGA 4IILA 5JNWA 4QLAA 5JPIA 3OE4A 1NNUA 4XEUA 4DHEA 5H7XA 4IIJB 2Q0SA 1X0VA 1N5IA 4LJLA 1ULBA 1EWKA 5IW8A 4TZKA 2LD4A 1IPFA 1D2NA 2LWIA 1GKKA 2FW0A 3BD9A 3JARA 2VYNA 5JD5A 3K70D 3FOBA 3LNTA 1RLMA 2IUUA 3PKJA 5EI5A 3DYBA 1MCZA 1KJ9A 1NMYA 2Z04A 1P4HA 2B2NA 3AV3A 5TPZD 1J33A 3RKUA 4BTLA 5IM4F 3MWKA 1UH5A 1XC7A 4RFVA 1E1RD 5FBRB 4IHJA 3L18A 4U7TB 5LA6F 5BSWA 4B3DA 4ARCA 5DSTA 1QP8A 2JFQA 3M5PA 3T1NA 5I9NA 1CJTC 1EUDB 3S8YA 3I34X 3ZVKA 1LRJA 1PJCA 3DEKA 4OP2A 4UBMA 2BFFA 3HCNA 3EZFA 1B2RA 1DOZA 1P31A 2AGVA 3QVTA 5T3YA 1ODTC 2FA9A 2WRZA 2G71A 4CG3A 1PG0A 4JIMA 5ENDA 3WFJA 1Q2XA 3FR8A 2OQIA 5KO2A 3D6VA 3DBLB 1R8XA 3K30A 5FF9A 4CNBA 3BX1A 2ODQA 4HWSA 1EK0A 3I12A 2XCRB 3KU1A 2DQYA 2BMFA 2LVBA 4JJ6A 5FPTA 3FMFA 4FT2A 3ZY4A 2Q0XA 2R0QC 1Y6RA 2ZZNA 1H2EA 4YV2A 5BOSA 4HWPA 4DIFA 2H07A 3AF6A 2R62A 4KE8A 5BSTA 4URHA 5ALVA 1XTVA 1WB9A 4TLDA 4EAAA 4B33A 2GCPA 4RAOA 3BVPA 1DDGA 1FDWA 1RR6A 2PUCA 2JF0A 3IEVA 2Y9MB 3JVDA 5KNDD 2VHVA 5B7PA 1D07A 3G2MA 3MNFA 3R3XA 2X1VA 2G70A 1YZHA 5B3JC 1MC1A 1PEYA 1IB0A 3AYXB 4EUFA 1VMDA 4C43A 2XMGA 3KE8A 4WCVA 3T8YA 1COWD 2XPCA 3FTNA 3GT4A 5A4KA 5DLYA 3W3AH 2Z5LA 3DW3X 1HFEL 5DB4A 3HXTA 1UWLA 2GF2A 1L6RA 1NXTA 1J56A 1XNGA 2B94A 4W82A 2CLOB 3D3EA 1CQJB 3AF1A 4QPZA 1W5EA 3CX4A 4DWVA 3UJ8A 4IJMA 4PF1A 4MCHA 1T2UA 1Q6YA 2QOEA 1E8DA 3B1VA 3OZCA 3VPGA 4Z7JA 2GI4A 1JEDA 4GBJA 2GZMA 3LOUA 4DJJA 1SHZA 4NYJQ 1YB4A 2HT6A 3DCNA 4X7RA 4CM1A 3FMOB 3UVEA 4BNJA 1CC1S 1NIJA 4Q82A 4Z2AA 3O7WA 1G3IA 1EX6A 4MKRA 2GRJA 2ECOA 3AILA 3FDFA 3MTAA 3SZRA 3PRYA 4YIHA 2JJ8A 1LQTA 1S96A 1GL3A 3FDXA 4C3UA 3MINA 3GG2A 3P2YA 5FQNA 4UATA 5DHQA 2VTBB 2IE0A 1QDUA 2Q50A 3ESQA 2E4ZA 3I2HA 3K09C 4FHEA 4OHPA 3SSAA 1RWXA 3QW2A 5CB4A 2CD9A 1ONBA 5IPFA 1GYRA 1GGHA 4MJ3A 1F9AA 1RBZA 4JIGA 2EX4A 5AKYA 3K9BA 1J9GA 3WO0A 2X1HA 3VO8A 1F38A 4KSBA 4OQEA 2TMYA 2ZJ7A 3NGMA 1HZZA 2D2XA 4IZ6A 2NW6A 1FZQA 4ARAA 4BKOA 1WPGA 1JQ3A 1J24A 2X9QA 1I14A 4PNHA 4BDSA 4XA8A 2J4FA 2AN4A 3SQWA 2GVNA 1QQ7A 1N32B 4CNQA 2L0XA 3I73A 4QYMA 1E79D 1TMYA 5J2UB 1V9LA 2C8JA 3A11A 3E3NA 4TL7A 1UQUA 4HYYA 3ST7A 2NUPA 1PL0A 2VWPA 5EXXA 2Q7OE 3ITNA 2ODPA 1E6KA 1JU3A 2B83A 3DG9A 3HCBA 3MBOA 2NZVG 1BHSA 2FP3A 2CYAA 2VFAA 4J0EA 1O2DA 4EHFA 2QHXA 5K6AC 1J8FA 2JBWA 3F0TA 4O4JA 3IVXA 4G2NA 1OA1A 3VR4A 3AR3A 1DG9A 3F78A 3L0ZA 4TMFA 3H5IA 1E4EA 3NNNA 2OO5A 4TV8A 4UMFA 2Y99A 4JR2A 5IDVA 4AW9A 5C8XA 1H4SA 1RWNA 3CLUD 2QVYX 1GU7A 2I22A 2QP9X 5F4BA 5I45A 3VNQA 3RYTC 3TGLA 2UXBB 3LRTA 4JQYA 1T0IA 3KEGA 3LQFA 2P1DA 4OYHA 3OMXA 3U61B 4MVJH 4Q9JA 2Z5VA 3L84A 2ZI3A 4I1UA 4L2IA 3DPUA 4PHHA 3LCVB 2JI4A 1XCLA 3HV2A 2A0UA 4R01A 5EE5B 5IN5A 5FWAA 1P0QA 2DUNA 3AM4A 3DOOA 2MYTA 1N2JA 1G0NA 3SC6A 5JFGA 3LPLA 1ADJA 3ORFA 1UFRA 1DUIA 1G98A 1A7UA 1QH0A 1G4HA 1ESEA 3PDIA 3H5OA 1O97D 1JPVA 3SEAA 2HA3A 2WIJA 1PTJA 3N2LA 1MAHA 2D0PB 3OSZA 2YWHA 4G23A 4RGBA 5GZ6A 3VDMA 4AKEA 1RLJA 4YRDA 3ETLA 1T9ZA 1MGPA 3RE1A 5JAIA 3FHCB 4WVLA 5FUXA 3O92A 4GXTA 1M1UA 5B3JA 2G9NA 2VQFB 4RA6A 4AO6A 2E6UX 3UJBA 3T4XA 3B78A 2QZ4A 4W6QA 1I0ZA 5E95A 1I94B 5KPDA 2BH2A 3PQ7A 3AM3A 1HKUA 3HDYA 3GH3A 2Q9UA 3L3BA 1WF3A 2ZWMA 1NURA 4I8XA 5CT8A 1W7AA 5F52A 2X7XA 1JU9A 3DXFA 4CPDA 4TLBA 2PFGA 3AVOA 1N7IA 4Q24A 4F6LA 4EJMA 3HPRA 2HCRA 1BGXT 2V6FA 1CUIA 3QPBA 4ZEXA 3SF8B 4CEIA 1BKYA 2P2DA 4OMFG 3GUHA 2YVQA 3KT8A 4EPRA 4EVIA 1MZVA 3FRIA 4G86A 1XD2A 2E4XA 4U6SA 4ERXA 4ZWNA 1U0JA 1GNTA 1M34A 3ZE8A 2ZBDA 1ILEA 2B4YA 2DWCA 1OILA 4BPBA 2BZ0A 4MUNA 4O5AA 2NLOA 1E9EA 1R4MA 2NSLA 3DAPA 2RH5A 2AG5A 4CRWB 2GM9A 4D46A 2CLSA 2AI1A 3CJTA 2YNMA 4UULA 3ILHA 1SB9A 1IHYA 3P9RA 2WIDA 4ZU6X 2XUHA 4V2IA 1BEEA 4DGSA 3VHRA 4F5DA 2O3TA 2W48A 3RBAA 4GZLA 1P0FA 5ALQA 4OFZA 5BOVA 3UJPA 