4EWHA

Co-crystal structure of ack1 with inhibitor
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
275
structure length
274
Chain Sequence
LTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and optimization of substituted furo[2,3-d]-pyrimidin-4-amines and 7H-pyrrolo[2,3-d]pyrimidin-4-amines as ACK1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Activated CDC42 kinase 1
total genus 78
structure length 274
sequence length 275
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ewhA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ewhA01
3HV4A 3OCTA 2JLDA 5F20A 2C47A 3R0TA 5HE0A 2V0DA 2PVMA 1CTPE 3MPAA 4I5MA 4IWOA 4EEVA 4EK3A 1YXVA 3LJ0A 4BCQA 1UKIA 4BKYA 3EQCA 4D1XA 2BROA 2ERZE 5HIBA 3UTOA 4P7EA 4CYIA 5DVRA 2EB2A 1ZOGA 3DBFA 5L6WL 4O27B 5JT2A 2XUUA 3EZRA 4DEGA 3ZH8A 3SXSA 2XK7A 4A9TA 2X2MA 5IISA 3GVUA 5DPVA 5AR2A 5D7VA 4AZFA 2E2BA 4J95A 2PK9A 3F66A 2C68A 4UZDA 1OPKA 3QRIA 4FKWA 4BCHA 3QTSA 3S00A 1JBPE 3EN6A 4II5A 3UIBA 4GUBA 4PTGA 1R3CA 3FLSA 3V8WA 3UP7A 5JGAA 3H4JA 4GMYA 4NZWB 4JAJA 4FV5A 5GZAA 2A1AB 4HYUA 4FTOA 4O7RA 2Z60A 3JVSA 4TNDA 3HUCA 4RWJA 3D5UA 5AX9A 2UZUE 4QMXA 4CMOA 4KNBA 5DT4A 3KCKA 3RAIA 4C4JA 4JOAA 5DRBA 1ND4A 4JX7A 3QL8A 3QWJA 4DITA 4BDBA 3KGAA 3BYMA 4MD9E 4Y95A 5HU3A 4KSQA 4CFWA 3F61A 1LUFA 4EHGA 1V0OA 3CC6A 3LE6A 4RX5A 5AR8A 4EQUA 4QQ5A 3N4TA 2G2IA 1WBOA 4FIGA 2XIXA 5KMIA 4RVMA 2QG7A 3NUUA 2XK4A 3MH3A 3PFQA 5EOBA 3F3TA 2YCSA 3TT0A 2XMYA 3FUPA 3AD6A 2YCQA 2QO7A 5CU2A 1PXKA 2IO6A 4IFGA 4XBUA 5JEBA 4TZRA 2QU6A 4IDTA 1FQ1B 1YDTE 4IJ9A 2C1BA 3A60A 1URWA 4NM5A 1IEPA 2OZAB 3CJFA 4QOXA 2I0HA 4BN1A 4CEGA 4EK8A 4EJ7A 2YA9A 3HDMA 4GS6A 4BB4A 2ZDUA 5M53A 4ZY6A 1Q5KA 3U54A 2R4BA 2YCFA 4FV4A 4GYGA 4RIWB 1LEWA 5M4UA 4FT3A 4J1RA 3ZM9A 5IA4A 2E9PA 3TTJA 3DDPA 5DGZA 4FA2A 4I5PA 2BAQA 4B99A 2FB8A 3QUEA 4W9WA 2QLQA 3C0HA 