4EW6A

Crystal structure of d-galactose-1-dehydrogenase protein from rhizobium etli
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
311
structure length
309
Chain Sequence
YFQSMSPINLAIVGVGKIVRDQHLPSIAKNANFKLVATASRHGTVEGVNSYTTIEAMLDAEPSIDAVSLCMPPQYRYEAAYKALVAGKHVFLEKPPGATLSEVADLEALANKQGASLFASWHSRYAPAVEAAKAFLASTTIKSVHVIWKEDVRHWHPNQDWIWQAGGLGVFDPGINALSIVTHILPRPVFITGAVLEFPENRDAPIAADIHFRDADGLPVHAEFDWRQTGKQSWDIVAETAAGQMVLSEGGAKLSIDGRLTEPEQEYPSLYRRFAEIIKAGKSDVDVAPLRHVADAFMLGKRKFVEAFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of D-galactose-1-dehydrogenase protein from Rhizobium etli
rcsb
source organism Rhizobium etli
molecule tags Oxidoreductase
molecule keywords D-galactose-1-dehydrogenase protein
total genus 89
structure length 309
sequence length 311
ec nomenclature ec 1.1.1.48: D-galactose 1-dehydrogenase.
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4ew6A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ew6A01
3JYNA 3KETA 3GFGA 4AJ2A 1PZGA 4IJVA 4AJKA 2Y1OA 4R1TA 4JROA 2G1UA 4LSMA 4BNKA 5MGBA 1WZIA 4BNWA 3WDSA 4PZCA 2BLLA 1UXHA 3JQDA 4D41A 5B4UA 3UXYA 4U0JA 5L51A 4WLVA 4PN3A 7MDHA 5HA5A 2O3TA 5U9CA 4IJKA 3QWAA 1PX0A 3VVCA 4A2CA 5FI5A 5L95A 4FQ8A 4WLEA 3HQ4O 4XWYA 3ZI0A 5IJZA 4UEOA 4IPTA 1BWSA 2P5YA 3LLSA 4CL3A 3FTNA 3ZV6A 4XR4A 3MOGA 1QG6A 2E6UX 4H3VA 1LSOA 2WD7A 1BVUA 2IEBA 4HNHA 4BO6A 1GUZA 4PLVA 1QR6A 1DJQA 3O26A 2J3IA 1RM5A 3NX4A 5U4QA 1E7MA 1T2DA 3PWZA 3SLKA 4AJIA 4YJHA 2YW9A 4YQZA 1EVIA 1IB6A 2OZPA 1K89A 4BGEA 4FFRA 3GQVA 3BTOA 5T64A 1P1JA 5BSGA 3AI3A 4FGWA 4N5NA 3KM0A 1VJTA 4U6QA 5KJ1A 2CUKA 5G0TA 1KY5A 1YGYA 1B3RA 4JCOA 1HYHA 4D45A 5GZ6A 1A9YA 2V6BA 1ZH8A 3WICA 1EUCA 3FD8A 3GK3A 2Q4EA 1QYCA 1DRWA 1LDMA 2PKQO 3INGA 1E3EA 3DBHB 3GN2A 5CDGA 1DFGA 1R4MB 2X23A 4QT0A 4R1NA 2QRKA 4NR0A 1PJLA 4ZRNA 4Q3EA 1TA4A 4AICA 1P45A 1OBFO 3GGOA 4JQCA 1UZNA 4U5QA 4ZRMA 1ZVMA 1FF9A 2HCTA 3JQ9A 1NAIA 4K6CA 4ID9A 3FHLA 4B7CA 1Q7GA 4DPLA 5BNIA 3IKVA 5B1YA 3AUUA 5IAAA 1SEVA 1X1EA 4M87A 2BGMA 2OOSA 1A7KA 5BNTA 1LLUA 2J6IA 1ZK1A 3HG7A 5CDYA 4YJHB 4OSPA 3INRA 1XCBA 3JQGB 1DSSG 3ZV4A 1MC5A 1KC3A 4GVLA 4D7AA 2PD4A 3TZKA 4ZGWA 3JQEA 2E49A 2JCYA 4AJPA 4MVJA 2O4UX 3ASUA 4IXTA 1Q7CA 3IQDB 1PQUA 4GKVA 2G82A 4MVJH 3ZWBA 4GMFA 1K6JA 3PDJA 3IUPA 5JAZA 2R00A 3CPSA 2DTXA 1RJWA 4RF3A 4Y6PA 3QRWA 4BV8A 4NZ9A 2IXBA 2PH5A 5KVVA 4R69A 3W4KA 1JQBA 1GZ3A 2NVBA 5TJ9A 2EP5A 3QJ5A 5EQFA 1FDTA 4IGEA 4KQXA 5HWSA 1H6BA 1E1MA 2I3AA 1JTVA 2PTGA 4DIBA 4CPDA 4UUMA 1G0NA 3GG9A 4OSOA 2DT5A 4DQXA 1VL0A 4YCAA 3QIVA 1LSUA 3GZNB 4NJOA 2EGHA 4YT5A 5TX7A 3RUIA 2VRCD 1N1EA 5JY1A 2A92A 3DFUA 2QYTA 5TT0A 4F3YA 1WP4A 5DP1A 3PYXA 3ON5A 2POQX 3W4JA 3DO5A 3TSCA 1DPGA 1N7HA 2PGJA 1PIWA 1BRMA 4LMRA 4R51A 1DHRA 5F1OA 5DT9A 1U3WA 5JAQA 2WE7A 1E0DA 2BH9A 1YONA 2I76A 5C7IO 4Z3DA 4BNTA 1BXKA 1LBEA 3D5QA 2VWPA 3RASA 4ZICA 1WMAA 1YH3A 4OXKA 3I3OA 3CSDA 5COAA 3RJ9A 2DVMA 2X1HA 2F1KA 4YR9A 5KWEA 1CQJA 4IMRA 5ER6A 1G0OA 5L40A 1NBOA 2C7GA 3DQPA 4MIOA 4E6PA 4XQEA 5ADHA 1WW8A 4NMHA 1T2EA 3R0IA 1VLLA 3A06A 4BIIA 1C0LA 3GY0A 4CMIB 3I23A 2WEKA 4ALNA 4BO7A 3H5AA 4XGKA 3IL2A 1NP3A 4HKTA 5B4VA 5JC8A 5IDWA 5L45A 4OIMA 4A5OA 3FSRA 1M2WA 2YV2A 3C3XA 1RPNA 4WCFC 1UZLA 3S2FA 3JD1A 3FN4A 1EMDA 2Y0DA 3NYWA 4G65A 1JDJA 4ZJUA 4YRBA 1P3DA 4JX8A 1HDYA 1GD1O 1A9ZA 1LRJA 2YJZA 4NG5A 5AXBA 2GLXA 1IOLA 1U4SA 1YQXA 2P91A 1SMKA 1WDKA 3UAGA 1FMCA 4IDFA 2W2LD 4YRDA 1VSVA 1NQTA 3VVBA 1AXGA 4ZQFA 3ZH2A 4O59O 4YJFA 2D4AA 3C7CB 3PP8A 3U4IA 4I5EA 4ILKA 4OKIA 4QO8A 4W7IA 1X7HA 3WWZA 1VSUA 1KS9A 3F5QA 3RFTA 1N7GA 1ZSVA 3PXXA 3COSA 1DC4A 4WLNA 1T1RA 1YRLA 3G49A 5CEFA 1QRRA 4FFLA 4D3FA 4B3HA 3D4OA 3TOXA 3DOJA 1IUKA 1UP6A 5CPBA 3WGTA 4BHTA 4GSKA 4TROA 3WGIA 4CMBA 1EFKA 5CG1A 4Y8VA 4CM9A 1X15A 5EESA 2O48X 2DBRA 2J3JA 2EV9A 1MUUA 1LU9A 1T2AA 4B8WA 3EHEA 4EW6A 4GAEA 4QSMA 3ZHXA 3I1JA 4TWRA 5JLAA 1MXFA 4TRNA 4BNIA 1YJQA 2PFGA 2XPCA 3MJCA 4J0FA 5DZSA 4CMEA 5KJ6A 3BTVA 1R37A 3JQBC 5G4LA 1IYZA 4UAGA 4CV0A 3WGQA 1HWYA 2OBYA 3H9JA 4EEZA 3LVFO 4BO1A 2PGLA 4RVHA 3PGJA 4DBVO 3NTQA 5A03A 1F8FA 4BNLA 5AXAA 2CDCA 4ALMA 4BNNA 2I3GA 4GLLA 3T4XA 2YQ5A 4E2YA 2X58A 4BO0A 3CEAA 1Y1PA 1Z75A 1G1AA 2ZJ1A 1MG0A 1B26A 2D5AA 2GUGA 3OICA 4M86A 1NM5A 3RD5A 2O2SA 2BRUA 3O8QA 4XJSA 4RCVA 4WLOA 1X13A 3TOZA 4NIMA 2XXJA 3ZHZA 3PLRA 4YJGA 3ICCA 2PKQP 5AXDA 5KVSA 3SXPA 1H93A 5CPFA 2WDZA 1R0LA 5KTKA 1E5LA 1WLYA 2BFPA 4JLWA 1AXEA 3MJTA 5ES3A 1H94A 3NGXA 3ZU4A 1I3KA 4Z6KA 4OMUA 3EAGA 5C7OO 4XDYA 3ROKA 3Q9UA 3F6YA 1XDWA 3WNQA 3QW2A 2GR9A 2W2KA 4F45A 2W8ZA 4DIFA 1XELA 3RKUA 1HZZA 2C29D 2B4QA 5HS6A 8LDHA 2ZYDA 5F1KA 1KY4A 3KXDA 3VZQA 4AJ4A 4CV2A 1EEHA 1AHHA 1WDMA 1B7GO 5I7FA 3F4BA 1CERA 1B8VA 1E6EA 3KSUA 2BELA 1O5IA 2XXBA 4BKUA 4LMPA 1GQYA 3OEYA 4LCJA 5KJCA 1N2SA 4RF2A 4E5MA 4BQPA 3GNQA 3L07A 3BHMA 1EVZA 5COBA 1ID1A 4R1UA 5THQA 5CP8A 2GGSA 4DWVA 1BHSA 3OF2A 3ABIA 3VZSA 3RKRA 4AJNA 2FR0A 2GCGA 2TMGA 1HEUA 2VYVD 2HDHA 1HDZA 1DHTA 1J4AA 3WGZA 1DO8A 4HFMA 3ZWAA 4P22A 2ZTLA 5TRTA 1LC3A 4FGSA 3BMNB 5JCJA 3ZDFA 2CZCA 1Y5MA 4NK5A 1NTOA 4E5KA 1SAYA 3PPIA 2V7PA 4MO2A 4CV1A 3UKOA 4IIUA 4GH5A 1P0FA 1OOEA 2Q22A 1Z6ZA 