1ZAYA 3P9IA 1QMPA 2FWRA 4R6WA 4XGIA 5DPMA 1W5TA 3ZEIA 2OMEA 1NP7A 3H1PA 3OEEA 4YJ2B 4CEHB 2AQHA 4JI2B 1E4OA 3O8OA 4RDIA 2WUVA 3OLWA 2ANBA 1HWYA 1ZIDA 3HADA 3QJGA 5AKJA 4BFVA 4DSTA 4OI4A 5K0EA 3EDQA 4LRYA 3BK1A 2E2WA 3KXDA 4E3ZA 1AHIA 4ZHQA 3WC4A 4C78A 1O97C 2PGNA 1Z3CA 2NVUB 4Q18A 5BQ5A 4LZJA 3GRUA 1I32A 3ZWVA 2VDPB 4Y1FA 3T7JA 5LZ4A 1E18A 5I48A 2XBMA 2B4TO 3GRKA 2PD6A 3DDWA 3PXCX 4LQ4A 4LF4B 3TOSA 1Z0IA 2CDRA 1L4BA 3N2KB 3M6MD 3RTCA 4MQLA 4DMCA 3S2UA 2ZCJA 1GAXA 4ER0A 2DY0A 1U9IC 2YQ4A 3U6KA 1YTUA 2L19A 4WAUA 4CT0A 3VGPA 4PZ0A 3WO1A 2EX1A 1U1CA 4EFMA 3SM9A 3CURA 3CNNA 3D2AA 1EINA 2WYWA 1QE3A 2F90A 3HJNA 1BKDR 3WHLA 1D9XA 1F4PA 2DAPA 3T4PA 2QRNA 4QSMA 3G9TA 1PZNA 1TM2A 3VZBA 2X8LA 4WBNB 1ACJA 4E2YA 1U9JA 4YCAA 5FOUA 1NUPA 5CDFE 4YLGA 1TZJA 5CX1B 2GN4A 5AW3A 4CCYA 1Y89A 3RAPR 1HNXB 2PUJA 3AEQA 3C6ZA 2AOTB 3MCTA 3MWYW 4H1TA 4NCNA 1AMNA 2ZSFA 3L7JA 3OSUA 4YT4A 3ZBQA 5A3QA 2V96A 2BGNA 3KKPA 1WCYA 3S5JA 4DA4A 1JAHA 4FU0A 4A2WA 3PSAA 4I1IA 3ZIUA 3PDIB 3PDUA 5B36A 3V4OA 3HVRA 3A1UA 4W8HA 3MGGA 4KO8A 3H2SA 2PS0A 1DXYA 5LBUA 3FDJA 4S3MA 3S4YA 2WICA 2J3MA 3B9BA 3HXMA 1OLXB 4JI3B 4B44A 5EZYF 2ADFA 1G21A 3TX6A 1XD8A 4B7AA 1JDPA 2WE8A 4L8LA 5K3SA 4UCWA 4L2IB 3V1YA 1M66A 2BIFA 3CEHA 5FR1A 4IG4A 3B36A 3ZXXA 1PV2A 1ZK1A 4RACA 5ITVA 3D8HA 3ELUA 1OOEA 2YMPA 3HGQA 4KH1A 5FWYB 1U5BA 2AE2A 3ZDXB 1I1HA 1AXEA 1D5WA 3GCXA 1PJTA 1SM4A 3VNBA 4R2LA 1DRKA 1EJ6A 2NXEA 3B5JA 1T25A 3FCYA 3H1EA 3MQ2A 4HDCA 3MCVA 4IS3A 4U7HA 3BSSA 4OREX 4U7FA 3KYCA 2PKCA 3SIXA 2II6A 3D2BA 4FFMA 3KD2A 5AK5A 3ZQUA 2ZRAA 4PLGA 2EYUA 3EIHA 3E35A 3PQEA 4MS4B 4ALLA 1RRFA 4EB6B 3E7DA 1WE2A 2P4SA 4I8IA 2YWBA 4Q9NA 5DCUA 1ENPA 2I03A 3WHPA 1XTKA 2AYYA 4LHZA 4F56A 2JRLA 1JB9A 3JQRA 3AUFA 4JROA 1K2WA 1I1OA 1F60A 1NJ6A 4HCJA 4P86A 3RC3A 4BPRA 4ZFNA 4CETA 5JJBA 3LWZA 4RD4A 2PN1A 4A91A 4XB2A 4GRDA 1B6RA 5DGCA 1WAMA 1XMIA 1Z4NA 3P52A 3BGIA 3CWCA 2NIPA 3RIXA 2Y67A 5BMOA 3D8SA 5DYYA 2Z6QA 1JYFA 3M6XA 1A97A 1RHQA 2WU3A 3NORA 4G81A 3RFFA 3OIYA 3D9QX 2JD0A 3WDLA 3AI1A 1YMVA 4CL3A 5DVZA 3DEZA 2CJYA 4OHRA 5EIXA 2WYUA 1JVSA 4MR8A 2L82A 3RUDA 3NHYA 4F46A 1KHHA 5CFMA 2FUG1 2AFVA 1BRMA 4NNOA 1KC3A 5F3RA 2Q6IA 4HV4A 3QQ5A 1ZJZA 3BIJA 2XB8A 4PTLA 2EV9A 4KQ6A 1AM4D 5TX7A 1G8AA 3D6HA 3WLRA 4B0PA 3QXXA 3SI7A 1XTTA 2ZSDA 3NFRA 4WKGA 4CTMA 3S28A 2ZRDA 3ELYA 3JPWA 1N78A 2KPOA 1GA1A 3KEMA 4DCOA 4QOIA 2JVKA 1S2OA 1K5GA 4LYYA 3W5AA 1REQA 1YS1X 4H6XA 4RTSA 2NYRA 4L4UA 5CB4F 2GD1O 2R44A 3U80A 4TTRA 2HMAA 5DHUA 1XMOB 1RAHA 1N7JA 5I4CA 4EH1A 4K2HA 1FC0A 5C3MA 4RS3A 3FN4A 1ZUD1 3MM4A 1UC9A 4LYEA 4XVCA 3EIEA 1M54A 3BSYA 2R97A 3NMUF 3GLIB 4QJ5A 1FJ2A 4EI8A 1K6XA 2CXTA 5E2IA 4RF5A 1M2HA 1K88A 2HFJA 4LPSA 4OL9A 4JL6A 4ILEA 2I4OA 3DVAA 3EVGA 5C31A 4BQFA 3ABRB 4PC6A 4R54A 3IXMA 3H65A 3GOQA 4MAMA 3ZCUA 2EBFX 1H2BA 3NCHA 1ONPA 4G0ZA 4CV0A 1P1BA 4J7UA 2C07A 2AZDA 3CVVA 1OX6A 2G80A 4LVOA 4M0PA 3WKEA 3ESZA 4P9NA 4MVJE 4LHWA 2JJQA 2A8YA 2VJKA 4PVCA 4CLXA 2WNSA 4JH0A 1NUTA 1XOIA 3R4CA 1YQTA 2XE7A 2FSVC 3NJRA 4N18A 3ZU4A 4GMHA 4BX3A 4H3SA 1FP4B 2QD5A 2XUDA 1NQVA 1I5RA 1YZGA 2AF4C 4N5NA 2WHPB 4JVOA 2A5FA 4TMYA 5FV4A 3AVWA 2OAGA 3M2PA 4YP1A 4FSHA 1ADGA 1PL6A 3NWEA 1OC4A 2O0MA 3H2JA 2BHTA 3IP9A 4L5JA 5EWJA 3P4XA 1W59A 4IBOA 2WM3A 5KNDH 1AGPA 4F4HA 4YRJA 4LA4A 1FTNA 1CJSA 2XDQA 4FJ0A 2XI4A 1B2LA 3HU1A 3LUPA 3TLYA 1QIFA 5BPHA 2QTZA 3COSA 3PGKA 4HQFA 4D45A 3DCIA 5IJZA 3VSDA 2J1LA 5IABA 2AG6A 2FZLA 4DTCA 1SD5A 1OZAA 2HLPA 2X7JA 5C3UA 5LP6C 3A1VA 3A10A 4PO8A 1PYDA 1T6NA 1J2RA 1GUYA 4F9GA 5DGDA 1KAQA 1YI8A 2HA2A 1ODJA 2C2YA 5A2GA 4KN9S 5TJHA 1MD9A 3W5CA 4E5KA 3KE9A 1B14A 3AFGA 3JD2A 1G8KA 3KDSE 2XGGA 4P22A 1APBA 3T3NA 1FZTA 1KPGA 4QDJA 5LQCA 2X14A 