4LGHA 5EKNA 3TNIA 4FTLA 4DEIA 5LVLA 5AIKA 4PTCA 3PY1A 3DTCA 2XNNA 2O8YA 4X6QC 4PF4A 5AR7A 1U5RA 3ETAA 3GCSA 3R2BA 5B7VA 3OOMA 4F70A 4QQJA 4F4PA 2GQSA 5CT0A 3FKLA 3OUNB 4TWOA 4L8MA 3ZUUA 2OFVA 3A8WA 2JIVA 1UNGA 1V0PA 3Q9XA 4LRMA 3KQ7A 4FT9A 4ZP5A 1YDSE 3CTQA 2XM8A 4FKSA 3ZZEA 4EH7A 4RFZA 5BVDA 1B38A 4JLCA 3FMEA 3GCPA 3FY0A 3SG9A 3A2CA 2PHKA 3KRXA 3F3WA 5IEYA 2IPXA 4GT4A 5CU0A 4X0MA 2UZBA 3TTIA 3KVXA 4LG4A 3OY1A 3TEIA 4G3FA 4IB1A 1H1QA 1OM1A 2R5TA 4WA9A 3AGLA 2PMIA 3NLBA 4HPUE 4M15A 2OO8X 4N4SA 4GT3A 2YDKA 2J5EA 3FL5A 5LWNA 1G5SA 3DOGA 5K4JA 1VYZA 3EZVA 4J96A 3P08A 3Q2MA 3PXZA 3I6WA 3SQQA 4BHZA 4PMSA 3T9TA 4DEHA 3UO5A 3E8EA 2R7BA 4NL0A 4Q9SA 3DK7A 2W5AA 3QTXA 5CAQA 1XH8A 3PXFA 1LEZA 1RJBA 2WB8A 5CEMA 3V6SA 5AUYA 2IW9A 4QP7A 2C30A 3HMOA 3K3JA 3EFWA 3MVLA 5TO8A 5IPJA 2YLFA 2UZTA 4EK5A 2XEYA 4N0SA 4OUCA 2V55A 3QWKA 5CY3A 3VNTA 4U9AA 4YR8A 5BNJA 3F2NA 3ZRMA 4O6LA 4PL3A 4BI1A 2UW3A 3MA6A 5BVEA 3DAJA 4IADA 5CX9A 4DGLC 2PMLX 3D15A 4BBFA 4KIOA 4BCGA 5IDNA 4F65A 2J0KA 2V62A 5HTCA 3MPTA 3ZXZA 3NIEA 2OGVA 4H36A 4ANLA 2Z8CA 3FLZA 3VBXA 5FP6A 3PA4A 2FYSA 4FT5A 3DAKA 4GCJA 5ETFA 1H1PA 4FNWA 3V5TA 2NNWB 3O71A 2RKUA 4PP9A 5ETCA 3DZQA 2W1EA 4AS0A 3WZUA 2XK9A 4YJQA 4GRBA 2PU8A 1XH7A 2QODA 3MDYA 4FTJA 3GI3A 1REJA 3E8CA 1ZMUA 3U51A 3DTWA 3TZMA 2CNUA 4YO4A 2I1MA 4YNEA 5FM3A 2CCIA 2GTMA 3EQIA 4UWYA 4BTMA 3L9PA 3KN6A 3PJ8A 3FI4A 3SAYA 4BKJA 3KC3A 5AV1A 3CIKA 4IZAA 4IVCA 3HMNA 5LOHA 2UW6A 5AP1A 4L00A 2BDJA 3MY5A 3OD6X 3IGGA 1SZMA 3RKBA 3DV3A 4BL1A 2C0IA 4BTFA 3EQHA 3FKNA 3ZOSA 5L6OA 5E90A 3PJ3A 2VWVA 2GNGA 4O7TA 3Q4ZA 4RLKA 1NVSA 3AC3A 5FLFA 2A27A 2CHLA 3DA6A 3LFNA 4PP7A 4D5HA 3FMJA 1ZZLA 3VUIA 4D28A 4UMUA 4C4GA 5IUHA 3MIAA 3RJCA 2ZVAA 5KNJA 4ANSA 3MPMA 1R78A 1S9JA 3C13A 1UU7A 5AV4A 3MH1A 4OTDA 4XP0A 3AC2A 4JRNA 4Z16A 2QOHA 4FBXA 4FIIA 4RQVA 3C5UA 3ERKA 5CNNA 