3CKYA 3AY7A 2CFCA 3B6ZA 3PHJA 2B35A 4PG4A 4HY3A 3PJFA 1TVEA 4FJ0A 4GKBA 1MXHA 1DLIA 4NJMB 3U0BA 4ZU3A 1MFZA 4YWJA 4FS3A 3JSAA 2QZZA 3GDOA 3PRJA 2BF7A 4RORA 5H81A 2EKPA 1H9BA 4NH4A 4TMFA 1NNUA 3I9NA 3L6DA 2HMVA 2J5QA 1UP7A 3RC7A 4NU5A 4DC1A 4CR7A 1H6DA 4II3A 4TKLA 2GNAA 4YEDA 4B4WA 3MCVA 3BMOA 3MJEA 3PIIA 1ULSA 2J5KA 1C0PA 4CQMD 1X1TA 3SX2A 1KYQA 4NFHA 1PZFA 4R3WA 4CM3A 3LF1A 2A9FA 3RVDA 1OZAA 3SVTA 2YQ4A 2GF2A 2EJWA 4R1SA 4I5DA 3NT4A 1P33A 4ITUA 1Y9EA 1H6CA 2PGDA 3WQRA 4EDFA 2GZ2A 3NJ8A 4FJ2A 5AOVA 2UUPA 5KIAA 4TSKA 1KVTA 1SB8A 3ORFA 1NFFA 1PEDA 2FHSA 4J91A 4MOWA 4D79A 1HE5A 1YB4A 1ZUD1 1HZJA 2C5EA 2J3HA 4GL4A 2CVZA 3VKVA 3UCEA 4CM4A 1GV1A 3QA9A 4CLXA 2J3KA 3TN7A 2DUUA 3C1OA 1V3VA 3OJOA 4Z0TA 1BVRA 1E3JA 4RVUA 2ET6A 4XYEA 3OA0A 5DBIA 4Y6SA 5BSFA 1A71A 2HAEA 4BV9A 2CF6A 4R3NA 1DIBA 4W6ZA 4J4TA 1RM0A 3FF4A 1TI7A 1KEVA 1NPDA 3QVTA 6LDHA 2Z95A 1ZJZA 1UXGA 3KEQA 3PHHA 3WGOA 3IJRA 4BMSA 3M2PA 5F1PA 1NFRA 1B8UA 1ORRA 3GVIA 3ZV3A 4GGOA 5CFZA 4OO3A 3BMCA 4KWIA 3WJ7A 3LDHA 1D4FA 2GD1O 4XYLA 4WK6A 2TMDA 1K0UA 5JPIA 2ZQZA 4RQTA 4J49A 3JQFC 1WWKA 3NUGA 2UUOA 1NPTO 4N18A 1T4BA 3F9IA 3WYCA 4X54A 3L6OO 2NTNA 4L75A 4PIVA 2C82A 1KVUA 3KHUA 5T8KC 3TNLA 1GUFA 3WTCA 2YZ7A 1XLTA 3U5TA 1NASA 4G5HA 3D3WB 3PHGA 3WSVA 1T4DA 2AG5A 2OO5A 4ROSA 3WIDA 2B37A 4ALJA 4NFYA 2DBZA 3L4BC 4WCDA 3GR6A 9LDTA 3H65A 3M1LA 4IY1A 2HK7A 3GDGA 3LLVA 2NVWA 2QRJA 4CQMA 3DR3A 4OAQA 1RM3A 4R5HA 4IM7A 1MG5A 3ONDA 3QWFA 5TSDA 4MVJI 2AMFA 2C2YA 5BT9A 1X7DA 2X0RA 3VDRA 3FCOA 5I7SA 1ONNA 5ENDA 3GFBA 5J9GA 1I2BA 2GERA 2O23A 1JW9B 4Z3KA 2H6EA 1E7YA 3BTUA 3ENNA 5DOVA 3CH6A 1X0VA 3CMCO 1BG6A 1YB1A 5KNLA 4FIZA 2UVDA 1ADFA 3E48A 4RO0A 3VH2A 5B12A 3L4SO 3JCZA 4I5GA 2Q1TA 3TZQA 5CEEA 4HFRA 1Z74A 1XU7A 4IDAA 2JFFA 3S55A 4IQ0A 1QYVA 3VH1A 1CETA 1K2WA 2EKQA 4L4XA 4TZTA 3K2EA 1U1IA 4EUEA 1P31A 3NDRA 5DCWA 1QP8A 5JSFA 1L1FA 4LRTB 4R9SA 4WKGA 3MWDB 4AJJA 3T7EA 3ZWCA 4J2HA 1TEHA 3C7AA 3KYBA 2Z1NA 2VZ9A 3HDJA 4QO7A 5GZ1A 3AFMA 4BO4A 2VZ8A 2E48A 1K5HA 2Q46A 3MWEB 4BVAA 2VNSA 2VRCA 3VOSA 1ZEMA 3RU9A 3D1LA 5CG2A 1S7CA 5FWNA 3GRPA 3I52A 1R6DA 4R01A 5L53A 3L9XA 1HRDA 1V35A 5B4TA 1F14A 1HETA 2H63A 4FOSA 2EJVA 4M8SA 3SJUA 2IODA 4LGVA 1DAOA 2EWMA 5F3RA 3ETGA 1V6AA 3ZU5A 3PFFA 5C5IA 4UULA 2FPGA 3NGLA 2PZKA 3CIFA 2AXQA 4NQZA 3EUWA 1QORA 8ADHA 1RKXA 2X22A 2VYND 2NU6A 3LQFA 1YKFA 4DYDA 4IDDA 3TWOA 2W2LA 3AM5A 1FDSA 1NVTA 2WD7B 3E9QA 4J7XA 3VDQA 4QX6A 2ZB4A 1GZ4A 3ASVA 3P2YA 2Y1EA 1ISMA 3U4DA 4R68A 5G2OA 3ONFA 3GAZA 4BKOA 4HXYA 4EZBA 2I9PA 1BXGA 4NBRA 2WMDA 1PJSA 3OEWA 4E5PA 3DEYX 4K9DA 1E7RA 3QV1A 1D8AA 2FZWA 5KVQA 4GSLA 2YUTA 5HTOA 4K1LA 4EUFA 1M76A 1ZEJA 4BGIA 3NRCA 3SJ7A 1YL5A 1PJ3A 4KQWA 1PQPA 2C59A 5L4LA 5A3VA 1ENYA 4J43A 1I5RA 1XA0A 2BFAA 2JHFA 1O9BA 5JYFA 1NAHA 1ENZA 2VHVA 1W0CA 4CQLA 1UUFA 1WVGA 4AL4A 2ZQYA 2UDPA 2Y1FA 2ILTA 4CODB 4P4NA 4Q3NA 4EJ6A 1T2FA 4CUJA 3SC6A 1XGKA 2X4GA 3GF4A 3QWBA 4C7KA 1ZCJA 3GHYA 5JDIA 5L9AA 3P5SA 2O4CA 3B1FA 3C85A 3M1AA 3NTRA 1LSSA 4II2A 1R15A 4R54A 3L9WA 4EEXA 1HDOA 2W98A 1V3TA 1QYXA 3JD0A 3S2GA 3OH8A 4XB2A 5DNAA 4DUPA 4R41A 3BMQA 4YAGA 3NDJA 3UCXA 1ZJYA 2A94A 1CJCA 1DOHA 4EJMA 3TQHA 3ANMA 3RSHA 3AU9A 2VRBA 4XA8A 3L77A 4HX5A 3PZBA 2RHCA 3PQDA 2JD0A 3H5RA 3EYWA 1R4MA 3BYZA 3V8BA 4CM6A 3LT1A 4WLUA 4IQ8A 1D3AA 1XQ6A 2EHDA 4KMSA 4RDIA 4QTZA 4WECA 1SEPA 3AUAA 2SCUA 3DAFA 3DOOA 1A27A 4BNXA 1I3NA 1Y8QA 4AG3A 3OQ6A 4CLRB 1QMGA 3K73O 3GAFA 4NJMA 4B4OA 4CQLB 3RU7A 3I4CA 5CHEA 4J9VA 3JQFA 4W9NA 2JFGA 3KEOA 1H9AA 4DVJA 4CMGA 1U8FO 4WNCA 1U3UA 2GRAA 4BO9A 1QV6A 2O3QA 1PZHA 4Q3BA 3G1UA 4RV9A 3WQQA 1P0CA 2JFHA 4FC6A 5A4DA 4GBJA 4IJUA 4LW8A 3FPCA 3PHIA 3PGXA 4MVJE 1Y7TA 3WB9A 4YTEA 4GLOA 2QHXA 1DC3A 4NBUA 4BQRA 3TF5A 1NVGA 2F00A 2HK8A 4M55A 2Q4BA 2EERA 3RUFA 4GX0A 1EK5A 2DUWA 5EIOA 2GZ3A 1LXCA 5K0ZA 4IINA 4DLAA 2AEJA 4WE3A 3PIDA 3AY6A 3P19A 4UUPA 3PJDA 5JCJD 3GA0A 2AHRA 2H9IA 1YBVA 1O95A 2Y05A 4Z0PA 4CJXA 1ZK2A 1WZEA 5T8KA 5BSEA 3LU1A 1B8PA 2JJYA 4YT4A 2B0JA 1PS0A 4XCVA 2ZIZA 2D8AA 3GEGA 5JMWA 2DU8A 1SOWA 4MKRA 4CM4B 4MDHA 4RVGA 3ZNOA 2OHXA 4BNUA 1N9GA 1LLCA 3GOHA 3H9UA 4FFPA 3DZKA 5JS6A 1GYQA 3WWYA 4CMIA 1HE2A 3INTA 2VYNA 1PL8A 4J7CA 4PG7A 2QRLA 1PSDA 2PV7A 2DAPA 2AE2A 3GMSA 4BB6A 2PR2A 4XDZA 1UAYA 5H83A 4A7PA 3AW9A 3H6KA 2ZJ0A 1EUDA 5G0VA 3U62A 2BD0A 2QIOA 3LZ6A 4MP6A 1NX6A 3W6UA 3LC1O 2W90A 3W8EA 3D4PA 4FFNA 1JAYA 2J5RA 4R4JA 4J90A 4Y67A 1NQAO 3BAZA 4PLYA 4IDCA 4CMEC 2JD2A 4B7UA 3DBVO 4J0EA 4J2OA 5M6DA 3CINA 4IJWA 1R66A 2P4QA 4JBGA 5JDIC 3DBHA 4W9NC 2VWHA 1J5PA 4GVXA 3HN7A 3JQCA 1VKOA 4QEDA 1CYDA 4ZD6A 1GCOA 3E1KA 3EZYA 1FDVA 1L7DA 3OJFA 1CDOA 5F5NA 1JKIA 2Q1SA 3ZWYA 4IUYA 4YAEA 4PLZA 3EDMA 4RLSA 2I66A 2W4QA 4PVDA 1MC4A 4FFMA 3S1LA 2HK9A 1BTOA 3RFVA 3RC9A 2C5AA 2FRDA 4XRRA 3WS7A 5KJEA 3GVPA 3C24A 3JYPA 1XKQA 3AOGA 2I5PO 1EZ4A 1E77A 3ZZNA 1PGOA 3WSWA 1IZ9A 1M67A 3W1VA 1P1RA 1VL8A 1EE2A 2NTJA 1MGOA 1PL7A 5EPOA 4I9HA 4MINA 3WLFA 4O5OA 4E33A 3AUTA 3K8ZA 4HBGA 1Z82A 3OIFA 4B3JA 2EG9A 1QYWA 4RVFA 4RZIA 3RUAA 2PK3A 5KKCA 5L7WA 1E7SA 3WYEA 3IUSA 4OM8A 1M75A 4QQRA 2EIHA 3OFSA 1XIVA 5IXSA 4ZN6A 2ZTVA 3KO8A 3QY9A 4A10A 3FBTA 1ZSYA 3FI9A 1YBAA 