The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
65
|
sequence length |
205
|
structure length |
204
|
Chain Sequence |
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSRVKLAEHKIFPAALQLVASGTVQLGENGKICWVKEEHH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Biological and Structural Evaluation of 10R- and 10S-Methylthio-DDACTHF Reveals a New Role for Sulfur in Inhibition of Glycinamide Ribonucleotide Transformylase.
pubmed doi rcsb |
molecule tags |
Transferase/transferase inhibitor
|
source organism |
Homo sapiens
|
molecule keywords |
Trifunctional purine biosynthetic protein adenosine-3
|
total genus |
65
|
structure length |
204
|
sequence length |
205
|
ec nomenclature |
ec
2.1.2.2: Phosphoribosylglycinamide formyltransferase. |
pdb deposition date | 2012-04-26 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00551 | Formyl_trans_N | Formyl transferase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Formyl transferase, N-terminal domain |