4C61A 2XCKA 3HKOA 3OBGA 4MBLA 5HVYA 5FTOA 4C02A 5IQGA 3EB0A 4O0YA 4YZBA 3S3IA 4LQMA 4OTQA 4CV8A 2FVDA 3SDJA 1NT2A 2ZOQA 1WBTA 2PYWA 3DBDA 4FV1A 4KS7A 2ZV2A 3OCSA 5FTGA 2CMWA 3VJNA 2WELA 2WQEA 4I93A 1ZOEA 4OTPA 2RL5A 3GU6A 5CTPA 5A54A 2AC5A 2LAVA 4BBMA 4QMNA 2J90A 2ONLC 4AW2A 4ZTLA 4I41A 3MSSA 2IVUA 2QOOA 2C5OA 3CPBA 3PVUA 4FKUA 3P23A 4EL9A 2O5KA 5G6VA 4YTCA 4BYIA 4QMWA 5IA0A 3KXZA 4KBKA 2WTKB 1H1WA 4LUEA 5I9YA 1WVYA 5LVMA 4B6LA 1Q97A 1QL6A 4L7SA 3N9XA 2X39A 3FL4A 3UG2A 4XP3A 4AW1A 4U0IA 3NNXA 2EU9A 4FT7A 4O2ZA 3SKCA 4CV9A 2W05A 2YM8A 4EOLA 3MFUA 4E3CA 2C5NA 4G9CA 5KMNA 1OL2A 3BE9A 4QMPA 5E8ZA 3QQGA 1ZWSA 2RIOA 5CU6A 1J7UA 4RA5A 4FVQA 5I9WA 3C4EA 3TV4A 2ERKA 3OXTA 2QNJA 4QTDA 2XH5A 4BCPA 1OI9A 4FZAB 4C8BA 3MI9A 3R7GA 3C5IA 2BRGA 3T3UA 2I7QA 5CSVA 3WF7A 4MF0A 5C01A 2PVLA 5GHVA 4EH5A 3UO6A 4XJ0A 1SMHA 3VQHA 3CE3A 3KVWA 4AF3A 3OZ6A 4YPDA 3PLAE 4M84A 1CKIA 3G6GA 2BIKB 3C4FA 2V7OA 1Q24A 4IJPA 5CZIA 4J8NA 5HG8A 5L2WA 3LMIA 2ITVA 1MQ4A 2CLXA 3QTWA 2XYUA 4BHNA 1DS5A 4BVUA 2RF9A 5IKWA 2O3PA 3E5AA 2O0UA 3R22A 3UNZA 5HD4A 3PVGA 2CNVA 2X8DA 4ACHA 4BDKA 1QPEA 2BMCA 4RFMA 1NVQA 4GW8A 1JSTA 3HA6A 2Y9QA 5E9EA 5FEQA 1XH6A 2P33A 4YMJA 5JQ8A 5IA5A 4KINA 1H25A 4NFNA 3UC3A 4F9CA 2PUPA 4P5QA 3F69A 2B9HA 5IF1A 2QOLA 3L8PA 3ORKA 4AT4A 4ZJVA 4IM2A 3PJCA 4NFMA 5T68A 1FINA 4E1ZA 2VU3A 5I3RA 5HZNA 3BZ3A 4BIBA 1BKXA 3MB6A 4HCTA 3CY3A 3TI1A 4U44A 3V5PA 1QPDA 4ZXTA 4KSPA 4QMMA 5E92A 4CCBA 3U87A 1EH4A 2W1DA 3FBVA 4UMPA 4HPTE 5FTQA 4AAAA 2ZV9A 5AEPA 4BTJA 2GNIA 2P0CA 4XX9A 3NRMA 3TZ8A 4L68A 2JAMA 4LV8A 4FEUA 3PIXA 4APCA 4PL4A 4UB7A 2HIWA 4GIIA 3TZ9A 4JRVA 4NUSA 4K8AA 4M0ZA 2GS7A 1VZOA 4N6ZA 4W4VA 1Q3WA 1WVWA 4CZTA 5AAEA 2VO3A 4Y5HA 5D41A 3EL7A 2ZMDA 2GS6A 4A9SA 4IAKA 2OW3A 3LIJA 4RFYA 3SXFA 5FDPA 4JQ8A 3H9FA 2CKPA 2G01A 2HY0A 2PE1A 4EK6A 2WTDA 1ZXEA 3VF8A 4CFVA 1STCE 