1VRWA 3DMYA 4FCCA 1ZO8A 1OFGA 1BDBA 4XQ9A 1C3VA 2AG8A 2BFOA 3QQPA 2Q2QA 1JKJA 3MJSA 5I8ZA 3RUHA 3UFXA 4B7XA 4RDHA 2DPGA 3R1IA 3H9QA 4YDRA 3TZ6A 4FPXA 2Y1GA 5EL0A 3Q2KA 1GUYA 4NBTA 5FF9A 4UVHA 3K31A 1E3IA 1HXHA 5TNXA 1I33A 3ZGYA 4QFCA 5BNFA 1U2DA 4GX5A 4CUZA 1I24A 2JAHA 2ZB3A 4D42A 1EBFA 2FOIA 3V5NA 5GZ3A 3WMWA 3KLPX 1JA9A 3DOCA 1YVEI 2EGGA 3FBGA 1E3SA 5IDQA 3HB5X 2NVUA 3G0OA 3UW3A 1H0KA 3DBLB 1HSOA 4J7UA 4JGBA 4OOFA 2CD9A 3OECA 3RROA 3W8DA 4DA9A 1NVMB 4FN4A 4XQCA 3JQAD 3KTDA 4KP7A 3M6IA 5L4SA 2IZ1A 2NU9A 4BNZA 3GUCA 1HYEA 4QFDA 2NQ8A 5L4NA 1SBYA 1HL3A 3OJLA 1PTJA 5KCZA 4OQYA 1ZK3A 3V2UA 3ENKA 4KUGA 1NYTA 4FB5A 3RI3A 1QSGA 4HWKA 5TT1A 3E6AA 3IP3A 1ISHA 1SC6A 1UXKA 2CF5A 4PLFA 4JK3A 4JIGA 4PG8A 5JW6A 1F0YA 2FY8A 3FNEA 3W6ZA 2X9GA 2VOJA 4KDFA 1T25A 2X8LA 3JTMA 1GCUA 1EVJA 2HMTA 1C0KA 2JD1A 5A06A 2RIRA 3QVSA 4YJFB 3DZFA 1YBMA 1PR9A 1A4IA 1YDWA 1ZK0A 4DXHA 5H82A 1VM6A 1UXIA 3ITKA 4YXFA 3E5RA 4BNYA 3IKTA 4CLOA 3HN2A 3FRJA 1DC5A 3WIEA 2BKAA 4NBVA 4HUJA 1XR3A 2P9CA 1U7HA 4A03A 3JYOA 3DBLA 5DN9A 1PGJA 5THKA 7ADHA 3DC2A 1F17A 2D1YA 3GH3A 5DULA 2IRWA 1DIAA 3Q11A 4O63O 2YHUA 5I7VA 4RZHA 1HYGA 4W82A 3I9KA 4E4YA 1JN0A 5G0SA 2OMEA 4ALLA 4CM8B 4DTIA 2DLDA 1XYGA 3D4NA 4YJGB 1JKFA 3ADOA 4HV4A 5HM8A 2WWRA 4I08A 4W99A 4KTTE 2AEFA 4UEKA 3HNPA 4E5NA 1ADBA 2P68A 3EMKA 1WXDA 2CDBA 4ALKA 4CM9D 2PZMA 3DBRA 4TRRA 3AFNA 1P44A 1NXQA 1MA0A 2OFPA 2C07A 2DTEA 3VHRA 2W2KB 1SNYA 3CTMA 4L8VA 3OMLA 2Q1WA 3VC7A 1EDOA 2O50A 3JV7A 1C1XA 1AN9A 2YY7A 1D7OA 3HE3A 3F4LA 1LLDA 1I32A 5DBGA 2VUUA 3GVCA 1CIVA 3VPSA 4PLCA 3H7AA 1P1IA 3QLJA 4BB5A 3SLGA 3UGKA 1DC6A 4M54A 3S8MA 4PLPA 4XB1A 5JY6A 4LVCA 1DFHA 1KVRA 1P1KA 5JDCA 1LDEA 1LUAA 4MVJM 1Q1NA 1U9JA 1B15A 3U9LA 4L74A 3IDSA 3QWIA 4DL9A 4D0SA 4Q3AA 3ZWVA 2P4HX 4MVJP 1E1LA 3GT0A 4NDNE 5A5FA 3DHEA 5A9SB 5I8WA 3JD4A 2PKRA 4RF4A 2OBNA 2BI7A 3KB6A 1MV8A 1KOLA 3VPHA 4Z9FA 4IQGA 2I99A 2NADA 4L4SA 4HNGA 4MJLA 3EVNA 1ZW1A 3MTJA 3OJ0A 1O8CA 1U5AA 2RHRA 1PR3A 5I9LA 1GAEO 3P2OA 3GVHA 4CMCA 2XOXA 3G1TA 1C0IA 4A26A 2DBQA 3ZN2A 3L6EA 2DC1A 5BQFA 4FR5A 1XU9A 1EQUA 2H5LA 3I5MA 2ZKLA 1GFSA 1L7EA 2FR8A 3RC2A 4GWGA 4MKZA 1EVYA 1A7AA 1EFLA 2IEDA 3ZV5A 3AUSA 3FNHA 3UICA 1ZFNA 4PRLA 4OQZA 2GN6A 4D44A 1I0ZA 4ND1A 4O0LA 4WJZA 2I65A 1I3LA 1H5QA 1LRKA 5ILOA 4JBHA 2FR1A 1Y8RA 3WNVA 1G6KA 2WTBA 4IMPA 4RVDA 4UUNA 3CXRA 4ONEA 2XF8A 3E18A 3H8VA 4CUKA 4H7PA 5IDXA 3WBBA 1GY8A 4BKQA 1PJCA 4PZDA 3DL2A 4MP3A 5DF1A 3CUKA 1HT0A 4RJTA 3Q6IA 4GI2A 2DFVA 2G76A 3DMTC 4J3FA 2ZB8A 3ZHYA 3WLEA 5COQA 1C1DB 3U3XA 1CQIA 5JXWA 2QZ9A 4PLHA 2R6JA 1U2GA 1UDCA 1Y9AA 2HMSA 3Q2IA 2HU2A 1E7QA 4URFA 4RPJA 3ROMA 3IMFA 2E37A 2ZTUA 1YL6A 1K6IA 5FI3A 3WFJA 4L73A 4TRJA 4BMNA 4J1NA 4E2WA 4PVCA 4EBFA 2C7VA 3KSDO 2H1SA 5T6BA 4DMMA 4I9UA 4B4UA 1VE9A 4PZEA 4MVJF 3ZHBA 5CDTA 4DLLA 1YDEA 2EEZA 4NPCA 3DTYA 4ND5A 3GMDA 4HADA 1XSEA 3DWFA 1U5CA 4TKMA 3ZW8A 1E6UA 4UVDA 5IZ4A 4N5LA 1IPFA 4AJOA 3N7UA 1E1KA 1DJNA 1LDYA 3GN1A 1GEEA 3RCBA 3RAJA 2Q45A 4MVJD 5AQ1A 1LNQA 4CM7A 1KVQA 1ISGA 3AOEA 4U8GA 3WFIA 3UVEA 1BW9A 3KOUA 4ALIA 1SO8A 4W7HA 4MIYA 3GZNA 4CMAA 2PZJA 3I9JA 1KEWA 4RL6A 1H2BA 4Q3CA 1UZMA 1IL0A 5TC4A 1RYEA 1VPDA 1TB4A 1VKNA 5JAIA 1P9LA 1ENOA 3PQFA 2C0CA 3HADA 5G0UA 1E3WB 2PH3A 3WJAA 2HUNA 4DREA 3PK0A 2FPPA 2ZYAA 3LK7A 1U28A 4XGNA 1FK8A 3E03A 2FPIA 3E9MA 1I36A 1PWXA 4YRAA 1Q2XA 4DQUA 2Y0CA 3JQ8B 3GNSA 2Q2WA 2X7HA 1GDHA 2Q2VA 3V2GA 3BIOA 1NWCA 4D3DA 2AQHA 3WX0A 4PG6A 1I3MA 2CNBA 5I9NA 4WUVA 2R2GA 1B16A 4IZHA 4CLRA 3G17A 4KDEA 3PDUA 3NJ4A 4RQUA 4BO2A 5AXCA 4WEQA 4TVOA 9LDBA 3KUXA 4NK4A 3HDQA 4C4OA 2Q50A 4UVGA 4GQAA 3S2IA 4NNJA 1LC0A 3PYMA 1U3TA 1AHIA 4M49A 1QYDA 4IDEA 2VOEA 4JJFA 5LDHA 3PI7A 4XKJA 4LRSB 4F6LA 5T5QA 1PS8A 4W4TA 3K6JA 3FR8A 2EP7A 5F5LA 3OM9A 1X7GA 3F46A 5K6AC 3ICPA 2D59A 3ZCXA 2VUSA 1YQDA 3PVZA 1VC2A 1PZEA 3GVXA 4YVFA 3WG9A 1X14A 3CE6A 4K26A 2O3JA 4UEJA 2GN4A 3WOHA 2HJSA 4YACA 5A3JA 3VZRA 1CF2O 4J1QA 2HRBA 1TT5A 4BNHA 1I10A 2AA3A 5TGDA 3RBZA 4NI5A 3BXXA 1H6AA 1DIRA 3N74A 1DRVA 1K3TA 3WYBA 1XHLA 4XX0A 4DIOA 4J4BA 4BNJA 5IG2A 4WCFA 3K92A 1AUPA 3OETA 1NQ5A 1DRUA 4P8RA 3GPIA 4YYZA 1JVBA 4KUEA 2O3UA 3GGGA 3L4BA 3SBOA 1ADGA 1JVSA 2BFMA 1T1SA 2BMAA 3NKLA 4RF5A 5TS3A 5ENVA 1RM4A 1JLLA 4IDBA 5ITVA 3WMXA 2D3TA 3TL3A 5ICMA 1O0SA 1HTBA 1PGNA 1MP0A 3ZU2A 3R6DA 1IULA 1R12A 3RUCA 3X2EA 4EI2A 4YT2A 1E6WA 4FSHA 5EN4A 3SEFA 1LJ8A 2O3RA 3KSZO 4Z9YA 1TT7A 2A4KA 3VH3A 4CR8A 4XEHA 4AJHA 2OP1A 4HP8A 1UP4A 5G4KB 3VZPA 3Q3CA 1WPQA 1WAMA 2B5VA 3HHPA 1AE1A 3UH1A 4PLGA 3G3EA 3ROPA 1GYRA 5JBIA 4A27A 4L0QA 4K6FA 4C7JA 4XIYA 4KZPA 1NQOA 4YAKA 4OGWA 3TZCA 1TT5B 2P9GA 3E8XA 3KYCB 3HDYA 2Y0EA 4BGUA 2AW5A 5CEJA 1ISFA 5JDCC 2Q1UA 4XYGA 1J0XO 2EF1A 2G17A 3OQBA 5B37A 2YHIA 3DAPA 4IS3A 4LK3A 3GDFA 2VT2A 2GSDA 2WM3A 3UHAA 1B3BA 5BSHA 1NHGA 2RBEA 3O9ZA 2VUTA 3I6QA 1BGVA 2PZLA 4NU6A 2Q3EA 3JQBA 4L76A 1PWZA 3U4HA 4RVSA 3FWNA 4IDGA 4EUHA 3I4FA 3HDHA 3V1TC 1NR7A 3H4VA 1BXZA 1Y81A 1ZMTA 2GYYA 2BGKA 2OXIA 1V0JA 4R16A 4U0KA 3ETEA 2NQTA 5JO0A 5I9MA 2WYUA 5JCXA 2O3SA 5C37A 2UV8A 4QUKA 2AEMA 3QWHA 3QP9A 1YQGA 3OHSX 2HMWA 3GLQA 2YFQA 4D3SA 5A05A 2PWZA 5C7LO 1EK6A 3S2EA 3UN1A 1ZIDA 2X5JO 