1N0IA 2AL7A 3T15A 3V7YA 3V6MA 3TI9A 2D3TA 1PZGA 3RIYA 1VP3A 5KU1A 1PE0A 2NO7A 3C1TA 4J0GA 3THWA 1SD1A 1LJUA 2D8MA 2ECFA 3JZMA 2QQFA 3EN0A 3KB8A 3KSZO 3R1IA 4HLQB 2IHYA 1W36D 1T3ZA 3ONVA 3H7IA 4POAA 4PZDA 1NBMA 4X54A 4RKQA 2WT4A 2G3YA 4HNHA 3RAEC 1C0EA 2QTVB 5AHKA 1XZFA 3MRTA 2DPYA 1JPJA 4N3GA 1PNVA 3STTA 1SZDA 3V7FA 1USIA 2IP4A 5ES4B 5LFAA 3T95A 3ZXUB 4PQEA 4MR9B 4XOUA 3ZGNA 4WKOA 2GBLC 2V97A 3AI2A 4KWTA 2JAOA 3C1OA 4TWIA 4C22A 3GDWA 5DNWA 4WA7A 1FTYA 1QIKA 4OXXA 3CFYA 3HXPA 1I5EA 3INTA 5CVDA 2Q9BA 4CF4A 5LPNA 2DBQA 4OU5A 3J7AC 2BFBB 3RFCA 1E0KA 3ZQJA 3AR6A 1VJRA 4QECA 1BMFA 4FYPA 4D4JA 4DR2B 3E8XA 1Z8FA 2J5BA 1CEYA 1SCAA 3G0OA 3D1LA 5IAOA 2O19A 3A2KA 3PFGA 2IL1A 4JI4B 1QHFA 1ZH8A 2DBRA 2G40A 2HSDA 3KKOA 4MR9A 3RYCA 2IH2A 1WZ2A 4QOJA 1N2OA 1CY2A 4W5OA 1QF6A 1X1EA 1U8UA 2FMTA 1EDDA 2CXNA 1VL0A 2I54A 4HMOA 1I6KA 4CCWA 3SVLA 1CS0B 1KEVA 1DJNA 3OZWA 4NEGA 3HFJA 4CV2A 3RT9A 4B3HA 2IS4A 2Q1SA 1FXWF 1HT2E 1JG3A 1L8OA 4L4ZA 4UPDA 3EPKA 1WXHA 4MHSA 4JYZA 2CK3D 1UKZA 5CVEA 4X6LA 3L43A 1Z17A 3G6WA 2XCLA 4BNNA 2RG7A 3EXHC 4MTCA 5CYOA 2IV7A 4ZYTA 1T29A 2CCJA 4GM0A 3P2IA 4KYUA 3WBFA 1BWQA 1ZGZA 1MH1A 5EIFA 4JEHA 2OUIA 2QZZA 3B52X 2CB0A 4HWRA 5FQOA 1G7TA 1J5PA 2CFRA 2CDCA 3UJ3X 1WP4A 3CZ5A 3EXIA 3M3DA 1W0CA 2XH8A 3LI2A 5HRAA 1DV2A 3ZI7A 4DLYA 4JP8A 4E1AA 1TZ2A 3PZRA 2PANA 3OIUA 3IHTA 3DLAA 5LXTA 1BQ4A 1YQUA 2IZ6A 3PSHA 3NATA 3EXFA 2IYVA 2P77A 1AGNA 5AM0A 3I01M 4LDNA 1Z82A 3IL2A 1W1WA 2H4ZA 1IUPA 1JHPA 4I66A 2XQKA 3OF2A 4P3YA 1II0A 2R8RA 1US8A 4L72A 4H27A 3K94A 4BE7B 1G3RA 2Z95A 2Z2JA 5IZCA 2ID9A 3ITDA 2PMCA 3IMFA 4LUCA 3VR4D 4MGIR 4C0QC 2ASVA 1R6BX 1AZWA 3OZAA 1SBQA 5ARCA 3VKUA 1F0NA 1Z26A 1ML3A 3JQAB 2BKEA 1AXRA 1YJQA 2F9LA 5IDWA 2O20A 4DAEA 1LFDB 4XEHA 3A4TA 1CJMA 3PQ4A 4UBJA 4ALNA 1G8MA 2AMVA 3LTEA 3D8TA 3NRJA 1M2FA 2BR3A 3PNVA 2CUTA 4J90A 4KE9A 2D5BA 5IVIA 1IVSA 1RQGA 2WT9A 1T0UA 1A04A 1RJWA 3JVUA 5FI3A 4NXMB 2W93A 1L0BA 1A5ZA 3AESB 4G5OA 5ULLA 2P2NA 1C8BA 3WQRA 5C7OO 1U7PA 2GUGA 2PYDA 1MBZA 1L1EA 2XB4A 3K2EA 4KMOA 1E8MA 4CE6A 1PTJC 2AFIB 4IQFA 5KTTA 5F5NA 4RD6A 1JG7A 4HUQA 4J0HA 1NLMA 1NMEA 2NU9A 2VTEA 2H63A 4WESA 1SUPA 1O0BA 2XYRA 5LDGA 3GF4A 1MVLA 1YZYA 2D1YA 1KR2A 2XDQB 1C3LA 2ZIXB 3E05A 3NHPA 4I9HA 4KIGA 3FFAA 4NK4A 5E4TA 3RPEA 5CT6A 5JQGB 2I87A 1AQJA 3V32A 1FSFA 1CDEA 1V7CA 2QVXX 3HZHA 4HDAA 4WY5A 1BQEA 4CKWA 2JIZD 1MQ9A 1K8RA 3W5VA 4B3IA 1DBWA 2GR9A 1IOLA 4KDEA 2NYUA 2G72A 3IT2A 4J1TA 1C4OA 4RA9B 1GPKA 3THRA 2O2YA 4K1XA 3GFTA 2AVNA 3DOHA 2BUCA 5E0KB 3OQMA 1FP2A 2BEVB 2O1SA 4PZYA 4ZMSA 3RROA 4PAGA 3FTFA 2VH1A 4Y7CA 1MC5A 3DGEC 4DM3A 1IZ7A 2G9UA 3H83A 3OFKA 5KUTA 2C2OA 1OFTA 4OHVA 4UQLA 1R9GA 3T9FA 1EUCA 4HAWA 1NVKA 2APJA 3C3PA 1KAEA 4HB2A 4J2OA 3VJKA 3TNFA 3ZJYA 3K5PA 3L6BA 1XEXB 3R3VA 4KW7A 5C4MA 3PFNA 5K5EA 4O3MA 1Z0FA 4XYMA 4EPXA 4F4UA 4D9BA 1COWA 2W9XA 3H7AA 2QLBA 1IQ0A 1GLNA 2I2AA 4EA9A 2IWRA 3TL6A 3GHHA 1UMCA 1NJSA 4FE7A 4NU6A 5EMLA 1T36A 1P4GA 2Q5OA 5BV1A 2AOXA 4MQ5A 5DASA 2WJIA 2QI9C 2TMKA 2BZGA 1P1RA 1L6IA 1JG4A 2OC4A 5EKSA 1Y6JA 2WMYA 3RFTA 1VSVA 1H2YA 1SVSA 2WG1A 2PTHA 2Z3WA 4E15A 5CEJA 3O93A 3Q8LA 2P5SA 2PZMA 4HADA 3STHA 4CFSA 2IFTA 2YY7A 3VNUA 1KIFA 1FNBA 1RCFA 2WT8A 2XMCA 1GCGA 4BKMA 1I4OA 4GVLA 3T7RA 4F38A 2CFSA 1S2NA 1SCKA 1K66A 2CUKA 2F3TA 2O5VA 3UGKA 1Z3IX 4EZIA 1LU9A 2ZUBA 5JWOA 2JDID 3LXMA 3QRWA 3D0RA 3TUIC 4FFBA 2ZRIA 4RTRA 1CQWA 3WQQA 1LVGA 1FU4A 1J0EA 2B0JA 2GBLA 3WKAA 3AJRA 1SHKA 3WV5A 1HDEA 4ABYA 1W36B 2Y1EA 3SR4A 2WTNA 1KY2A 3PDCA 1H3FA 5FBLB 4R8SA 4QU8A 4RF4A 2MTBA 3O4GA 3DVQX 4LQLA 1MO6A 3PLNA 5U4XA 1R5JA 5H70A 1GCAA 4GECA 1DKUA 1E9BA 1KFEB 1BOFA 4BQRA 4BGEA 4Q7QA 1EX9A 4LRXA 2DEUA 4LJRA 1SBZA 2I99A 1LA2A 