1Q41A 4W8EA 5TT7A 4HGTA 3V01A 4WNMA 4NYEA 4XV9A 4QQTA 3QA0A 4DFXE 3SVVA 3EFLA 1YHVA 4J97A 4G6NA 4RT7A 4HW7A 3H9OA 3W2CA 3PRFA 5T3QA 3UDBA 4BCJA 1OL6A 3DT1A 3TKUA 3TACA 3WF6A 3IDBA 2PUIA 2QHMA 3D14A 3IW4A 4IXPA 4U5JA 3EWHA 4E4NA 5J87A 3EQGA 4G17A 3S4QA 1H01A 4AUAA 5AJQA 3JPVA 1YXXA 2Z7LA 4QPMA 4C4HA 3MESA 3PWDA 3TNHA 5K9IA 2PPQA 1YOJA 2PVYA 4YZCA 5HG9A 2C6IA 4F9WA 2VTIA 4OGRA 4YJOA 5CVFA 3IPHA 3K54A 5LVOA 1YI6A 1HCLA 4JBQA 3LFFA 2C3JA 3ZYAA 3ET7A 3DK6A 2Z7SA 1U54A 3FLYA 5H8BA 2WTIA 2UW5A 2J0JA 1P5EA 3NCGA 4FG7A 4O0WA 5FG8A 3AC4A 4O82A 4LRJA 3NW7A 4KKHA 4BCKA 5C27A 3TCPA 3UZRA 3O8UA 3RHKA 4OBPA 4O7VA 3UQCA 3DB6A 4HVHA 2YM6A 2QOQA 4MQ1A 2V22A 3LM5A 3QQFA 3NNVA 1UWJA 1NVRA 3VUKA 5KMMA 2GNHA 3H30A 3DNEA 4I24A 4ASXA 3F5UA 4IX4A 3L9MA 1OMWA 3V6RA 4YC8A 3EIDA 2XBJA 4ZY4A 4G9RA 3FJQE 2FH9A 3BYVA 2JDVA 4TRLA 4U97A 3AC1A 3CD3A 4FG9A 1J7LA 3TDWA 5IDPA 2YM7A 5EH0A 1FGKA 4ZSLA 5TF9A 4AZSA 2JDRA 1W84A 4FL3A 5EM8A 4GU6A 3FYJX 3QRJA 2YIXA 3LW0A 4M69A 4RX8A 2UW0A 3PVWA 2WIPA 3RCJA 4MNFA 5KMOA 3PYYA 3VHKA 1W82A 4CQEA 5FD2A 4K9YA 3O96A 2PZ5A 3BELA 5HLPA 1G3NA 3R8LA 2XB7A 5CLPA 4PTEA 5CF6A 4JG7A 5EHLA 4I4FA 2X9FA 3KXMA 3HV6A 3NYXA 5D1JA 4FIJA 1BYGA 3CD8A 2JDTA 3MH2A 4FSMA 4ZJJA 1OKVA 1ZMWA 3AG9A 4IWDA 4AGDA 3DNDA 1P14A 2OZOA 2HW6A 2WD1A 3QD4A 2GDOA 4CCUA 4F7JA 4GKIA 3NMUF 4XUFA 4MF1A 4K77A 3HMIA 3KF7A 2B9IA 3NUYA 4ALVA 2JDOA 3NYNA 4KBCA 4E20A 1UV5A 2J0LA 3ZLYA 5KO1A 4DG2E 4RJ8A 3R01A 5HESA 1UU9A 4U43A 4ZTHA 3VUDA 3GBZA 1CSNA 5AM7A 3P7AA 3PRIA 4M14A 5EW8A 3G15A 4EOPA 2GNLA 3ZO2A 3NWWA 4FIEA 5IQEA 1ZYSA 3CXWA 2OJFE 3TJDA 4I6BA 5JQ5A 4FSNA 2P55A 1TQPA 2W1CA 4UMTA 3QGWA 4WBOA 2B7AA 2B9FA 2J7TA 2ZMCA 1OECA 3F3ZA 3HA8A 4G5PA 1KE5A 4X6RA 2XS0A 2W9FB 4Z9LA 3ZUVA 3JVRA 4G31A 3BGQA 4AZVA 3U6JA 3WARA 3LQ3A 3IDPA 3ORLA 4EHZA 3CQWA 4RIYA 3PA5A 1Y8GA 4FGBA 4JAIA 3AQVA 