4GX2A 2EKLA 2B4RO 5U1PA 2RH8A 2Q49A 2P2SA 4E31A 1SOVA 1ADCA 3LC7O 4NHEA 5ICSA 4BOYA 2DKNA 2WYVA 1ZZEA 3ZWMA 3QVXA 4BNVA 2AQIA 1LX6A 1A4UA 1LA2A 3ST7A 2ZYGA 1SB9A 2DBVO 3QHAA 2CY0A 2VQ3A 3FTPA 2IE0A 1HLDA 3DZJA 2A35A 3BMNA 4U6SA 4E0BA 3RBVA 2Y68A 3ZWPA 1DFIA 1YXMA 1M6HA 5JYDA 5HRUA 1ML3A 1ISIA 2OUIA 4RPGA 2GPTA 2PA3A 5JO9A 4CQMB 4H16A 4I9NA 3PYLA 3WGYA 2Y66A 3FNFA 2Y1DA 1LDNA 4BL5A 4YAJA 5ER9A 1B0AA 4XYBA 1LTHR 2FMUA 3V2HA 5I7EA 3HZZA 1SPXA 1OI7A 5A02A 4J6FA 3ZW9A 3WBFA 3HUDA 1SCUA 1LRLA 4E30A 1LLQA 1UXJA 3R3JA 3BMOB 4N54A 3F1LA 4RPHA 2NTVA 3HFSA 2WJPA 4YJDA 2EXXA 1KERA 2CMDA 3AWDA 3HFGA 1I01A 4LN1A 1T24A 3Q9NA 2LDBA 1DIGA 2NU7A 4DRYA 2J8ZA 2D5CA 1T2CA 3O03A 5KKAA 1ULUA 1ARZA 4RGBA 3OIDA 5IF3A 1LSJA 3BHJA 1GR0A 2O7SA 3CMMA 1D1TA 2HRZA 2O7QA 3L0DA 2QW8A 2QX7A 4WASA 2NVUB 1E5QA 4IZIA 4CM5A 3V1YA 3C8MA 3LT2A 2IXAA 3LT4A 1N9GB 2LDXA 1YE3A 3AI1A 1OC4A 2X6TA 3WGHA 4JXKA 3ZNPA 4WCFB 3WQSB 5L7TA 2UYYA 1YL7A 5DP2A 3PFWO 5K6AA 3OJEA 1PJBA 5J23A 1HDCA 2VHWA 5A9SA 4DBZA 1NHWA 3VPXA 3D5TA 2AQ8A 2AE1A 2NNLD 3ULKA 1RWBA 1WNTA 5EERA 5L3ZA 4B3IA 5IN5A 3DZGA 4F46A 2EW2A 4CLHA 3H9EO 2B36A 5LCXA 2G5CA 4GX1A 1UAGA 3OA2A 1PJTA 3EGOA 4ZA2A 4MKXA 2YHIB 1GPDG 1Y6JA 4N7RA 3VPFA 3PZRA 3KVOA 2B5WA 1IHXA 3E5MA 5DCUA 3V1UA 1F12A 3G79A 3A28A 2PLAA 3IIEA 3OSUA 1P1FA 1XG5A 3W4IA 3IOYA 3GUYA 3OP4A 4RPLA 4YB8A 4UUOA 2VWQA 1E92A 1ZSNA 1P1HA 3D7LA 4DLBA 1R16A 1PS9A 1MX3A 3FNGA 4QXMA 2V6GA 3I6IA 4UREA 1NR1A 3GZ4A 4M89A 3F5SA 1ONOA 3E9NA 5JC1A 2JL1A 3DZBA 4AJEA 4MP8A 5TJHA 5CDUA 4TRMA 3ZWWA 4NFSA 1N8KA 3IJPA 3KLMX 3JQ9C 1BDMA 3LSYA 2CVQA 1UDBA 5T57A 3T7CA 1N1GA 4Y98A 1BXGB 3EVTA 3IP1A 4PCVA 3M2TA 3I9LA 4ESOA 1W6UA 3KYCA 1OC2A 3NDIA 5DOZA 3C7DB 5EMHA 5KOIA 1JWAB 1M66A 1DBVO 4PRKA 1B14A 2B83A 3UCFA 4B79A 1YS4A 1V9LA 1ONPA 1VJ0A 1DEHA 3NV9A 3RFXA 1J6UA 1XQ1A 1TLTA 5A04A 4BNFA 3ANNA 4IIVA 1UDAA 1NWHA 4WGGA 4O1MA 4YQYA 4CV3A 2FSVA 3T4EA 2IZ0A 4CR6A 1A72A 4S3MA 2WE8A 3FWZA 4J1TA 4BS9A 5K9ZA 3TPCA 1WDLA 2NUAA 3LF2A 1UH5A 5HS4A 3K9QO 1N92A 2UAGA 4PFJA 3ONEA 4CM1A 2EW8A 3GEMA 3O8QB 1Z7EA 4BGVA 3NT2A 1MLDA 4N5MA 5KJFA 4GWKA 5DDIP 1PU2A 3MJ4A 4FFOA 2DM6A 4DPKA 3H9GA 4R5MA 3WXBA 3DZIA 3JD3A 1KIFA 2Q99A 4I1IA 1GQQA 2HJRA 2NU8A 5A5EA 1GYPA 1EE9A 1ZBQA 3TJRA 4E2XA 3PLNA 3U4CA 1JWBB 2WYWA 3DBRB 1LDBA 4YPOA 5JAMA 2DFDA 1VL6A 2AQKA 3IS3A 6ADHA 3AU8A 3LYLA 4OKNA 3LC2O 3KZVA 2PD6A 5IDYA 4A0SA 1HE4A 1TXGA 1GZ6A 4K28A 4KWHA 5AYVA 2Y1CA 4OXYA 4LVUA 3HSKA 5TQVA 2X9NA 2VHYA 1ENPA 3GC6A 4FJ1A 4AVYA 4IXWA 3DAGA 3A9WA 1Y5RA 3K5PA 3AM3A 1LQUA 3RUDA 1HDXA 1CRWG 2PD3A 4TQGA 1Z73A 3I9OA 2IDZA 1DAPA 2JKVA 3O38A 3H3FA 3MZ0A 3PWSA 3H3JA 1A5ZA 2X0NA 1HSZA 3JD2A 4OL9A 2Z1MA 4DMLA 4PLWA 3HJAA 2NACA 4J4HA 5GMOA 5EQDA 2DQ4A 4HFNA 2VHXA 1PGQA 4P38A 4F6CA 2GO1A 2O2YA 2WD8A 2OL4A 5BR7A 1KC1A 1I30A 2C20A 3K30A 3IC5A 3VH4A 5L7YA 4J1SA 4E13A 3ZWXA 1GV0A 3ANLA 3DONA 4ZQBA 3PHLA 1I2ZA 2BHLA 1E3LA 4KTVE 2CVOA 4DQVA 3VTZA 3OIGA 2B4TO 2VTEA 4E12A 3HB4X 1PJ4A 2Y67A 2GZ1A 4J9UE 3R3SA 4J16A 1R0KA 4ZQHA 5IZCC 5DCYA 3JQ6A 1NFQA 2ZCVA 3JQAB 3QVWA 4BNGA 4GPD1 5IXYA 1IY8A 1AGNA 2HKIA 1B2LA 4CLOB 4Z9XA 3IAHA 3WR5A 4AJ1A 3GHHA 2YV1A 4D46A 5F21A 1YJ8A 4OXNA 3D3EA 1BMDA 2Y93A 1YO6A 3CZRA 1Z45A 3JQ7A 3KYDA 3PEFA 4KOAA 3ZNQA 2JAPA 2JCXA 4XJTA 4TZKA 4ND4A 1QKIA 4JP2A 1K6XA 1O94A 2CSUA 4XYMA 1W73A 3N58A 4ZQEA 3MOIA 1C1XB 4XQGA 4L9RA 1N5DA 4CMKA 2BI8A 4RLHA 4E2ZA 3K96A 4EYEA 5DBFA 2HMUA 2IYPA 2VZ0A 5EINA 2Z5LA 4MPDA 1W4ZA 3GNTA 1JAXA 3TFQA 4DPMA 4H15A 2HLPA 2DPHA 1E7WA 4INAA 3D0OA 2PNFA 3DHYA 1Y8QB 1GEGA 1Q0LA 3A14A 4KUHA 4GMGA 4L4RA 2VHZA 3F1KA 3PWKA 3F47A 4BKPA 4DC0A 4ND2A 1VI2A 1FXSA 5G0WA 4YAIA 5MDHA 2IZZA 1V3UA 2GN8A 5C3MA 2NSDA 1FJHA 2NLOA 4GGPA 5FFFA 3ZWNA 2D2IA 1UR5A 2RH4A 3O4RA 5EJ2A 3K2BA 3X2FA 1CWUA 2YV3A 2OGUA 4DGSA 5AVOA 1YWGO 3JQ8A 1W8DA 1KEPA 1R4NA 1VJ1A 2VWGA 2JHGA 1DLJA 1GPJA 2QQ5A 4FOOA 1U4OA 5G4KA 3AJRA 3ZU3A 2VN8A 4I8XA 4G2NA 3GEDA 1HDGO 2CDAA 2RCYA 1E3WA 4OH1A 1ZNQO 4FD3A 2ZB7A 5JMPA 2B69A 4BO8A 3MEQA 3DZHA 4XZ3A 3TL2A 4UVEA 1PL6A 3RC1A 2X5KO 4BO3A 1IZ0A 5JYAA 5A9TA 4BO5A 2V6FA 2V6MA 3FR7A 1PJQA 4BKRA 1D1SA 1PJ2A 4XD2A 3I9MA 3NAQA 3UOGA 4OHUA 3BTSA 1OAAA 2VTDA 1Y8RB 1V8BA 2FN7A 3LT0A 2IYOA 2C54A 1C14A 1DXYA 4LISA 2ZCUA 4OOEA 3F3SA 4R9RA 1GU7A 4CLEA 4XGIA 4XR9A 3JQGA 4YT8A 3JYLA 1IPEA 4P4GA 2E82A 1KEUA 4YA6A 4AJLA 3ROQA 2P9EA 3QE3A 4EJ0A 2X9VA 1IE3A 1C1DA 3ETDA 1HE3A 2DTDA 4WOKA 5LDGA 4FC7A 4OJNA 4Y6RA 4B4VA 5TIIA 1KETA 1U3VA 1H2HA 4JP3A 2GDZA 3DMTA 4HFJA 3RQSA 4FDAA 4BMVA 2YDXA 3QSGA 4WPGA 1ZXLA 1EDZA 1EBUA 1GQ2A 3H2ZA 3CZMA 4I5FA 4Z0HO 3VAZA 4JNKA 5IN4A 4JBIA 1OMOA 5A1TA 4D43A 1RYDA 1HDRA 1QXSA 1DDOA 1F8GA 1MFPA 1ZMOA 5FYDA 5TLSA 3QVOA 3PJGA 4NBWA 1LQTA 5FEUA 3EZLA 1ISJA 2Y99A 4JJIA 3Q0EA 2XAAA 4UVIA 2QG4A 5KVCA 3E82A 1LEHA 3AY3A 3GPDG 1S6YA 4BNMA 3PJEA 1XWFA 2V65A 3NEPX 4RPKA 5JFOA 3DHNA 2HO5A 3SC4A 1WMBA 2ZK7A 4ND3A 3RJ5A 3VPGA 4JJGA 2R00C 4CLDA 2X5OA 5HBRA 3TDKA 4LSWA 3TFOA 3RBXA 2YFHA 3RIHA 1QLHA 3A1NA 5TF4A 2NM0A 4E3ZA 2G0TA 5GY7A 5T67A 5A9RA 3JQAA 3B1KA 1Q7BA 2P5UA 2X0JA 4DYVA 4EITA 3NTOA 2GN9A 3ITDA 4QECA 2I67A 1HF3A 1ZXBA 2X0IA 2PY6A 2FZEA 2YDYA 3BZUA 