3GMIA 3NVDA 1ZM7A 2AJLI 5CAEB 4C7OA 5JVDA 3WL4A 4RADA 1PT5A 1B43A 4ARBA 4TL9A 3KHKA 3PQFA 1P5RA 3FGPA 1J6UA 3CLRC 3FNIA 4UBIA 4M8NE 3HKBA 4BGDA 2OGSA 1UPUA 2FXIA 1DFGA 2A1TR 2BMJA 2W2LD 3HDVA 1L3CA 3ANYB 2XB6A 3S70A 3IVGA 5IBPA 1VL2A 3PIIA 4ZVQA 1O1YA 3H16A 4LEIA 1ARZA 1EJ2A 1LBIA 2EEPA 3K0FB 1FCJA 4GICA 2GK7A 2MMGA 4Q9KA 2WP0A 3ICWA 1WX1A 3TE6A 2X23A 3TO5A 5KNBH 5BN4B 4YYZA 1FJGB 1Z7YA 3W7VA 2A3NA 1K4KA 5TS2A 4KAJA 1Q0UA 5JBNA 1YFLA 1YV9A 3WTBA 4X6YA 3AESA 2PS9A 3CF6R 1QM5A 4YFVA 3W2TA 1KZHA 5B4VA 1FFHA 2NSJA 5LN1A 1YFJA 5JAHA 1N6LA 5T64A 4AX4A 4X7PA 4B6OA 2ZJ2A 5MFPA 1Z7EA 2X4IA 1V47A 2D06A 1XDWA 4PSAA 2HPVA 3SN6A 4RY8A 1BS2A 3OHPA 1NXQA 4RSMA 5F2KA 3UXHA 5KSWB 3PFHA 2HK9A 5TC4A 3IAUA 3JYOA 1W0KA 3DM9B 2R6HA 1PSDA 2CNKA 4LWZA 1UOQA 4FDTA 1Y6GA 1S7CA 2PZFA 3WNCA 3W9BA 2CKMA 2FOIA 2NYVA 1ND6A 2GF9A 1ZZGA 4C9BA 2EZUA 3KVOA 3NHAA 1VB3A 3OQIA 5HQJA 4URXR 2PGOA 4Y2TA 3KYBA 3ZWXA 2XSZD 1O4VA 1VA4A 1V1JA 3VVMA 1G41A 2DUJA 1TEZA 2A7QA 2JS7A 4YUXA 1FBTA 1KZ6A 5B6IA 3HABA 2BFCB 1EXDA 4KREA 4DWJA 4PC1A 5JYEA 1HQKA 3M1AA 3EMDA 1T9AA 3MCZA 3PB3A 3B8HA 4QC2A 3RJ9A 3W3AD 1ZJJA 2O3UA 1Z4OA 4OQLA 2NVUA 2BUBA 2X3UA 3TAHA 1W88A 1YT5A 2ZT7A 4FNMA 5EHQA 2PXHA 3NXSA 4RHYA 3E7XA 2O8FB 4ZHQB 5ARDA 1BD3A 2VHXA 3EG9B 1XJ5A 1BWRA 3M49A 1VBMA 2ZIVB 5FLXA 1B6SA 1VKNA 4RLQA 3P9PA 1TF7A 1SZPA 4C06A 2J31A 1SEPA 1T9DA 1G7RA 2XDAA 3EB9A 3L8YA 3U5TA 2AEFA 3N3AC 4LOKA 3SHFA 4G0YA 2MOKA 4UASA 1TF5A 5JMPA 3PQCA 5EIBC 4XGKA 1K0UA 1U11A 2P79A 1EJ0A 5AT1A 4YO7A 3VM6A 1KO1A 2DSTA 2F64A 3HBJA 3I04M 1PFQA 3TG8A 2FRDC 4YGYA 4KPEC 4YR9A 1RPJA 3K1AB 1RRKA 2WQ7A 3BJZA 3RAJA 5K3BA 3G2OA 4L51A 3RYIA 3EJ6A 2D6FA 2RB5A 1I9CA 1OYVA 4CV3A 5GZ1A 4JLAA 3LFHA 2AMJA 4EJSA 4CQMD 4X91A 3EVZA 4MJXA 4L7VA 5I7VA 3FRJA 1XZ8A 2DHDA 4ZREA 4U8GA 4BJ1A 2CLEB 4TSKA 4AJEA 2X19A 4BUZA 3EPJA 4EUEA 5E3HA 5FEUA 4G4SO 2ZUTA 721PA 2PH5A 4RFLA 5AJZA 1SH7A 2H0QA 2QXUA 3QYAA 1YQ9A 2VC2B 1AUXA 5BV0A 3D6JA 3NHZA 5KTYA 2IUEA 1CIPA 3I6MA 5FUYA 1YQQA 1QF9A 4RHEA 1OBOA 2WD7A 3O8OB 4IDAA 1RU3A 4KV9A 5CFLA 1ZW6A 4IHJF 2WINI 4QTXA 1I4EB 5AXBA 1EFRA 1LSJA 1TT5B 4DCJA 1RPZA 1JSXA 1TK3A 2XUIA 1U6IA 4KNVA 2G4VA 4WACA 3LBFA 3ZWPA 3GR6A 1G21E 1K08A 3AG5A 4L78A 3ZZTA 4CU5A 4F4CA 3T41A 4UAJA 3M82A 5CDUA 4BVAA 3NTLA 5CLQA 1AKWA 4ZOLA 4WSOA 4Q1AA 1YJ8A 1W85B 1C8KA 2RJOA 3TFOA 5G53C 5IT0A 3PHCA 2LCIA 2JGLA 5HKKA 5E7MA 2L18A 4UUOA 1W44A 1OYOA 1JQAA 4GMXA 4FBMA 4RZUA 1NMSA 3Q8KA 2MYNA 3VHXA 3DMFA 1PT9A 4NPHA 4MVJD 3BERA 5JNRA 4DB2A 5HNKA 1EP1B 1I7LA 5AM3A 2WHYA 2X22A 1T26A 4ZCRA 3RSLA 4L8VA 2JLSA 3ZWQA 1KZ9A 1JDTA 3AK4A 2O23A 1J2JA 4GZ6A 1O6FA 1JTEA 2D59A 3DFUA 3G5LA 4CLOA 1XF9A 5D01A 3DXZA 5KREA 3QG1A 4Y0AA 3NUGA 2IF2A 4PLFA 4B6PA 3BXOA 4EMUA 4ERNA 4GL2A 3ZHRA 1BH2A 1QHSA 4TVSA 1QRDA 1M72A 3ACCA 4ZO8A 4ZIRA 3NV9A 1KHTA 3O3CA 3AP1A 4HAYA 3KKEA 3RU7A 2QX8A 1WG8A 2BJWA 3GDOA 3RRMA 1PUIA 2O8BA 3BFXA 3U6BA 1G7SA 1B8VA 3UMCA 5EWLB 1NUUA 3JCZA 4JEMA 4ZEVA 4A8PA 3R5KA 3FVTA 2W6ZA 2XV1A 1DKQA 1EBBA 3TM5A 2WF9A 1KYXA 3WGIA 1TQHA 2RHMA 3FPLA 4PG5A 2C83A 4NFYA 3MUFA 3L7AA 4IO1A 1NMQA 3ANNA 2JCSA 2W6IA 3FDZB 1M2VA 1QHGA 2VG8A 4Q48A 2RAVA 2NO6A 2VK4A 4FI3C 1C9KA 4PEVA 4ITUA 4KFRA 4RQAA 1NX9A 2NZ8A 3KEOA 5B7NA 1OWPA 5LP6A 3GLGE 4I3HA 2G5GX 1E96A 1E3DA 1JEAA 3N7AA 4MYUA 4HC4A 3C7DB 4F4JA 5K09A 3QE9Y 3QQPA 4FS8A 3W9YA 3LH5A 1JAXA 1G5RA 2FMUA 3P1JA 4MICA 2AKEA 5FPQA 4Z86A 3JQGA 1RWQA 4X64B 2G9VA 4IFTA 3TW4A 4M0DA 2K2WA 1GRCA 4JBYA 2FH5B 3CV3A 3G0HA 1H6DA 1SUWA 3D64A 1DCMA 4YQZA 3NWJA 5JR3A 2CVQA 1W87A 1IPHA 3QUBA 5CHEA 4B6RA 4QQNA 3MQ4A 4YIKA 2LE0A 1VL6A 2ORVA 1MTZA 3HY6A 4R8MA 5FD8A 4HH3C 5H83A 1ZZEA 2ZB3A 4D4LA 1GZVA 2PJZA 1UP7A 2C88A 4JP5A 3DYVA 