1WVXA 4AT5A 4DG0E 4IX5A 4J52A 4QQCA 1Z57A 5CEOA 5LWMA 1JSUA 2XK8A 5J79A 3ZO1A 2Z02A 1QPJA 5JKGA 4CFUA 4NT4A 4MXZA 4AACA 5CF8A 4CG9A 3LCTA 4LM5A 5JFWA 4R7BA 5CEKA 2XRUA 4Y83A 4QPAA 2F7ZE 1WAKA 2WZJA 2XKFA 3BRBA 3KA0A 4RIYB 4C2WA 4C3RA 3RWQA 1OUKA 5EI8A 4F7NA 1XH9A 3U6IA 3OHTA 5KBRA 4FSQA 4HZSA 4EUUA 2VNWA 3M2WA 2BVAA 5JMSA 3L8VA 1GZOA 2IZRA 3H3CA 4TYGA 4X3FA 3IONA 3Q9YA 3PWYA 4H58A 2UZLA 4LRKA 5E1SA 1AGWA 2XYNA 5D12A 4R1VA 3Q5IA 3HLLA 2GNFA 4WT6A 3R7OA 5L3AA 3O8TA 5ICPA 1PF8A 3ORMA 4WRGA 4FI1A 5GIPE 4QTCA 4ERKA 2YDJA 3SOCA 3VS3A 3FKOA 4PPBA 4TYEA 4DC2A 3QZIA 4IX3A 5GZ9A 3D94A 3W16A 3F6XA 2XP2A 3R83A 1SVHA 3W8LA 3ZLXA 2QCSA 4F1MA 2WNTA 3U6HA 4TWCA 5AUVA 5JSMA 3CEKA 5B2MA 3TXOA 4D4SA 4DBXA 2QI8A 4EH8A 4FUXA 2UUEA 4EH6A 2H6DA 3QLGA 2YWVA 4J99A 4D1ZA 3FI2A 3A4OX 4KIPA 2WXVA 5AV0A 5TR6A 4PPCA 4PY1A 4Y72A 4YJTA 4FC0A 4ACGA 2DUVA 2Y6MA 1OIUA 4V05A 4KAOA 3NS9A 4EZ5A 4CGAA 3CS9A 4BTKA 3FZ1A 2XIYA 1H1SA 4JXFA 3PVBA 4V0GA 4ZK5A 3TKHA 5M4IA 3G90X 2C0TA 3DFAA 5JRQA 1IAHA 3BWFA 5CS6A 5ANKA 3E7VA 3BCEA 2IZSA 3QTIA 1RQQA 2E9UA 3IKAA 4LMNA 1SYKA 3FY2A 1DI9A 4JIAA 1BX6A 3UMWA 3EH9A 2GSFA 5HO8A 2OIBA 4UMRA 5KX8A 1JAMA 5HTIA 3BLQA 4IE9A 4O0TA 2PMOX 4V0GB 5CAOA 3NR9A 1W83A 1OBDA 1WBVA 4MKCA 3R7EA 1PXMA 4L6QA 4E4MA 2H96A 3RAWA 2C6TA 2F49A 4FUYA 4JDIA 2ZV7A 2HZ0A 3DXQA 3TKIA 4NKSA 5L2QA 4QMOA 5HVJA 4EOMA 3R9DA 2ACXA 3K2LA 3P0MA 2WMUA 2BAKA 3Q53A 3VUMA 2XJ0A 3G2FA 3M11A 1ZYLA 3VBWA 3UZTA 4H05A 2VUWA 2VGPA 3HECA 2C3KA 4CLJA 1K9AA 4FV8A 2WQBA 4FIFA 3NEWA 1JKLA 4IAYA 5GINE 3RPOA 3G9NA 3F5XA 3O50A 4D9UA 4WKQA 4FKGA 5L2SA 4MWHA 5FWKK 3RZBA 2NP8A 2Y4IB 1TQIA 3DDQA 2OF2A 2IVSA 3DLZA 3Q4TA 2VWIA 3ENHA 4IHPA 5IEXA 5D7AA 5EHYA 3BYSA 2HWOA 4FTRA 4FV0A 4ZSEA 4KRCA 5DFPA 5DOSA 4CKIA 3ZEPA 2BHEA 2BZKB 3FQSA 4IM3A 4BI2A 2IZUA 4BIEA 4EH4A 5LVPA 4NCTC 2YIQA 4NEUA 3TNPC 5HLNA 5J5SA 