2VNAA 3A4VA 3Q1LA 1O6ZA 4PLTA 3H5NA 4MVJG 3I83A 2VCYA 1LI4A 4IGFA 2C2XA 3KYDB 3B1JA 3OBBA 2VYVA 1U7TA 3AOEC 4WOJA 4E5YA 3KBOA 4Y9DA 4CMJA 1QLJA 1PGPA 1X0XA 2HSDA 3TZHA 1FDUA 2FSSA 4CL8A 3AK4A 4O6VA 1HKUA 1JU9A 2GASA 1P77A 4A73A 4D0RA 4FBGA 1BW9B 1GADO 4M1QA 3B70A 4ZHSA 3RUEA 5ITWA 1EUZA 1I2CA 3ZWOA 2ZTMA 3BMCB 3BA1A 3AI2A 2NV6A 3DDNA 3JQ7B 4U7WA 1P74A 2FP4A 1KBZA 3EK2A 3GGPA 3PQEA 3RWBA 3H2SA 1YB5A 5T73A 4Q39A 2NWQA 1CEQA 4JN6B 5JYEA 3EY4A 5IFLA 3VTFA 3B20A 4LCEA 5LC1A 1GTMA 4CM8A 2JCVA 1YOVA 4Q3DA 4G81A 3ZNNA 1Q0QA 3STHA 1DIHA 3ADPA 2FWMX 3NT5A 1MB4A 3DB2A 1HLPA 4Q9NA 3P7MA 3DFZA 1R4NB 5ILGA 1Z7BA 1FDWA 4WLFA 3KV3O 2YYYA 4PG5A 4EGFA 3C1AA 4IS2A 3GRKA 1R0SA 4E32A 1T26A 4CMHA 2QYSA 4FW8A 4S1VA 4TVBA 3DTTA 4OYRA 4XIJA 5CAEA 3MTGA 3UUWA 4BUCA 1XEAA 4WNIA 1U8XX 1F06A 1QV7A 3D3WA 2HQ1A 2OORA 3FPLA 1BSVA 2D0IA 2OP0A 3BHIA 2WSBA 1ZK4A 5IZCA 3WTBA 3C1TA 3EW7A 2RAFA 3AM4A 1UJMA 3JYQA 4ZQGA 1EQ2A 3U49A 4E21A 1M6WA 1PQWA 4ZVVA 3U09A 5CDSA 2BGLA 4XRGA 1E1NA 3BMQB 4B8ZA 2X86A 3D64A 1IHYA 3GG2A 2ZATA 4PGFA 5JE8A 4AFNA 3UF0A 1GL3A 2I6TA 4WEOA 1ZKMA 1LDGA 5JNLA 1I8TA 1Q0HA 1J49A 1YOVB 1O89A 1SZJG 3KRTA 3MJVA 4IBOA 1DB3A 4P4LA 2E4AA 2VT3A 3WGGA 3W8FA 4MIEA 1KVSA 3HWRA 3DXFA 3OQ1A 3VKUA 3EC7A 3TRIA 3PTZA 1NPYA 4YBZA
chains in the Genus database with same CATH superfamily
2CT8A 4YRCA 1JHYA 3EQ8A 3L01A 2XQGA 1NP7A 4OB6A 3WE7A 3ORHA 2RE8A 4JROA 2GAIA 4MROA 4PFSA 1UPFA 4RMHA 5EZ5A 3IMCA 5LPNA 5DEOA 4LSMA 3BT7A 2WIBA 3M6WA 4QUBA 1H22A 3RTDA 3WDSA 2CBZA 2I0FA 1UIRA 4CNBA 2W0MA 3WXMA 2A1IA 4MMYB 1E79A 4P84A 3UA4A 5L51A 1G66A 4WLVA 1XZHA 4FKBA 4YJ2A 3A6LA 5HA5A 1SOMA 4IJKA 1MNAA 4UXHA 2P5TB 2HFKA 3VVCA 3HU1A 5CCDA 3WK8A 3N8HA 4BLUA 3TKLA 3GXBA 4XWYA 1UKCA 1ZITA 1ZUNB 4CL3A 1P4JA 3DVAB 1RWQA 1VMKA 2FWIA 4JOCA 1V16A 1T15A 4HMOA 4IJMA 6REQA 1IBLB 4PHFA 2E6UX 1R6VA 4C2AA 2WD7A 3KJZA 1IN8A 1GGNA 1Y1LA 3DQQA 4C05A 1QRTA 4HNHA 4V03A 4FGUA 4PLVA 5BQ5A 2CE7A 2GPSA 1WKCA 1OBOA 2GEUA 4JMLA 1US8A 2Y8EA 1IB6A 1U4NA 1K89A 4IIJB 1RAIA 5KTPA 2XUJA 4FFRA 1Z26A 3KU4A 1VP3A 4YQFA 1UKBA 3UUFA 4PNHA 1HNWB 2FEXA 3O7MA 2YCLA 4FGWA 4N5NA 1U0JA 4BLVA 4KQIA 5KJ1A 4EFLA 1PSZA 2A1UA 3MJHA 5ED4A 4A0QA 2CV1A 1B3RA 5BUQA 1AKWA 4NE2A 4TXLA 4D8XA 1IBMB 5BR1A 1I6LA 3C5EA 4Q93A 3VU3A 1WXFA 1ZH2A 4BX2A 5LNK1 1XWIA 4W5TA 1YV9A 2MINA 1NW6A 4NECA 2DFTA 3O93A 2CXSA 5FWAA 5C46F 5JD5A 2IJGX 3SNKA 3TI7A 4BECA 5CDGA 2W7TA 2X23A 3A05A 3KP1A 4QT0A 2WFLA 3EXHB 2PL9A 3IUQA 3IEXA 3RSZA 3JZFA 3MTEA 3C6QA 4Q4JB 4R7TA 4WWHA 4ZOQI 4ZI7B 3U1BA 4QVIA 3KX2A 3GGOA 4QOEA 1WBBA 4U5QA 5EI5A 5GV7A 1ZVMA 4ZYYA 2CMHA 2Y3IA 1UBTS 2JAXA 1PR5A 4IIDA 4K6CA 3EMDA 1RPAA 4PNZA 4CEJB 3RKSA 4G5GA 5JVDA 2GEVA 4QUDA 3ICWA 3P2MA 5BNIA 3IKVA 5EP2A 4JYBA 2P6RA 2X42A 1SEVA 2Z8ZA 1X1EA 1ETUA 2GUWA 1OI2A 2B9EA 2OOSA 5B12A 3OQNA 1EFVB 3I42A 2C9MA 3CCFA 1K4KA 2IZ6A 2PWBA 5HM6A 2XWBF 4E4RA 1IN4A 4XSGA 4P08A 5JH7F 2FGKA 4KXYA 1RPZA 4NCAA 3TLMA 1E9EA 4ZGWA 3COJA 1XC7A 1UT8A 4G9EA 1QRSA 1KY2A 5AM5A 4A5SA 4AJPA 1DX4A 1NVFA 1Z28A 3ASUA 1FMTA 2AK3A 2V4MA 1A8QA 3IQDB 1CY7A 3PTAA 4P7FA 3ZWBA 3AL0C 4I3FA 2QV0A 1ZJWA 4UD2A 5JAZA 4DQKA 3CPSA 1RJWA 4JLPA 4F5YA 3K70D 4Y6PA 4NZMA 4NZ9A 2IXBA 1PYGA 3BFXA 2EDCA 3D6VA 4S1OA 3W4KA 4AF6A 1GZ3A 4AX8A 3VVMA 1YSCA 3QJ5A 4ZK2A 1ULAA 1FDTA 1T0IA 1A76A 3T7RA 1AF7A 1PG5A 1XTIA 3ILHA 4N3CA 1H6BA 5FLKA 1E1MA 2I3AA 1JTVA 2EF0A 2VXYA 3AVOA 1T10A 3LXXA 3OCJA 4NZYA 4RADA 4TQAA 4UUMA 1J39A 4WY2A 5CURA 3V2IA 3ZDEA 2ZVJA 2IXGA 1RWMA 1CQIB 1SZCA 2DPMA 1Z35A 3LW7A 3QIVA 4YCAA 2PRIA 4NMMA 5TX7A 2AZDA 4PTYA 4PSCA 1IQPA 1T3LA 4QTXA 4NYMQ 4N76A 3LY8A 3DVSX 4BP9A 1N1EA 1O77A 4J75A 3DFUA 4OLAA 1XJ0A 5TT0A 3L8MA 1P0IA 1WP4A 1JNYA 2ZVQX 1N6NA 2DPLA 3DMPA 5J4KA 1FBNA 4LMRA 4EI7A 1E2IA 3AUKA 3NKFA 4HTFA 5GWXA 4C6RA 3WVNA 2GBIA 2MSLA 4IV0A 2K2QB 4PBTA 1R2QA 5JAQA 2RAUA 1E0DA 1GA4A 1GPAA 2WE7A 4FYWA 3EQZA 3DMDA 5C7IO 4DIKA 1BXKA 3RFUA 1HFWA 3TSZA 2QRPA 3ISTA 4JJ4A 4RC9A 4X66B 3Q7EA 1YH3A 4OXKA 2I62A 1FFXA 1JENB 5CNKA 2DVMA 2GPJA 5DK6A 1P81A 2F1KA 5DYYA 4A8HA 4EG3A 2BN4A 5DGDA 5KWEA 1ULZA 1K63A 1G21E 4G37A 1BOFA 5ER6A 2C7GA 2CNLA 3ZJTA 4MIOA 1Y7HA 3VGJA 1FX0A 4LKRA 5ADHA 2FW1A 2ODQA 1B43A 1JIQA 4OJTA 3W05A 1VLLA 2WJ4A 3A06A 3T5AA 1J5EB 1Z4KA 3GY0A 3OF5A 2C4NA 3G8BA 4RLFA 5FHQA 1ZOPA 5JC8A 4PC1A 3FPHA 1R9GA 3TTVA 3MRXA 5FHRA 3TV1A 4ACBA 1EB9A 3I4LA 3Q87B 3BIFA 3Q72A 3ZXYA 4D4KA 1JE0A 1EK2A 3LPLA 4ZO9A 2FDXA 3GEEA 4Y2UA 4D9JA 1B23P 2QK4A 2OWDA 1RLJA 4P3NA 1OW3B 4F7WA 4QLOA 2HU5A 3ZLBA 3NYWA 3W6NA 2ZR9A 3K0EA 4NENA 5AKLA 4YRBA 1HDYA 1GD1O 1A9ZA 1LRJA 2YJZA 3O0TA 4AP5A 5HKKA 2PT7A 3G5AA 1E4EB 4YYEA 1UZAA 3FUXA 1S2DA 1FMCA 3PD7A 4FNGA 4DRXB 1NQTA 2NTYC 3E2PA 3VVBA 1TO6A 2NXCA 3FOAA 3ZH2A 3T9BA 4PSUA 4O59O 4OKIA 1PX2A 3QKIA 5EP3A 2AD1A 2AX4A 4W7IA 4D4HA 4Z4GA 1CY0A 4CKCA 3INNA 2FSVC 4KQFA 1HO3A 4EJFA 2ADFA 3DGFC 3NNSA 2D7DA 3EISA 4HGPA 5CYPA 1D2AA 4AUEA 3L7OA 1G17A 3DYIA 1YRLA 4WLNA 1OF1A 4MLZA 4B3HA 3D4OA 3DOJA 3GFQA 4UCQA 3QELA 4Q4HB 4TROA 3WGIA 1EFKA 1YAJA 4LQLA 4Y8VA 4BX9A 2DBRA 2LR0A 3DTNA 2EV9A 1MUUA 4G4IA 3RU2A 4GU5A 2Y4NA 1T2AA 2I6UA 3ZHXA 2Y6VA 2EG5A 3H83A 1YZQA 4TWRA 3BVPA 5JR3A 