4Z3DA 5IBRA 3RAFC 1T3SA 1RBYA 1OQAA 2XCUA 2ZRGA 2XBLA 4IHKA 5BQXA 5EQDA 4O33A 2H59A 4C0XA 1U3DA 4FW8A 3W9SA 3B3AA 4EWLA 4B1FA 4U7GA 4DBLC 1EWYA 1HY3A 2C4HA 4YAFA 3BIXA 4G1FA 3TW8B 3Q0IA 3PUHA 2QX4A 2LIPA 3D6NB 1NXSA 3KB6A 1QNFA 2PRZA 2VRCA 4XTCS 4AY3A 4JXJA 1VHTA 4NJOA 1P0CA 2FZVA 1HEYA 1P39A 5FOQA 1TYAE 1UODA 4MR7B 4MR8B 3Q5GA 1JR2A 1P2BA 3BAZA 1ONSA 3QU7A 3PPXA 5DLEA 1E3MA 3GLGB 3EIUA 1NN1A 1X7ZB 3SX0A 1U0GA 3N07A 1KAHA 3LVRE 5J4HA 3ZHSA 2AK3A 1DV1A 4KFCA 1G8GA 3IPAA 2D7JA 4OSEA 1B7GO 3H1TA 1IUKA 3ES9A 4Q03A 4J3FA 2JLYA 1K1EA 5FL7D 1IM5A 4OPMA 3WIBA 3RHFA 1JX6A 1L7RA 1P6UA 3L5KA 1TO2E 2BONA 3L04A 4JUAA 1L7MA 4Y9TA 2ADOA 3ZGYA 1FNNA 1X80B 4H4CA 3ZCRA 1V5FA 1H5NA 4EABA 2OHXA 1X2EA 4D02A 4UDXX 3QEBZ 3B20A 3ETDA 2E4UA 1EHIA 4DZZA 2Y0PA 1D6MA 3U9TA 1T2DA 4EY6A 3ZTWA 5AIBA 1EUZA 4OP3A 2FE4A 1U5CA 2YJ4A 4HYTA 1J5EB 5KDDA 4YMVA 3WL8A 4DSNA 4Q1FA 2O4UX 3KUKA 3RK1A 1FUUA 3G9UA 2ZUUA 2Y2VA 3NWOA 3EWIA 3PNPA 4J1NA 2HX1A 1OTHA 4KACA 2CUNA 4FBGA 4LHVA 4RM2A 3RIEA 2OBBA 2PA0A 2QY9A 4WOKA 5HYVA 1YS7A 2WWWA 3CRMA 4X3PA 5BSKA 1DKOA 3Q3JB 4DMFA 3CUEF 2G6TA 3KKNA 2HMWA 3ONWA 1MJHA 3WG9A 4ZCTA 5L7WA 3PEWA 4K9OA 4ZVOA 1YQXA 1P74A 1WOYA 1IOZA 4TLMB 2Q46A 2XRZA 3TQOA 2J5RA 1DPFA 1YVEI 2IGTA 3ZE9A 4CQLB 5IFKA 2HRQA 2RK4A 3HR7A 5I4KA 4HUQB 4TZ6A 3F73A 1IN6A 4NZZA 1DC4A 1WKBA 4G1VA 4Z9FA 3EXAA 3T7IA 2H8KA 4DN6A 3GRRA 3TRDA 4ES6A 4ROTA 1PV1A 1FFWA 2AZTA 1OU4A 2WNHA 4J1QA 1P2DA 2C97A 4JVNA 3FF1A 4PIVA 1D09A 4BNKA 2E89A 1G5QA 4K7JA 4TMVA 5DI3A 1EDOA 2D1TA 3DV9A 3GDHA 4RFSA 5AJXA 3FNQA 4H3KB 2G5CA 4NQZA 1HT3A 3ID6C 3ORSA 2VUUA 4P35A 1RXIA 1N6IA 3IO5A 4CCYB 2UUAB 3LG2A 2O2GA 1KTVA 1L4NA 4JU9A 2OO5C 4NV0A 1OWOA 4P4SB 3RF6A 4GGPA 1L5NA 2VZ9A 3H75A 3I6QA 4KDRA 4WLVA 3UZUA 1RRGA 5K6AA 2AJ8A 3E84A 3M6LA 2OQ2A 5CXXA 1KK0A 3VAAA 3PXDA 4JB0A 4CKCA 3PLAE 3WL3A 2IBTA 5M2QA 3ED5A 4US2R 3EMKA 3L0OA 1GQFA 1VSBA 1QG0A 4CTKA 2IEAA 5HF9A 2FUNB 1QH1A 4MV7A 5EUQB 4L3VA 2CXPA 4YDQA 4J7XA 1U2DC 1XZAA 1Y9DA 2VT7A 2VJAA 3SCZA 2HMVA 3AUXA 2P6PA 2O7VA 3EDRA 4ZI2A 1Z28A 1ORHA 4JB8A 1NZDA 4Y6RA 3JSAA 1MNQA 1JHYA 2UV8A 4WIAA 2ZIEA 1OIXA 4WN9B 1RZ3A 3QVGB 4DCPA 3KZ1E 4QSHA 4HJXA 3COVA 3AHHA 1ZC4A 4ZCLA 3I8OA 3FNHA 4JWTA 2KWIA 1NW6A 5A5EA 1CCWA 5B1DA 2A5LA 4DDHA 4U9UA 5C37A 4B3GA 1UM8A 1O96A 4ONEA 4O3FA 3JAWA 3R40A 2V98A 4C5AA 2IP2A 1XVAA 1X9IA 4OJTA 5DHRA 3AH8A 5REQA 4DV3B 2Z9BA 3GVPA 2XYPA 1BSVA 1IN8A 1STOA 1ESDA 2QY6A 3PPIA 4Y6GB 5AHXA 4HN9A 1AKNA 1UXIA 4LJ8A 5JSKA 3JQAD 4WY2A 4KFUA 5IAEA 1LUAA 2VHZA 2PUEA 5C8DA 5I8PA 1KQFA 3GAFA 3ND7A 4RYLA 1Z5UA 3CVUA 3OLCX 4JVSB 5EJ8A 4POOA 3GAZA 1TXGA 2WF7A 4FZ5A 4UJ3A 1X0XA 3LPCA 5F3DA 1Z5GA 3VDNB 2C3MA 1GXSA 1DINA 4JJZA 4FZVA 2FU5C 4BMCA 3HDJA 3L41A 4GFDA 3WDKA 1ICIA 2ZYRA 4ZQHA 2YBEA 4P38A 1O95A 3M5WA 1C2YA 1T0BA 2EEZA 2J0VA 1BW9B 4J49A 3HNPA 3C0KA 2JEOA 4BFLA 4YY3B 2VYCA 4AFNA 4EG3A 3RJMA 1NOJA 4ZTUB 1Z2EA 2Q6KA 1LBHA 3I2GA 3H3JA 4QULA 2C99A 4NBSA 3BJRA 3IT3A 1ZOIA 3PQ5A 2HU5A 5I01A 3QFTA 4EKIA 1TADA 4LV5B 1W0KD 2QTVA 3RSOA 4EITA 2ACEA 1PEDA 2R1VB 4P58A 3FCXA 5DK6A 1C1XA 3NDRA 3O4VA 4JUFA 4K9QA 4L50A 1XJCA 3AHDA 3MS7A 3O26A 4B09A 2DJIA 1L7BA 4PINA 3WIEA 1UR5A 3ZHCA 5AVVA 3AP2A 4EKDA 5CEEA 5AW0A 1KWKA 5FPYA 1XU4A 1KZ1A 2RHCA 4Z7QB 1QP0A 1YOVA 1C7EA 1YVDA 1M74A 4Y2JA 3I9NA 1JYSA 1DU4A 3NASA 4NHEA 4PSCA 2G7ZA 2J3JA 1E1CA 1G1AA 3CX8A 2V5VA 1QGUA 4R1QA 1AJEA 4H4DA 3RIMA 1FMLA 4DV5B 1P73A 3WL7A 3QU4A 4RE6A 2N1BA 4RD0A 3S1AA 2HL6A 4NCIA 5A9SB 3C2QA 2QL5A 2GEUA 3ER8A 1T5OA 2GA8A 1RYYA 2HO4A 3DFMA 4DV2B 2HUPA 2Z4SA 1U7OA 1ES9A 2ZTSA 3D7RA 5E1OA 2X1MA 3WYFA 4D6XA 4ZT3A 2QB5A 3KCNA 4BC1A 1M0EA 1EKXA 1KSGA 3MB5A 5SICE 4DIEA 5IMSA 4W7HA 3IRUA 1XLWA 4NL4H 5ALYA 