2BPMA 2R3RA 3LHJA 3OCGA 2OXXA 5CQWA 2B53A 3TN8A 5LCKA 1VR2A 3UG1A 4S30A 4BI0A 2WMVA 2ZAZA 5E8TA 4QP9A 3I6UA 4XG6A 3ORXA 4HGLA 4ACDA 4V04A 4XOZA 3SD0A 3COHA 4M12A 1H00A 2C1AA 3VN9A 4A9RA 2PE2A 4M0YA 4QNYA 2VX1A 4I6QA 2Q0BA 5DR6A 4CZUA 2X9EA 2BZIB 4YLLA 4AZEA 4QMVA 2X6EA 3D4QA 4FSYA 5LMAA 2I0VA 3OS3A 2OZAA 4Y73A 3R1SA 4FL1A 3WYXA 4GH2A 4ZTNA 2PWLA 3NZ0A 3PPJA 4ANQA 5IMXA 3GQLA 4FKJA 2XK3A 3WYYA 4AZTA 3R7UA 4RIWA 4HVSA 5A14A 5AR4A 5IZFA 5A6NA 2BCJA 1KE7A 1OL1A 2W06A 2XCHA 2CKOA 1ZYJA 4LOQA 3CSVA 3L8SA 3CQUA 5A6OA 4XV3A 3F88A 2F4JA 4OTIA 5ANJA 3EQPA 2GHGA 2BRMA 3FXXA 3KY2A 3OY3A 3P9JA 5EQPA 3D5XA 3KK8A 3NVKI 2UVZA 3Q96A 1IR3A 2VO0A 2YZAA 3MN3A 1Y91A 4XCUA 5F95A 5GNKA 5DMZA 4ZJIA 3OFMA 4X2FA 4CQGA 4YBKA 3MB7A 3ORZA 4FTCA 1FVVA 5A4TA 4M67A 4FNXA 4AOTA 5HORA 3ORNA 1GZKA 2QURA 3F2RA 1U4DA 4FODA 4WUAA 1W7HA 3R02A 5BMSA 3NUNA 1XJDA 4RJ6A 1ERKA 4BDGA 4PNKA 3VBQA 5JFVA 1CKJA 1H4LA 1WBNA 2C5YA 3BV2A 3DBEA 4K1BA 4MXAA 4YSMA 5FQDC 3RZFA 4U41A 3QF9A 2BUJA 4UZHA 4OR5A 5CALA 3GC8A 4FNZA 4TKSA 5EM6A 3DB8A 3U4UA 4EYMA 3JXWA 4IAFA 2BRNA 1REKA 3BE2A 3OUKA 4O7ZA 5LMBA 1M52A 1YHWA 2XJ2A 4FOCA 4P5ZA 4MQ2A 5ANEA 4FE2A 4DFBA 5IQFA 4U8ZA 4ZLOA 4DFYA 5BVOA 4PQNA 4RWLA 2F9GA 4IC8A 5EFQA 1UVRA 2J51A 4G2FA 4DFUA 1QPCA 2ZB0A 2EVAA 2Z7RA 3E93A 3D83A 5AA9A 4LMUA 4QMZA 1MUOA 3VULA 1XHAA 2HOGA 3AMBA 2OJIA 4ALWA 2B1PA 4MNEA 4U6RA 1YKRA 3OF0A 3PG3A 5CSWA 5AA8A 3AT4A 3WZEA 2XNGA 3HUBA 2R3JA 4QMTA 3KFAA 4TYIA 3ZBFA 4ANBA 5L2TA 3A7IA 4LYNA 4DGGA 2X4FA 5H3QA 4KUJA 3D7ZA 5M06A 5E8WA 3VAPA 2NO3A 1ZOHA 2H8HA 1MRYA 3C0IA 4Z7HA 1FMOE 2YM3A 4BKZA 4OTGA 3IG7A 4BY9E 4L53A 2ETRA 4ZTMA 5AWMA 5FRIA 2XNOA 4J98A 4MNEB 4DH3A 3NVMB 2X8EA 4I3ZA 2R3LA 5EQEA 3E3PA 2EXEA 3QCXA 4GKHA 2PZRA 1HCKA 3ALOA 3UIMA 2ITNA 3QA8A 3HMPA 4ZSJA 1Q8UA 4U3ZA 5M44A 2WMQA 5CWZA 2F2UA 1K2PA 2OG8A 1OBGA 3MTLA 5AP4A 