4OMCA 2OGTA 4BNIA 1C50A 1XEXA 2PFGA 3PEEA 1RRGA 4R6WA 5DSXA 3W5HA 1EFHA 4YV2A 3ECCA 3SEQA 4MJXA 1GPYA 2PO5A 2ZPTX 4XQ0A 4B6RA 2AZXA 4UAGA 2BUBA 4S0XA 3WZMA 1O96A 2A3NA 3RWMB 1HWYA 4R2HA 4XIGS 2QLBA 2LKCA 1QONA 1UMDA 4I6EA 3P71T 1PVVA 4W5NA 4DBVO 1Y63A 4IFBA 4EPXA 5JSQA 3THXA 3NTQA 5A03A 4X7MA 4Y1GA 5AXAA 4BNLA 2CDCA 1NBWB 2I1QA 4RK6A 3ZI4A 3ZTWA 4JASB 4BNNA 2UU9B 2KWIA 2QT0A 1RRKA 3CE9A 4WNAA 1Y1PA 8MHTA 4DLXA 3B9RA 1MG0A 1B26A 1SOUA 2D5AA 3OICA 3IMKA 2AVNA 1GPH1 3WGJA 2PU7A 2WAOA 3HKDB 5J1TB 5CK4A 1NX9A 4AZ0B 4RCVA 4HEJA 2C4KA 3TOZA 3FNBA 1P6XA 1M0SA 2CL0X 2XXJA 3BWVA 3PLRA 4X93A 4J3NA 4B81A 5KVSA 3SXPA 1BX0A 2HPAA 1ZLYA 4RNDB 1QTIA 3CB4A 2ZDQA 5KTKA 3H1FA 1W5BA 1WLYA 4EO7A 1V4NA 3MJTA 3AF0A 3LSTA 3KCNA 3NHYA 1H94A 2FPRA 3NGXA 4RHEA 1I3KA 5ES3A 3STTA 1K8QA 3ACDA 3LWZA 3WNQA 4C7OB 2R86A 4GDFA 3LPCA 1E2FA 1DAKA 1L5LA 4AJ9A 2BEUB 2W8ZA 1XELA 3H0EA 2OB2A 3DFMA 3RKUA 1HZZA 1XFDA 2C29D 2GB4A 1T0BA 4Q4AB 3OSZA 4LTNA 1GRNA 4K6KA 2ZE5A 1IU9A 4EMTA 1WXWA 3QE2A 4WKNA 3K9NA 1G20E 1OA0A 1KJYA 1PUJA 1KY4A 3M5PA 3VZQA 2OY0A 1EEHA 1S8OA 2SBTA 4QYMA 4UOZA 5J2UA 2XCRB 1VSTA 1W2HA 2O2DA 1E98A 4LK2A 4Z86A 1B8VA 2VVTA 3BE4A 3VVLA 1XK7A 2V45A 3HJFA 3D6MA 1EX6A 1Y1KE 4EEKA 2BELA 2QE6A 3WWDA 1N0UA 2JIOA 3C8ZA 1W8IA 1ISRA 3RR2A 2H2IA 3BD8A 1GQYA 1XKLA 4L0CA 3RVNA 1JDPA 3HBJA 3PF9A 3N2YA 3BHMA 1EVZA 5BQXA 1SCNE 1QCCA 2F3QA 3NRBA 5THQA 5CP8A 4DWVA 2XQVA 2F8LA 4HS9A 3QPVA 4AJNA 2YY6A 3B6EA 1XKTA 3HKBA 1NBEA 5L3RA 1QIIA 3IVGA 1F2DA 1NVKA 2VYVD 1LFDB 1HDZA 1MC8A 4HFMA 3U7RA 4P22A 1E2MA 2P11A 1L5FA 3R5KA 1LC3A 4FGSA 1LW6E 3BMNB 5JCJA 4TZ6A 2JCBA 3WLAA 5ALWA 1SKYE 1KAOA 4I8IA 4ZOLB 5IYZB 5BV7A 1TZ2A 1W4BA 4XUCA 1IATA 2V7PA 4K6HA 2V9ZA 4IIUA 4GH5A 3IOMA 3UKOA 2YJTD 2FFAA 1NRIA 1P0FA 1JRLA 3F7MA 3P96A 3V33A 2R44A 5BVHA 4ZAWA 3T35A 3G68A 2B35A 2GFIA 3FVTA 3PCRB 4DUPA 3ZKWB 4FE4A 5FUMA 1WJGA 4YWJA 3KUUA 3L1IA 4RORA 5H81A 3R5TA 1G6OA 1BA2A 2OM2A 3CNOA 4KXFB 1NNUA 1NJ5A 1KNQA 5H7XA 3W5AA 3KQLA 1VL2A 2PSDA 1ITZA 3COZA 4LMAA 4NU5A 4AIRA 3CEJA 4TKLA 4II3A 2GNAA 4B4WA 1XN4A 1Y82A 1H4TA 2OYSA 1LPPA 1XI2A 4MEBA 2YXDA 3ZQJA 3GMTA 4RVCA 1RAGA 2APJA 2R68A 3MJEA 3C5CA 4ZPXA 1OIVA 1QIFA 1IQUA 4K8OA 4ZYWA 3SHQA 4C0HA 3RG2A 2GCOB 4YUAA 4LOHA 4WZ6A 3KKMA 3U3DA 1SHZA 4NFHA 3AUYA 3LZDA 3EXEB 5IAOA 4IJ5A 1MH9A 4ND8A 2GF2A 2EJWA 3FDXA 1H0HA 4FINA 1UFOA 3BHNA 5DNVA 3NT4A 5KSWB 1XL1A 2NUBA 1P33A 1GU0A 3AF3A 3BWCA 4QHTA 4BZQA 1QF7A 4O2BA 5EJ8A 3NJ8A 5DTRA 4EJSC 3WLMA 4RPCA 2VDWB 4TMYA 4D79A 1XCGB 1PEDA 2FHSA 3JVVA 2HA7A 5C1DA 1HE5A 2PMDA 4R1OA 1ZUD1 3CF2A 4GL4A 5K8LA 2VLBA 3RHSA 3VC2A 4E08A 1E1CB 1GV1A 2B7LA 4CLXA 2J3KA 5AVUA 3TN7A 2DUUA 1NM5C 1Y34E 4YJ3B 5ES4B 1SCQA 2ZYIA 2YZMA 3OJOA 3QKRB 2JGKA 2ONYA 4OHPA 2ET6A 4RVUA 4XYEA 4XTCS 5DBIA 4Z0TA 1P3JA 2WVAA 4BV9A 1HV8A 1YR3A 2YZNA 3PGA1 4R3NA 1RVV1 1DIBA 3F6RA 4G4GA 3VU1A 3VXKA 4KIGA 1WPXA 2FSIA 3QVTA 1M2VB 4MMZB 2Z95A 2PX8A 3LX8A 4RGYA 1YZTA 2H29A 3IJRA 2H1RA 3BJIC 2BBTA 3QUCA 1Z2AA 1Z13A 4KBGA 1UC5B 2ZANA 3DZ7B 1HE1C 1RC1A 3IPYA 4FZ3A 2W6JA 3BFKA 1KORA 4M53A 4E5SA 3NHMA 3B1XA 3ELYA 3F3YA 1UBSB 5CFZA 4OO3A 2NZ8A 2YVLA 1M2OA 4KWIA 4O2BF 2W71A 2D6FA 1PEAA 3LDHA 2AOXA 4FFVA 3IESA 1JB1A 1NJ2A 1V6SA 2JJ1D 3EWIA 3HRHA 4F6RB 3B2QA 1K0UA 4B4DA 2INGX 4RTQA 4RQTA 1P0QA 3W5CA 3TX2A 2VBIA 3NUGA 5JJBA 1G21A 4I3GA 3FMFA 3IA7A 5DLQC 4L78A 1T4BA 3O4JA 4KXMA 4REOA 5EIAA 4PNPA 3T38A 3ZVRA 2NTNA 4M1EA 1GQRA 1P4GA 2HOQA 3RYHB 4QXOA 1GJRA 3W1WA 4BU1A 2Z30A 1V8DA 3ONNA 1GUFA 4QYIA 3CRRA 2WHEA 3WTCA 4AM8A 4DAOA 2YZ7A 3FGPA 5INTA 3U5TA 1WKVA 1NASA 4G5HA 3FHJA 3PHGA 3PSHA 1V2GA 2A1TS 2OO5A 4ROSA 5IMBA 3FLMA 2XMDA 1TQ4A 2NYAA 4K9PA 2I8AA 3SZUA 5BWNA 4WCDA 3WB0A 4DWWA 2X8JB 2JW5A 3FYDA 3H65A 1VLHA 3M1LA 4DV4B 4KIFA 1WBDA 4EHHA 2QAGC 5DEIA 1OH8A 2O1SA 4H7JA 2QRJA 2R85A 4M1SA 1IONA 3W9SA 4OAQA 1RM3A 4R5HA 3JWEA 3QWFA 5CH8A 5TSDA 1SU4A 2E87A 3HEBA 1RMTA 2C2WA 2CXQA 4PS1A 4N3AA 3GLRA 1CRPA 3KYIB 3FCOA 4P81A 2CNDA 5SICE 5TVGA 3ZXIA 4QPCA 3GFBA 1W96A 5HIKA 1JW9B 3GP5A 1KMMA 2DPXA 1ZI8A 1BG6A 1DG1G 1ADFA 1JZQA 1ZXXA 3VR5A 5FDFA 3VH2A 1L6RA 3L4SO 2EOAA 2R8ZA 2ZRPA 4MRAA 3OOHA 4OFZA 4C0JA 4XIFA 4Q7QA 4KACA 1B6GA 1GA6A 1PFYA 3L79A 4GC9A 5SYAA 2P8JA 2EBWA 4IDAA 4PIPA 4RTMA 4IQ0A 1TQ2A 4P4SB 1QYVA 1ZKDA 3TVDA 3MCZA 3NFYA 1P2FA 2NO1A 5H0IA 5JSHA 2ASEA 2EKQA 4P36A 2ISSD 4TZTA 5BR4A 1U0GA 1U1IA 4DRXA 3UW1A 1P31A 3NDRA 1FYDA 5E1BA 3SP1A 1QP8A 2YWJA 1YVDA 3BEDA 2Q0QA 2RGUA 4R9SA 4IGKA 4FOLA 3L3BA 5C4GB 1SULA 2OMKA 2XTZA 3T7EA 4ZJYA 3QEMB 3RBAA 2NSLA 1MB9A 2ECPA 2Z1NA 3KYBA 3SZGA 3HDJA 3HR4A 4PCAA 1XLUA 2AF4C 4OB7A 4TSFD 4XFKA 4YCBA 1CJSA 1W29A 4Y2QA 4MIKA 3X0DA 4E11A 4EFMA 1ZOOA 3QUTA 4QGAA 1TTQB 1BC5A 2VNSA 3PEYA 1KEZA 1R5JA 3CLTC 3GJ5A 4O2AB 5JFTA 1M83A 1XMVA 4EHFA 1EGHA 3GRPA 2JH9A 1CUVA 1R6DA 3P2KA 1YZFA 2BONA 2KE5A 5LMUB 3L9XA 1HRDA 1P5ZB 5J9FA 3U44A 2QN3A 5B4TA 2XRMA 1F14A 1HETA 1GZSA 2WF7A 3N87A 3HXPA 3ZE2B 5I9IA 1V8ZA 3LDAA 2P2DA 1K88A 5CT5A 4FLMA 1DAOA 3SC2A 1NI4A 4RNCA 2RG1A 1T4MA 1EWQA 3MJRA 5JH7A 5D01A 5A5VA 4MB0A 2Q6KA 4RENA 3U17A 5G3ZA 5C5IA 5A4KA 2ZUUA 3FCSB 1XCMA 4FZVA 1DAEA 1J09A 3CIFA 1GNTA 1KO8A 1T8WA 3HNOA 