3JS5A 3LYLA 4RX1A 3CLUC 1OYYA 5C4IA 4XWWA 4D25A 5AVOA 2DWUA 1P7ZA 1GTRA 3CG0A 1G3UA 1PI3A 3ASVA 4IIUA 3A37A 1HL7A 5CVCA 3AHCA 3GPCA 2NZXA 1Y9AA 1DPGA 2JGIA 2EFJA 3KKMA 4RDXA 3CXUA 1V8OA 3UG7A 3OFJA 2IEZA 4OQFA 2XA2A 4UFNA 3NAQA 4Q4LA 5H5JA 5JWRA 5D00A 3S81A 3DF9A 4O1IA 3COJA 2JKVA 1JQEA 2QTAA 5H8WA 1JWLA 5TF4A 4FLMA 4LXYA 3BILA 3VU3A 2I5PO 3C5VA 2VPIA 4QO8A 1NZFA 3K2IA 4P81A 5J63A 4BECA 2BM1A 3N76A 1BHQ1 3E53A 1ZOSA 3K8YA 3NW9A 1FFBA 5ALFA 4G9GA 3GJRA 3MYRA 1XT6A 4UM5A 5LMUB 3HTXA 5BR7A 2B5WA 3CWQA 1XN4A 3D7LA 1MNAA 2W2OA 4PQGA 4Q4AB 5T4BA 3SHVA 4F2HA 2XCTB 4KPUA 4C07A 2O8CA 2NNWB 4CQJA 5JT1A 2JLAA 3W90A 2Q99A 1VGQA 3KOYA 4WLFA 3D43A 5MGBA 3CR3C 1FMTA 4ZAXA 3DTTA 4UUMA 1KJJA 4KO4S 3WHKA 3T38A 2WVJA 4QJIA 4E46A 1KXZA 2P78A 4NJMA 4TTQA 2ALJA 4ZOBA 3UUFA 3X2FA 2OR3A 1Q3TA 3SKYA 1F2TA 4Y2GA 1L4YA 3QIVA 2YOGA 1EM8A 4H31A 2FPPB 1E69A 1UBGA 2Z8ZA 2I8CA 3ODGA 4IIDA 1P5HA 2QUZA 1E1RA 2W58A 2YC4C 3P5SA 1R6TA 3C7KA 1R18A 3HMQA 1KDVA 3KELA 2V03A 3L8DA 3ONNA 3AG6A 4ZV4A 4HDQB 1JF8A 1T13A 3HA7A 3YASA 4KXUA 5L3QA 4QDZA 4INAA 2XCIA 3ROFA 1RCTE 1YUBA 3H5TA 5LQRA 2RH4A 1I2CA 5L6MB 1MAUA 1UDAA 1UT8A 3LK6A 4YRPA 1MU0A 1PUXA 3TPZA 1D2HA 4WZBA 2CNWA 4ZAGA 1RHMA 2WKWA 4JT8A 1P3JA 4ALIA 5KKCA 2QV0A 4LF8B 3CRW1 2WWFA 1U81A 2ZTHA 4YECA 1JZSA 5HK9A 1CEEA 2W2LA 4F3KA 1NRXA 1QHHB 3OE7D 2QRZA 1AKUA 2W2KA 2K2QB 5K05A 1KAGA 3PG5A 4Q39A 1EBUA 3LJKA 4BP9A 1QYIA 1KGDA 4KRGA 5CP8A 4YRZA 4IRMA 2BYTA 4PPGA 1P45A 3IP8A 5HCNA 1NYLA 5U4QA 3KHSA 1GO2A 3UM9A 4PN7A 5FNVF 1NQ5A 1BX0A 5M7EA 4A9AA 1CSEE 1ORRA 1R0YA 1U9YA 3SSMA 5CYPA 1SOMA 4F3TA 2F59A 4A92A 3P2MA 4BZXA 3VV3A 1DIRA 2A9KA 2AW3A 4KOEC 5AKLA 1BMTA 3LCRA 2H06A 4CU2A 3P4UA 2RGDA 4FC7A 2RHDA 4X9XA 3L7IA 1PK7A 1B42A 2E4YA 3P26A 3LCCA 1USWA 2ZUSA 2WJJA 2Q28A 3ZLTA 4I4TA 3BDVA 2WSIA 1T9CA 3INGA 3ONFA 3QV2A 3T9AA 2AC2A 1S9HA 1SVKA 3EOBI 4JR0A 4QPDA 4QXOA 3NX4A 2X0EA 2K5UA 3RJZA 4CKBB 5CJJA 4YXWA 2R00A 2P9HA 3MCUA 5LB2A 1FB5A 3A1EA 1CUFA 1XA3A 3PRHA 2NVOA 2P2LA 3EE6A 5GZ3A 3L0SA 2WPDD 4Q21A 4DPMA 4PHGA 4LZAA 2JHCA 1Q17A 1ABEA 3IQWA 3GBPA 2QT0A 2X4GA 5AHRA 4KWEA 3LPAA 3BMOA 2F1JA 4L9RA 3GN1A 4M1QA 2JHFA 3PD1A 4KXYA 4A10A 1P81A 1TA9A 2OE2A 3IRVA 1YBVA 3U7JA 4P4LA 1DC7A 2O2JA 1QG2A 5ESXA 4QD3A 3VOTA 1HDYA 3GMSA 2C0CA 1ZIXA 3KR1A 4Q4AA 2OHOA 3UK1A 4X1KA 2I6GA 3SQLA 1Z5OA 3GXOA 3G8BA 5E7QA 3W6NA 4AJPA 4CIAA 5HIKA 2CDAA 4KPYA 2P1RA 2EFGA 2HFKA 3AEUA 3MOIA 4KG7A 2IYPA 3GLFE 3BFJA 2JGJA 1C4WA 2C9ZA 4RL4A 1OVMA 3LX5A 3OZXA 2H5EA 3DT9A 2R66A 3PPYA 1P9RA 1DQSA 4OUDA 4UU8A 4OH7A 4RTQA 1Y3HA 3H9EO 1GUAA 2JFPA 2EOAA 1MOSA 4BO0A 4RD2A 4AKHA 1MW9X 3QVWA 3LC1O 4IV8A 4ZYWA 2IHVA 3DO8A 4LTDA 3AEKB 4MIYA 1XKXA 2HZBA 2XTMA 5EINA 1VRVA 3RW9A 3WGZA 2BZSA 1QHIA 4WZZA 3IAEA 3RB8A 4YX9A 4K6HA 3TXAA 5J43A 2HH9A 3RUHA 5M34A 4DLKA 2UZ4A 3ZZUA 3U7EB 3UMFA 1ZA1A 3EA4A 2UYHA 4NDZA 3VH4A 3WYAA 3WLOA 1P0PA 1SVLA 5DHTA 4LVCA 2N42A 2O59A 2FWJA 3AR2A 2P8SA 2Q7DA 4OG2A 4BX8A 2PPVA 3GL9A 5JD4A 1CUVA 4P98A 1OSNA 1YVRA 2P9BA 3BMNB 3B9RA 3TZHA 3HYLA 2GEDA 3N74A 1YCHA 4B0OA 1SXIA 3NHUA 1YOBA 2VYQA 3I52A 4Z49A 1UK6A 4PLCA 3ITEA 4KQWA 3KWFA 5AJWA 2C94A 3UJCA 3UFBA 4V0ME 5H3LA 1L9XA 3BWVA 3V4LA 3T5DA 2H51A 2CNLA 4OHMA 2R96A 1NW3A 2GN2A 3QA9A 2REQB 3WL6A 3NXKA 3GGJA 4Z1OA 3QSYA 3DOUA 2JFBA 2J4DA 3O2JA 1GZUA 1AQNA 2BGWA 1YU6A 2ACKA 3PICA 3P0IA 1ZJ6A 1ZPDA 5L95A 3L7CA 1IWPB 4WNAB 1DC5A 4X20B 1NBWB 1PAUA 1IE3A 4E31A 4DR7B 5FUBA 2ZRLA 3CE9A 3ZDZB 3A6LA 1UWCA 4X7BA 1QE5A 5JH7A 1K68A 3GLRA 1XB2A 2IYOA 1IRIA 3WLFA 3ZDAA 3AVQA 3LKVA 4ZU3A 1VG1A 3EIQA 3ZWAA 3VJLA 1LRLA 3VYVA 5U1PA 3VKFA 4AJ1A 1JDNA 3G79A 3IUMA 1QG6A 3FCEA 3CVYA 1N9ZA 2Y66A 3A1TA 5G41A 2ZCUA 3IHKA 4LF6B 4QQRA 