2R3OA 4HVIA 2VTMA 2OBJA 4J7BA 5GJFA 5C4LA 3C4WA 3FLNC 2XNPA 1UNHA 4KA3A 2VTSA 3GP0A 3KXGA 2R3NA 4LOOA 4D2RA 3EL8A 2C3LA 1FVTA 4NK9A 4WG3A 3VHEA 4HYHA 1UU3A 1QMZA 2W1GA 3H9RA 1ZLTA 3OC1A 4H3QA 3QTZA 1BUHA 4USFA 1U5QA 3LFQA 3ZEWA 4BZOA 1PMVA 1URCA 4FVPA 3BGPA 4Q5HA 3ZZWA 3QTRA 5I9ZA 2X1NA 4L7FA 4TYHA 4QD6A 3TV6A 2FSLX 4BCMA 1M17A 4A06A 4FSZA 4MWIA 2IVTA 4CFFA 4L45A 3GC9A 1G8SA 4YZMA 3Q2JA 2YM4A 2J2IB 2GFCA 3ANRA 3BU5A 4NIFA 1J3HA 4ANOA 2WTVA 1L3RE 4E93A 3UZPA 3KKVA 5C26A 4EBVA 2EB3A 3IDCA 4DA5A 1MRVA 2R3QA 2PY3A 2BR1A 2YAAA 3BU3A 4JNWA 4TYHB 1A9UA 3DPKA 2YN8A 2VD5A 5BUIA 4MBIA 2WU7A 5HLWA 4FKRA 2BZJA 4CXAA 5EK7A 2R3PA 5E8XA 3CKWA 2X6DA 1J1CA 4NIFB 4OTWA 3BQCA 4YJRA 2WTJA 4ASEA 4Q5EA 5AP3A 5GJDA 3A61A 1IASA 3I81A 3D7TB 3N4UA 4YJNA 3EYHA 4I0RA 4E6CA 3RK7A 2XIRA 5AUXA 4LUDA 4JQEA 5HIDA 4OT6A 5J5TA 4L46A 3VW6A 5BYYA 4D2TA 5EW3A 3QD2B 2C5XA 1PMEA 5BVWA 4QP2A 3R1QA 2ZV8A 4QYYA 4FSWA 3D7TA 2O65A 4IDVA 5J7BA 2Y8OA 2XM9A 2R3KA 2XKCA 3L9NA 3P1AA 4MYGA 4L52A 1R1WA 5FXRA 5AR3A 4IW0A 3BHHA 2CGXA 4WG5A 4P4CA 2OICA 1B39A 2W5BA 4D5KA 2F57A 4E73A 4FEVA 5FEDA 3H0ZA 3JY0A 3RM6A 4DGMA 2PVRA 4AN3A 3QQJA 3R9HA 4F7SA 2WQNA 3DFCB 3ITZA 2VGOA 4KIQA 3DKCA 1DAWA 2QOKA 4JJRA 4A4XA 3F3UA 3F5PA 3D5VA 2PZYA 2I0EA 4MXXA 3ZDUA 4IMYA 1BI8A 1H1RA 5HCYA 4WHZA 3VQUA 1YXSA 4EOQA 2X2LA 3RCDA 5DG5A 1PHKA 5DRDA 3Q3BA 2GHLA 3ANQA 4JBVA 3SV0A 3C9WA 3PJ1A 3UVRA 4EQMA 2OLCA 3RALA 3BI6A 2E9OA 3LPBA 4D2WA 4D4RA 3W33A 2R3IA 4EOSA 3LJ1A 3HGKA 4DHFA 2ETKA 4GVAA 5A9UA 2G2HA 4TL0A 1K3AA 1VYWA 2YWPA 3B2WA 4W4XA 4FTUA 5DEYA 4GK2A 1BI7A 4FKVA 4NTSA 4ITHA 4C36A 2Q83A 1GAGA 3K3IA 4RIXA 4WIHA 3ALNA 2HXQA 3DJ5A 3F82A 1T45A 3NW6A 4IZ5A 2UVXA 3FXZA 2OH4A 4DLIA 4AGWA 2Z2WA 1PXLA 3FQHA 5CYIA 4BFMA 4XG8A 4ITJA 3E88A 3FMKA 4QMLA 5CENA 3GXLA 3KRLA 4NW5A 5ETIA 5HICA 2EXMA 3E63A 4I6HA 3SA0A 3BWJA 5DLSA 