4GR4A 2AXQA 2BUCA 5FYQA 4QASA 3KEMA 3CZ5A 8ADHA 2OHIA 4RKYA 4HN9A 1EJ6A 1OT3A 1T4GA 2X22A 2VYND 4KK4A 1U6JA 2QZJA 4QQKA 3D4BA 5C1OA 4LZZA 1LD3A 4NAVA 2FFBA 3WKDA 2FVYA 5ALNA 3CUYA 4UDYX 2MSCB 5H70A 3E58A 1V8OA 1VE3A 2RG7A 3ASVA 3RLIA 2VAWA 3CXUA 2Y1EA 4PWZA 4WOCA 4DA6A 2XHEA 4R68A 4BZZA 4UBLA 2B4KA 3GAZA 4B3RB 1CF9A 3O95A 4BKOA 4EZBA 4LXGA 3UK1A 1ORWA 1I1OA 1MMFB 4BN0A 1F4VA 3TIGA 3SICE 3VU9B 1I5OA 3EC1A 5AWFC 1D8AA 5KVQA 1NLZA 4GSLA 2HX1A 4K1LA 4P92A 3AV0B 1IHUA 2I3ZA 1ZEJA 1GVHA 1W4RA 1UM9A 3BSSA 2O0MA 4JSRA 1KI9A 5H9VA 2P5SA 4GOLD 4XCXA 4KVGA 4CG2A 5JNVA 2FRDC 4QGGA 5AOAA 5L4LA 1ENYA 2AMVA 3N0VA 2IFTA 1I5RA 2BFAA 3C70A 2CJWA 1O9BA 3E8SA 1PEKE 2FFJA 4WKOA 4LWPA 4AL4A 1G7SA 2DYKA 2FPUA 3C3AA 3C7KA 4JSTA 2Y1FA 4XUDA 5FNVB 1X7WB 4P4NA 4E1VA 4ML3A 2XDAA 4HLNA 2C77A 1T2FA 3SMQA 1XLWA 4AYWA 1MO4A 1UIMA 4C7KA 2OLJA 5JDIA 1A96A 1NC1A 2D8MA 2O4CA 2JVIA 3NTRA 1GARA 1LSSA 1CUJA 1VGVA 3AKYA 3D9QX 4X97A 1HDOA 2W98A 5CIWA 3D0KA 5TVOB 4N5IX 2O8FB 2PUEA 3K0KA 3S2GA 5JPDA 5DNAA 1RP1A 5BYKA 1QH8B 3BMQA 4Q24A 2ZDHA 3K2QA 2P3QA 3TAHA 4YAGA 4WA8A 5BYAA 5JEEA 3QLUA 4HMPA 4M0LA 4MZDA 5EZYB 3ZBUA 1QHFA 1Y6GA 1F1BA 1G21B 1A88A 1U81A 2QVCA 1DOHA 4FWBA 4URHA 2PT6A 3TQHA 2CC2A 4A8PA 4EJMA 5EGNA 4V3BA 4DTCA 3SIWA 4FB4A 1AGPA 1QRDA 4DUYB 3C3MA 4RACA 3BXOA 4RH3A 1GO2A 1KJJA 2HA5A 1W4AA 4WLUA 1DTWB 4IQ8A 4HD8A 1L5KA 3KVYA 4MH0R 1AOXA 4KMSA 1P6QA 4Q1EA 4QTZA 1P2GA 1QK3A 3AUAA 3ROXA 3I0MA 2ECOA 4R1MA 4NZPA 4BNXA 3EUFA 1Z3IX 3GRAA 2FB9A 4L15A 3NG1A 4M6WA 3JRWA 4WGFA 5I7WA 4X00A 4DCVA 3UWOA 1HL7A 3NVAA 3K73O 4TTPA 3EN0A 4QICA 3CSSA 5EZSA 1XUOA 4PYMA 5A7GA 3QXGA 3SZOA 1JWLA 1J8QA 2JFGA 2P79A 1H9AA 3G2JA 2PKCA 1BHO1 1GUDA 1Y37A 3KEOA 2K6GA 3PF8A 4MUIA 5EUMA 4CMGA 4DLWA 4H1WA 3BDVA 2NPOA 2UVPB 3IQEA 3HUTA 3PPXA 1BE1A 5DLYA 3OO0A 2FW7A 2QOEA 4Q3BA 4RV9A 3DEZA 1N3BA 1P0CA 4Q3OA 5E8RA 1H5NA 2JJ2D 2PWYA 3T7AA 4LW8A 1U0EA 1AMOA 4JENA 2EX0A 4MVJE 1Y7TA 3WB9A 2P6MA 1BEEA 3ZVMA 3ILVA 4DG8A 1XTVA 1MOZA 3C4JA 4GVPA 4UE6A 1EJBA 1SH7A 4M55A 2Q4BA 4MS3B 2BOVA 3GRCA 1EK5A 4X6YA 2J7PD 3G2HA 3IALA 3WGKA 2DUWA 2I1VB 3M6XA 1SU6A 2AUNA 4MV6A 2C3MA 4TL8A 2XUFA 2GZ3A 4BJHB 5DLDA 5KNBA 4L1KA 4DLAA 3DP9A 1XJWA 3EGDA 4KPUB 5IVDA 2A5JA 2CVPA 3P19A 3DZ2B 3MFQA 1YQEA 5IWCA 1WD7A 4UUPA 3ID6C 4I1YA 1SXJC 1S02A 5E1OA 3ESQA 1YBVA 1FNCA 1O87A 1Y4UA 5T8KA 5BSEA 4XM0A 4AWBA 1L5YA 4R31A 4YO7A 4YT4A 1MJ5A 2G5TA 2B0JA 1NRWA 1VL1A 3UMFA 2ZIZA 4RTRA 1SN7A 2OHGA 4JI4B 2OC9A 5FP0A 2YVKA 5JMWA 2WJVA 3U81A 3GLGE 2O8EB 1ORDA 2PBRA 3FW1A 2NU6B 5THXA 3EZ6A 1EXMA 4PANA 1DEKA 1UJBA 3BSYA 3BMXA 3AVVA 1ESNA 4WOBA 2UZ3A 3DVLA 2BVNA 3FKQA 3DZKA 5JS6A 1WETA 2D7CA 3TGPA 4BVGA 3UAYA 2C2OA 1BMTA 3OCXA 1HE2A 1Z8FA 3FWKA 3QG1A 2JNWA 3INTA 4MWTA 2XRFA 1EUCB 1PL8A 3MGAA 1E1QD 4J7CA 4KGZA 2IX3A 2WB2A 2DAPA 2AE2A 4EX7A 5ALUA 2WILA 4C4ZA 1IXKA 1E2JA 5JXGA 3TLBA 2UXDB 1P4RA 4GHWA 2R65A 4D96A 4F91B 4G0ZA 2QL5A 1LJLA 4Y2JA 4NBSA 4AF8A 4EELA 1TMYA 2ZJ0A 1EUDA 1RRPA 4HNTA 5WRFA 3U62A 5JCZA 2H57A 5HP4A 4FDTA 2XADA 2QIOA 3PDWA 4J0GA 3SQNA 1NX6A 2H7YA 1IWPB 1GG2A 2IS2A 4JY7A 3T52A 2ISQA 1JAYA 1Q83A 5D6NA 4MCJA 3C6MA 3BAZA 3GD7A 5AKGA 4LFCB 1W48A 1UBCA 2JD2A 1ACMA 1FTNA 4J2OA 2FG6C 4BEBA 4H4CA 4IJWA 4EB6B 4MKHA 2P4QA 3NH9A 1I94B 3C0KA 5AHWA 1J20A 1X8JA 1EFTA 1S3IA 3QXXA 4L3VA 5F98A 5J1SB 4IWYA 4KYUA 4TV8B 5U4XA 1QFYA 2RGBA 3HN7A 3B7PA 2UYQA 3JQCA 1KH2A 3HGQA 2WSYB 1L7QA 1FXWF 2X3UA 4Q4LA 3E1KA 1L7DA 4JYPA 2WF6A 1IQ0A 2BKLA 2OAQ1 2BFCB 1JZTA 2C5GA 3OD5A 4RA6A 5KSYA 3LHDA 4PLZA 2X7JA 2I66A 4RLSA 4ARZB 3FWPA 3OHMA 2RGRA 3GUZA 3GRVA 3RVQA 2I2AA 1MC4A 3UMSA 5B6JA 1U7WA 4K88A 2QTGA 1D1QA 4PSDA 1ZJJA 3RFVA 5HX7A 1W4CA 4K9SA 1ZM2A 3GVPA 3OE7D 2RIPA 1M2JA 4HQKA 2JI8A 5CH3A 1KDTA 1E77A 5F4ZA 2EIXA 2PCJA 5AH0A 2CZQA 1V48A 1P1RA 3A9RA 4IUDS 3DE5X 4JYMA 3VJLA 4EAQA 4RXTA 3L41A 5HQJA 1S7GA 1TTHA 2BFBB 2NTJA 3AEQA 3LRPA 5FPKA 1AQJA 2JLYA 5EC8A 4ZO6A 3M83A 1JR3E 5DVZA 3EPHA 3GRZA 3PUJA 4E33A 5JASA 2RGEA 3WP1B 1PDOA 4HBGA 1PO7A 4QJIA 1ZCBA 4B3JA 1PNVA 2EG9A 1GN9A 3BEOA 3STWA 1UK7A 1QYWA 2Y1LA 3QEKA 4I66A 4PGHA 1UPBA 3T1TA 1LFAA 3RV3A 4OHYA 3RUAA 4OQPA 2OXEA 4AUMA 5HXAA 1O4VA 1E7SA 1USUA 4OM8A 5HRAA 4GPBA 3IBGA 2QQEA 3MMNA 5H3HA 4EG6A 4OUDB 2Q6TA 3ROTA 3B38A 1FYXA 1RBMA 5F35A 3N6VA 4UATA 8ATCA 3I8SA 5DYWA 821PA 1ZSYA 3U7QB 1YBAA 4H1UA 2F6RA 3H9BA 3P0FA 5IX8A 1ZO8A 5K7SA 1PNRA 2PX4A 1OFGA 2JBWA 1QGDA 5I47A 4XQ9A 1C3VA 2II6A 2AG8A 1RRCA 4DWOA 1NTRA 2WSMA 3TNJA 2BFOA 3QQPA 4ZVKA 3MJSA 3IQIX 5I8ZA 1VGQA 2VNIA 3C6YA 4YRJA 2GXQA 3D54D 1C7ZA 3RUHA 4RDHA 1UBLS 3UFXA 4DDKA 1RQRA 3CWZA 3WYGA 1OVMA 4DHWA 1I1HA 4JL5A 2A0YA 3Q2KA 1D2RA 5FF9A 3WC4A 2OWEA 3K31A 1E3DA 1SU8A 2ATXA 3KSMA 5IKOA 1AMNA 2IH2A 1AV6A 3KQYA 5TNXA 1HX7A 1EI9A 4CU5A 1U7ZA 4Q9AA 4QFCA 5BNFA 3ABQB 2IYSA 3M8KA 4CT4B 1JFFA 1LVHA 1YFJA 2J9YB 4GX5A 2W6NA 5ANRB 2JAHA 2A9OA 1AKNA 3FDJA 1IRXA 3ZEAA 5K0NA 3V5NA 2QEQA 3CRMA 1SVOA 5ERYA 4ZWNA 1ZD3A 2F1JA 3ZUPA 5IDQA 1E58A 3S2YA 1QIKA 1S5PA 4WK4B 4AZTA 1E1YA 1NT4A 1H0KA 1FP4A 4RZ2A 3MBOA 3VPDA 3QE0A 2J3EA 3CN7A 1W88B 4MQMA 2JIZD 2L2QA 3K53A 5NLLA 3PQ6A 4N6NA 5AP9A 5MN5A 4FN4A 1UINA 3WLRA 4XQCA 5CLQA 1G2IA 1L9XA 