3C3KA 2A1IA 4GPIB 4NBNA 1X7HA 5THXA 4CUZA 2X9NA 3LYAA 3O21A 4Q15A 2OXCA 4J9VA 4WXPA 1RQNA 3HJTA 1MQSA 4R40A 4EW3A 4Q9LA 4RC9A 4IINA 2CXOA 4MQUA 3MJ4A 5UKDA 1LPAB 3HB4X 3DZGA 4IXMA 2H11A 2Z6AA 2GASA 4NG5A 4MGZR 4DRZA 1S3IA 1UKAA 1GT6A 5AK4A 5GINE 1ZEMA 4F21A 2O2XA 1AT1A 3NRCA 4D43A 4IDQA 4QU5A 2ZT6A 4W4TA 1EFVB 2ZSJA 3D59A 3DE4X 2JAPA 3RNLA 1XD2B 2FZKA 2GJ9A 5DK4A 1QVRA 3RBVA 1Z5VA 3IFSA 3G8CA 4MP6A 1XU7A 2W90A 1WMSA 1OAAA 3W7BA 4GMFA 5JO0A 4OA8A 4F6RB 4X92A 4GDFA 4TTPA 1U2GA 4TXHA 4HVCA 3GEDA 5L4LA 2CEKA 4B8YA 1QYWA 1T6BY 3SZ3A 5ALZA 1TZBA 1K8QA 4I55A 5DP2A 5F33A 3AONB 1WLSA 3HZRA 2A84A 1JLLB 2YS6A 5DU2A 2D1QA 2BEWB 1TAQA 4N0DA 4Q7EA 1WM1A 1DJOA 3NNDA 3COYA 5FFNA 1NSFA 1SIBE 1W88B 5DW3A 4ER6A 1WL8A 4CFYA 2IEGA 1MG5A 2F00A 3IPRA 1MV8A 2OWEA 4O1MA 1DG3A 2Q2WA 3A2NA 3EF3A 1C9NA 1YR8A 4B87A 1RJDA 1Z06A 3K8QA 1M1ZA 1JNXX 3QFRA 4DQKA 4GAEA 1RM3A 4ITRC 1JN0A 5A7FA 3DMHA 3TS1A 5IDXA 3WISA 4TXMA 2E4VA 3CNBA 1M2KA 1PHPA 5EZ6B 4GPAA 4X3OA 1U28A 4Q6WA 5A62A 4MDEA 5AXDA 5CHYA 1TFRA 4HP8A 2B4AA 4RZ3A 4OATA 1A1SA 5F7XA 1N2XA 4AKSA 3I9OA 1BX3A 1MF7A 1WWKA 2ODBA 3QFCA 3LYUA 4O2BB 1I01A 4YV7A 2WHRA 1RXVA 3T52A 4F1WA 2JH3A 3UMGA 4H35A 4KDFA 4UNPA 1VPWA 1P7PA 4I1RA 3X2EA 1XAGA 2B3TA 4OQXA 1NNSA 5BWCA 1IHOA 3THSA 1A2KC 4PSVA 4HXEB 4AO8A 5B58C 1VCOA 3ZQ4A 1W4AA 4UTRA 5P8WA 1QQAA 3GRCA 3OEWA 3QG5A 5ALJA 5M5BA 3QHAA 1RWWA 4WFIA 8ATCA 2VSFA 1GITA 4OFBA 1O89A 1RQLA 2P9QA 2A9QA 4XQEA 3THOA 1CJKC 4MIKA 3FLBA 3RS7A 3U3ZA 5B12A 5J23A 1PS9A 3QUSA 1KZYC 1UPAA 2HSJA 2X0FA 2FJ0A 3E22B 3CZCA 3DO6A 2JBAA 3GNTA 4R71A 5J58A 4D74A 4WEOA 2HIGA 3SP1A 4X1KB 4UW9A 2Q3EA 4GI7A 3PF8A 1E5LA 2PBRA 3H2BA 3BC1A 3EQ9A 3KVYA 1RNLA 3GGDA 3TNYA 5FYDA 1E4YA 2GM3A 3IQIX 3JQ8A 2B5OA 3HB9A 3OKAA 1FUEA 1LW7A 1XKLA 2B78A 3AB7A 3I53A 2DP4E 4AZ3B 2EKQA 3LQQA 1E1KA 5A3JA 1MT3A 1QDLB 2R6JA 2O9JA 3LBYA 3TEJA 2F1IA 1IPEA 4LPKA 2R6R1 2GERA 2H29A 2PM8A 4XI9A 5EHNA 5J4LA 5DLDA 1OZFA 1EAMA 2P5TB 1IYZA 1PGNA 1R4ZA 3TLGA 5I6DA 2PXXA 1J0CA 5BRJA 2EDCA 1Y3DE 3HB5X 5EP1A 2FJPA 2PA3A 3C3MA 3GJ0A 1H22A 1PFVA 2VYFA 4P82A 3U3OA 3EVEA 3BWXA 4MUFA 4YAJA 2A9VA 5KKNB 1W36C 3G5MA 5CVJA 3EC7A 4OU4A 4E0BA 3OWOA 2XNKA 4L5CA 4BLVA 1CT9A 1HL3A 4S1WA 4B9AA 1E2JA 1Z6QA 3EODA 3NC4A 4BLTA 5CA0F 1NRJB 2O7RA 4MWSA 1EM8B 4KQHA 2C5GA 4OM7A 2WF6A 1I30A 3OURA 3SXUA 4YRTA 3OIDA 3RVBA 2JAUA 3UAWA 1J20A 2HWYA 1XVVA 1Z29A 4A6XA 1V35A 3R5SA 3X1KA 3I45A 2V7BA 1K6MA 4ZQIA 3CZ4A 4M0MA 3G82C 2WC1A 1E7YA 4EG0A 1B93A 3KOMA 2FFRA 1G3MA 1ZMTA 1QFYA 5JE8A 3OO0A 4A0RA 2ZQYA 3BTVA 3L6UA 3FUUA 5IJ0A 1KFBB 1NUSA 4QRHA 1UJBA 4MYSA 5H81A 1D4OA 5EQFA 2JLWA 4J03A 3GCGA 1Y3CE 2OK7A 4YC7A 4JLVA 5IWAB 4B3SB 5AKKA 3G7SA 4DABA 1RS0A 2PO5A 2B82A 2WNIA 2FI1A 1LC0A 1XP8A 2D2EA 2Q1WA 2EFEB 3EUWA 1H69A 4PV7A 3U49A 4ZJPA 1QS0A 3IEIA 3NQ41 2LRHA 2ZSUA 2WLTA 4KXVA 3VI3B 2C92A 5DDIP 4ZCQA 4IH4A 1C41A 3NT4A 2C8VA 2OGTA 1JI3A 3BQ9A 1EWTA 5MN5A 3FFBA 1NPDA 3HCFA 4D3FA 3T5CA 3H1BA 5KOIA 2JD2A 4QFDA 5GJBA 1OI3A 2ID7A 4H6VA 1IUNA 3K4PA 4JHLA 5TDHA 4CUJA 1OWMA 4TYPA 1XPJA 1ZW1A 2DJ5A 2VDRB 1CZOA 3DAYA 4NZOA 1UJ5A 1WEHA 1LSOA 1ZKMA 1ZLXA 3QTTA 4RK0A 3SDBA 4BFZA 4F9EA 3PGVA 3H5AA 4P54A 1P1HA 1R6UA 4TS3A 1T9GS 1Z2OX 3L4EA 5FL7A 5TMDA 3QLVA 821PA 2ZZKA 4LYJA 4OGKA 1QFZA 4LZOA 2UZ0A 4IH9A 2IXBA 3EPLA 1PR4A 5FNZA 5TMPA 1W4CA 3ND5A 4G4GA 1GYQA 4R7ZA 2GEVA 3ZZMA 2AJCA 1UBFA 2I6UA 3TEFA 3I9V6 3O0DA 3O9MA 2FNAA 1ST2A 2H18A 1U7UA 3QOWA 2UDPA 3R7WB 5KYXB 1JSRA 1ZUNA 2HEGA 5H59A 4EUKA 1FLDA 1WVIA 4P1ZA 3EHDA 2PBFA 4IHAA 3L6DA 4YEDA 1KO7A 2YJZA 1DZIA 3AERB 4RVHA 5CCDA 1FK8A 3ZHXA 3BD8A 1FDSA 1MG0A 4MP3A 2A5GA 1ZH0A 4HGQA 4EVRA 4OGFA 4Z6KA 1GZ3A 3H0EA 2D5IA 3TLKA 1KO5A 1E2BA 2XF2A 3NOQA 5BYKA 1NOKA 3CH6A 1ESCA 5ALXA 1VBKA 4LE1A 2ETXA 1D2CA 2VJNA 3PK0A 4L27A 4KJXA 4OYLA 2PMEA 5EJ5A 2A7XA 3W3AA 5AXAA 3AW8A 2EDAA 5HMMA 3R7FA 1SHUX 4NIMA 4IO0A 1Z0SA 2HHAA 3EPRA 3T1QA 2P6RA 1ZJ5A 3GFQA 1T91A 2FMXA 2QYSA 1CUJA 1LPNA 4LCBA 1GUBA 4MDFA 4CM4A 1HT0A 4ZP1A 3VH1A 2X0RA 2FEKA 1JHQA 2RGYA 4HFNA 1ZBDA 4KHPB 3K0SA 3LQ1A 1KOJA 1L4KA 4CN9A 2HJHA 4EI2A 2WFLA 2OY0A 3N2ZB 3N7TA 3D54D 4K6GA 2EJVA 1DIAA 1HTTA 1ZJ4A 2LDBA 3O03A 5F9FA 4WCDA 4HGOA 1JA9A 4DZRA 4B76A 1A4RA 3I5YA 1XJ0A 2HIAA 2JGKA 3CU5A 4IQGA 4QIHA 5BV2P 1PRYA 3S2YA 1E3SA 2QKYA 3ORYA 3OZFA 4HRAA 4JZYA 2C2MA 1NE2A 1PR1A 1BXRB 2BCGY 2PSHA 2OZLA 4MULA 1CFJA 4UNNA 4OKSA 3IMKA 3INNA 3COPA 2J5XA 4L16A 4QRIA 2XTAA 3IHLA 5DM2A 1EDZA 1H3EA 1B41A 1X9GA 4WLEA 4NHOA 3DMRA 3N2EA 2LNDA 3IT0A 2Q5EA 1AKYA 1CZLA 3IA2A 3I9MA 2HLNA 2QEQA 4MUBA 4PLYA 5AQEA 1IBCA 4HPWA 3WIUA 4BKRA 4K0KB 3H5NA 4I6EA 4ARVA 1P7YA 1ZVQA 1AGRA 4BP3A 2FQ1A 3EMBA 3LF1A 4G4JA 4J4HA 5EP2A 2WVGA 5KIAA 3GFBA 2G0NA 1PFGA 1XHFA 4BMOB 3B1YA 3X1ZA 5JCPA 3GA7A 1IG3A 3IV7A 2YOFA 4PFSA 5KC9A 3JWIA 2HV9A 4RWEA 3KPJA 3RU3A 3T7CA 2W8ZA 1KJQA 2ZRFA 3BE5A 4IXDA 1X74A 4LRTB 1F7VA 2NU6A 5HIAA 2WUWE 2OXEA 4BO9A 1Z6AA 3H8JA 3BH0A 4WXYB 2G1JA 2YWRA 2IYXA 3HFSA 4RY9A 5CTJA 1W48A 1JLSA 3PUKA 5K7SA 1QV9A 2V65A 5I8ZA 4BS9A 3NHMA 3X44A 2VF7A 3D1JA 1YDWA 4MB6A 4MYHA 4R1UA 1SFRA 4BO3A 4MITA 2HI0A 5HX7A 2C3OA 4JUDX 1QF7A 2R8OA 4IIEA 3GK3A 1KFCB 1F0YA 4N6NA 4ZD6A 3EWSA 2AI3A 1C7IA 3PR1A 3CT6A 1YRBA 4MVJA 4TWAA 2KLHA 2PK3A 3UMSA 4ATNA 5JTUA 3K72B 4GH5A 3Q40A 3PHLA 1RE1A 5F2NA 4OLAA 1XMSA 2C2BA 5EE3A 4OX9B 3PXAA 5EFZA 3CUVA 2XE6A 1R0RE 3KKKA 4ID9A 4KQGA 5F1PA 1VKHA 2A2ZA 4P4GA 1E79A 2B8EA 5IXYA 5KOJB 3KWMA 4ALMA 5CYGA 4OJQA 4UMDA 2VQEB 3EG5A 3GG9A 1NHGA 3U4IA 1OD6A 3SGLA 1NR5A 3CCFA 5IJWA 2FP4A 1LGYA 1QGAA 4UBKA 1ULHA 2P6NA 4A3SA 2QJWA 3TTSA 3R3YA 3QVGA 3FD8A 3A1DA 4BAGA 4NONA 4CW7A 4DL9A 4LFAB 3ZK8A 3FNEA 4M1YA 2HQ1A 4XM0A 2AN5A 1J90A 2DHCA 3CXRA 3I09A 3AF0A 4MGKR 4UUBA 5CPFA 1DBSA 4Q3OA 1FXWA 3P4YA 3HCWA 5CLIA 1ZMXA 2ZKIA 2KW5A 1JQJC 2WJYA 13PKA 1K8XB 2CL5A 3CG4A 1VM6A 2J9GA 1Q84A 3PXUA 3QEJA 1MGOA 2ASEA 4YJGB 3R8XA 4LX8A 4Y1GA 3PFIA 2VUHB 2OHHA 3TLEA 1HOXA 3E1SA 1YU9A 2OTCA 3SMVA 1AGXA 2GM5A 2QD3A 1H4TA 4CQMA 3CIOA 3EFOA 2ERXA 1DKPA 3VI4B 3F96A 1X70A 4WZBE 2QMYA 1NLYA 2C8LA 4A5SA 1XZCA 5L8VA 2LUOA 4NSNA 2EWMA 3RVMA 2HPZA 2P35A 5IT9A 2DETA 1JHAA 2VZ0A 2FZCA 4UPVA 4YP9A 5KNCD 4UHCA 3RHSA 1SKUA 5AVUA 4D26A 2C3YA 3IP6A 1AZLA 2J9FB 4L95C 4PY2A 2QL6A 1LDYA 1KNXA 4ENSA 1BCRA 4Z4GA 4TUYA 1S3GA 2RGUA 4XZ3A 2H8GA 2RFLA 3DTYA 1EHCA 4HWTA 3WKDA 4CKEA 5EZQA 5CM2Z 2B7LA 2EJTA 121PA 1SEVA 4J7AA 1E6MA 3RQIA 5B1HA 4PAOA 1CQPA 1IUOA 2RGNA 1TM5E 4UVHA 4QHTA 3FZYA 1LB1B 1M0TA 4ZA2A 4NBTA 3ZV5A 2YDXA 1DQNA 2BI4A 3T9CA 3JQ9C 3SJBA 3OHMA 4OAOA 1VBFA 3AOEA 4IMJB 2FLWA 1RKVA 2Y6UA 1R0LA 3GQBA 3L4BA 5AM1A 1EGVB 2ZIWB 3CZMA 4ZOLF 1DQRA 3EEOA 2VCHA 1MHTA 7ADHA 2FZEA 3WS7A 3RKRA 2Q07A 3X43A 3F4LA 1FJHA 2AMFA 4FGWA 1GA4A 4M0KA 1P77A 4ER7A 4BO7A 1Y5NA 3F1KA 2W6JD 3RNOA 1Z2AA 3ZDRA 4BQNA 3ZWCA 3TZKA 4YAUA 2BE9A 3ISTA 5TGDA 2V7XA 3LAWA 4H16A 5HZHA 4G2TA 4NTZA 1USKA 2OM6A 4ZC1A 4XTRA 4P4NA 4UU7A 3GEIA 5EJ4A 3HDTA 3TINA 4NYMQ 4KVFA 3R75A 4OOEA 4URVR 1G8SA 1YZ3A 3ZDBA 3EGDB 3KUCA 4Q01A 4NU8X 3NC1C 2Q41A 3KZMA 4DDMA 4H1UA 4YCCA 4TQGA 4FB4A 1Q1AA 3UK2A 4CM8A 4DAOA 3OT5A 1H5UA 1RDFA 2D7CA 3TBKA 2QLJA 2RBKA 3Q7PA 4E2FA 1MMFB 2IPLA 4BQEA 3FGOA 4DMRA 5K03A 4D6PA 3D0OA 1TAUA 1B76A 3U3RA 4GL4A 2J0UB 2VZLA 5JPDA 1VPDA 1YKGA 4O0LA 4DCVA 1SCBA 1SUDA 1QP7A 5ALRA 3DUFA 3LOQA 5F35A 3RS5A 5IDQA 3A6FA 4P8RA 4WV3A 3EY9A 4HT3B 1R0SA 1UP4A 4CQMB 1THTA 1M2WA 2UVPB 1CE8B 4OMCA 5CNMA 3NH6A 1RACA 3PC8A 1Q1ZA