1I7LA 2PRJA 3UIEA 4HK4A 3GUCA 1HYBA 3I53A 16PKA 5HIIA 3SBDA 4BNZA 4BEJA 4QFDA 2JIPA 5B3JA 1R6UA 3K16A 4X84A 3UV3A 4OQYA 1ZK3A 4B2LA 4PGAA 4FB5A 1XTQA 1PDVA 1QSGA 2CVFA 3DCJA 3EGXA 3FPSA 1D6SA 3K0AB 2Q7OE 3IQHX 1Y4ZA 1SBIA 5C1PA 3ZIDA 4H7KA 1C30B 1LNZA 1ORIA 2JHAA 4PYQA 1QGZA 2GZAA 3IP3A 3GJ4A 1ISHA 5ALKA 4JK3A 3R0XA 1KKMA 3B3FA 1NNEA 4XEUA 1F0YA 3PI6A 4ZEWA 2FU5C 4YLEA 4DVGA 3K94A 2VP6A 2DEUA 3MQFA 1N3IA 2ZDGA 3HUEA 4KFUA 4Q7EA 2YXNA 1E66A 5JAHA 1EVJA 2FJ0A 2HMTA 2SKEA 4A1OA 3ZCPA 2RIRA 3QVSA 3QJGA 4Z1MD 1OH5A 3DZFA 2PLFA 4NOJA 1YBMA 4CNQA 4RULA 1Q50A 4C14A 5H82A 2J9XB 1VM6A 3IEIA 3OQOA 1FLNA 2EL9A 5SZHB 3IEPA 1LZKA 2FCRA 2ENUA 1UOOA 2FMIA 2ODBA 2OO7A 3BXPA 1UFVA 3B7WA 4TWBA 3M6FA 4X91A 5HR5A 3IKTA 4EF4A 3FXAA 1XNHA 4N8DA 3CM0A 2ZI5A 3QSYA 3RTBA 2ZYHA 3DL4A 4WDQA 3PC8C 1KRWA 2QX9A 3EVEA 1XR3A 4Q1CA 2O7NA 5BVHB 3JYOA 4FE7A 3FHTA 3A6GA 3HEAA 5ESDA 4PO1A 3EZFA 4G0OA 1SK9A 4OV6B 1JFRA 4I7EA 3DC2A 4ZVMA 3ZHTA 5DULA 1SG0A 1ST2A 2Z3VA 3DMFA 3LFHA 4H0FA 3OQIA 4PIMA 4PM4A 4HI0E 4MUXA 2J9FA 2YHUA 3ER6A 1A98A 3IAS6 3MWYW 3LLUA 4NOMA 4ALLA 3EIXA 2XE4A 3FYUA 4CIAA 4DTIA 2BDTA 2OT3B 2WJAA 1AGYA 4M0EA 5EIEA 2XJ4A 5EJFA 3U7GA 1YIAA 4Z4IA 3ADOA 3NORA 1B93A 1NT2A 5HM8A 3BWBA 4HLUC 4W99A 3U5ZB 1JYEA 4Z9AA 3DDUA 3HO8A 5KBYA 4LZNA 4AD8A 4ENVA 3ZYCA 4AY5A 2IU0A 4M8KA 4K2HA 4CM9D 1Q92A 3OOEA 4WADA 1WXEA 3C6ZA 2R5NA 4MA0A 5IKEA 4LF7B 5JADA 2C07A 4KNVA 5AFSA 2W2KB 4PCUA 4QDXA 3X2SA 4DWJA 3OMLA 4K8RB 2OV6A 3EQ2A 4MDEA 2WTNA 1W1IA 2O50A 4F4UA 4B43A 2TMKA 2JCGA 3DWGA 4U2CA 2YY7A 5E6UB 3RRMA 2ERXA 3QBTA 4LUCA 4PTZA 4KR2A 1A2BA 3D7RA 4GRDA 1ZIOA 2B0CA 3ZDCA 2VUUA 3GVCA 5LQDA 5LBTA 2PZGA 1SC3A 3VPSA 2F9FA 4V0SA 3DV0A 3UK2A 4HQLA 5AW3A 3SDSA 3SLGA 1ZZGA 5DBOA 2VDVE 1THTA 2R11A 1AHPA 3D6UA 1L5HA 1T8RA 3S8MA 3HGMA 2XA1A 4GPTA 4MV0A 3OESA 2A59A 1RMYA 2XDWA 3NO4A 5DM2A 1NSYA 3V7NA 4CBVA 1LUAA 4A0RA 3MYRA 4MAMA 5BQPA 4KI0A 1IEWA 3IDSA 2ZVPX 3A1EA 4L74A 4E22A 3QWIA 4DL9A 4D0SA 2VAMA 3E7PA 4MWOA 1ETHA 3LGSA 4MVJP 3MHTA 5A9SB 2YWGA 4X1YA 4A6XA 3TJMA 1O08A 4RF4A 2OBNA 2QT9A 3KB6A 2QXYA 1KOLA 3VPHA 4IMIB 2OCGA 1C1HA 4Z9FA 2ZUWA 3U19A 1J1UA 2NADA 4L4SA 2FA9A 2BMDA 3IO5A 3VX4A 4CF6A 5AVXA 2QTCA 4MJLA 3EVNA 2J33A 1N6HA 4F9TA 3OU6A 1X1AA 1O8CA 1U5AA 4EUKA 3C8HA 3TE6A 4LF5B 1PR3A 4A6PA 1UYJA 2XOXA 3FZYA 1JIUA 1C0IA 1JR2A 1WB5A 3G1TA 2FQYA 2DC1A 3SN6A 5JMTA 4K9NA 1SQSA 2H5LA 3SEAA 1TVKB 3RS5A 4F93B 1GFSA 3RODA 4B7AA 1IOVA 2I4RA 2FR8A 4GRAA 4PONA 3RC2A 2PGXA 3AFOA 4GNRA 4L7QA 4D4GA 5J2TB 4YMLA 3AL3A 3EW9A 3AIMA 1PHPA 3U3OA 1EFLA 1UWVA 2JJMA 4IILA 4NRDA 1T0JB 3ZV5A 2XXAB 3EPAB 2NQ2C 3AUSA 1N2HA 4E03A 5K5EA 1V5FA 4RDCA 1EWRA 1GXSA 3U1VA 3UICA 2J9ZB 4R2KA 2ISCA 2Z6AA 1MW8X 3DEFA 4D44A 5JXHA 1BN7A 3AF4A 4O0LA 3H1BA 3LFTA 4PY2A 1EK0A 3UJHA 2I55A 1C30A 1H5QA 4PPGA 4ECAA 5BP7A 1QUFA 3KOWA 3WNVA 5FAXA 2QRNA 5DIZA 5B55A 2XE8A 1K8ZB 4NESA 3HLTA 4RVDA 4KU4A 1DT3A 4E3WA 2RHDA 5CM9C 3E18A 1RXIA 3WBBA 3D1JA 1GY8A 1A1VA 1U28C 3J81A 3CUKA 1ZP6A 2CK3A 3STXA 4F8YA 2E5WA 2G1JA 1QDLB 2MYUA 2YJ5A 2IP4A 3IIMA 4CFYA 2XKJE 1N25A 1C9YA 4NTZA 3WLEA 4OREX 1BH6A 3ZHQA 2ZE8A 5JSZB 4PZLA 4GR9A 4P35A 5D3QA 4OQFA 5JXWA 2WICA 3AKZA 1T5OA 2C2ZA 1U2GA 4X9XA 4OVKA 5FOQA 3Q2IA 2HU2A 3PRYA 4RGVA 3UAOA 1RHQA 4NENB 4TL6A 4MR7B 4I4LA 2CJFA 2E37A 1PV1A 1BX3A 2WU4A 3L8YA 3P9NA 3VOTA 4GLFA 2R62A 5JSKA 2VHQA 4LDAA 5JD3A 3U9SA 1N57A 3ZWDA 3TQQA 2BEWB 4BWVA 1Y9DA 4E2WA 3URMA 2C7VA 2XW6A 4CCSA 4F72A 1DX9A 3QF4B 2OO5C 4EG0A 4DV1B 2RAVA 1ZAYA 2O7VA 3JW8A 2DUJA 1QTRA 1L0BA 2EFYA 4I9UA 3L92A 4I14A 2WQ7A 1VE9A 2HCFA 1XE3A 1ESDA 1YQ9A 4MVJF 4EQ6B 3HV0A 1C9EA 4N39A 3RVKA 5KYWB 3E3OA 5CX1A 3QXHA 4G01B 2XQKA 2OQVA 5AVWA 2HT1A 3PDHA 4NPCA 3AMVA 4LGCA 4HADA 4MPRA 2G88A 1E3MA 1XVUA 1U90A 1ABFA 1WY7A 1FRVA 2JZNA 1KSHA 4DA0A 4JHLA 2EKDA 3VO1A 1TGVA 4J03A 3BH7A 3HKCA 4PSAA 2OBFA 3RRJA 3CEPB 1CC1S 3WLTA 2XUHA 3BGDA 1TYAE 3RCBA 5FPTA 3RAJA 1NLFA 3CV3A 4JA2A 2DY0A 4KO8A 1MW9X 3O47A 4M1ZA 4R8RA 4U8HA 2REOA 5G40A 5IJAA 4EYGA 3GDHA 1C7JA 4U8GA 4F38A 1WM1A 1OXKB 1W59A 2IE8A 1G7RA 1IJBA 1BW9A 2HJVA 3NOVA 4ALIA 4C08A 2YS6A 3NBXX 3OY2A 4W7HA 1TFUA 4G0NA 5HE9A 2IIBA 5C34B 4LF9B 4PEVA 1CZNA 2OSVA 5BWCA 4G97A 2GK7A 2YWHA 1Z5GA 1ZS9A 3L0IB 4KSYA 4LJ8A 2AZTA 3IMEA 1G9SA 4Q3CA 1VKNA 3O4IA 4W1RA 4PRYA 2WNHA 1ENOA 1IG3A 2JGDB 1Y3HA 2PQ6A 4HLDA 3FYCA 3AEKA 4LNHA 2YIJA 1T3GA 3R3YA 4RKRA 2Z9CA 4D2IA 1FVHA 2QBYA 1VPEA 1Z5UA 4D8YA 3NBQA 1FK8A 5KQLA 2FPIA 4MHTA 1P7VA 2AJLI 3JQ8B 1J22A 4UMEA 2FQ1A 1Y4DE 1KFBB 1Z6PA 2G1AA 2Q2WA 2R6DA 1F0PA 3GLKA 3LQYA 4K87A 1XXHE 4TM7A 3V9AA 1ULTA 1FRQA 2HBZA 2A5YB 5CUQA 3GEPA 3WI7A 2OD2A 1R7RA 4PG6A 1JHOA 2CNBA 2QXTA 3ZY5A 1C7QA 1LV7A 1E1RD 1L6IA 1SUWA 4FS8A 4ZARA 5HIMA 4A1FA 3U7HB 4CLRA 4KDEA 3NJ4A 4BO2A 5AI6A 4U9IS 2EATA 3QFHA 4TVOA 2QLMA 4BVFA 3KUXA 4NK4A 9LDBA 3QFSA 3NHUA 3P9YA 4I19A 4C4OA 2WUVA 4EGQA 3AL2A 4C04A 4TTIA 5AW6A 1T91A 1Z0AA 3USZA 3IQFA 1M2KA 3NHPA 1WQ1R 1T9BA 4D02A 4CDMA 2DY1A 2ZGVA 4NNJA 5FTLA 2O14A 4NMLA 1LC0A 3PYMA 2VF2A 3G02A 1AHIA 1XEWY 3PCXA 5CDHA 4S1WA 5L8VA 4X1KA 4Z2YA 1QWSA 5FJIA 2Z2YA 3PI7A 3UGQA 5T5QA 2FRVA 3H3XA 4W4TA 3NC4A 2COUA 3FR8A 3K6JA 4BRZA