1S9IA 4RWKA 3FYKX 4EKLA 5FXQA 2WU6A 3LJ2A 4BRXA 2WAJA 2P4IA 1CM8A 3MIYA 3COIA 2IW8A 2VO6A 4WG4A 4RZWA 3EN4A 3LCOA 3U4WA 3R8VA 5HBJA 5IH5A 3E3BX 4G3GA 3IK3A 5IMEA 5F9EA 3ZUTA 1JSVA 1T46A 1H27A 3MJ2A 1IRKA 1OPJA 3JUHA 3L8XA 2W4OA 3Q32A 3MVHA 3KULB 3R63A 2GTNA 4ZIMA 5ANIA 5HU9A 4L67A 2QU5A 5FXSA 4XS2A 2BDFA 3B2TA 3ACJA 5HI2A 1SM2A 4M13A 4XV2A 3EKKA 1ZY4A 2PVKA 3UNKA 4L9IA 2R0IA 2HELA 4FICA 3UVQA 4YJVA 1KOBA 2JKMA 3KULA 4G16A 4N57A 4TPTA 5DR9A 5EG3A 4DAWA 4FKTA 3LQ8A 2OJGA 2KTYA 2R7IA 2HZ4A 3PSCA 3CR0A 5BVFA 4XP2A 2BALA 2QVSE 4V01A 2DWBA 4DG3E 1LPUA 4QYEA 1W8CA 5BMMA 3AMYA 4NTTA 4BIDA 3DLSA 4C0TA 4DCEA 1O6KA 4DGNA 3FSKA 3SRVB 3VJOA 5EM5A 3LQ5A 4F63A 3MVMA 4F1TA 5CASA 2R2PA 5L8KA 4FVRA 3II5A 3BHTA 4ZLZA 4K33A 3E62A 4JIKA 4BDFA 3TNWA 2XKEA 5EI2A 4EUTA 4FEQA 3HX4A 3BBWA 3KK9A 5CT7A 2VWUA 5HE1A 4DTAA 3R28A 2VWXA 3ATSA 2XJ1A 4I92A 1OIQA 1ZAOA 4O1OA 4A9YA 2VWBA 3LZBA 4PMTA 5DE2A 3RPRA 5A4QA 5L4QA 4BDJA 2W4KA 5AP0A 3ROCA 3R2YA 1I09A 3PLSA 3CY2A 4G1WA 3GFWA 3WILA 4X2GA 2AC3A 3NYVA 4MXCA 3R04A 2XNEA 2I6LA 3QCQA 5EOLA 2EWAA 2RFNA 1YI3A 4BWXA 4RJ5A 2A0CX 4EOJA 4MK0A 3UYTA 4O83A 2R3MA 4BGQA 1XH5A 2W1ZA 4MTAA 3BLRA 3FMHA 2DYLA 4MEDA 3R8ZA 3UIXA 2VTQA 3EJ1A 2JDSA 4GU9A 5JRSA 2BILB 2JITA 3GEQA 5AUTA 1MRUA 1CDKA 1SNUA 2OJJA 5K4IA 3TUDA 5AV3A 2QQ7A 2JFLA 4JX3A 1M7QA 4XBRA 2X8IA 1ZRZA 4QNAA 4EYJA 4BGGA 3R7IA 3ZONA 3PDTA 2UV2A 2VX0A 3OW4A 4BZDA 3LCSA 5CQUA 1GJOA 4QP4A 5LARA 5L6PA 5EM7A 3IOPA 5IG1A 4L3PA 2G9XA 2LGCA 4FZ7A 2J0IA 5L2IA 3AD4A 3UP2A 3DXPA 3PE2A 3MH0A 5CXZA 1P2AA 4F6SA 2XRWA 4DFLA 2OWBA 4IZ7A 5IQIA 4ACCA 1DI8A 4BCFA 5J9ZA 4ZSAA 2RG6A 4U42A 1OL7A 1UNLA 3MFSA 1PKDA 2RFDA 1KV1A 2QHNA 2JKKA 4AWIA 4DFNA 3P4KA 2VTAA 3BKBA 3E87A 3EQDA 5BQ0A 2CSNA 1AQ1A 3HDNA 3NYOA 4IB5A 5ANOA 1G8AA 2UZVA 4I23A 4IEBA 1JWHA 3MJ1A 5FBNC 4IM0A 4NM0A 3AC8A 2PZIA 3IS5A 5EYKA 3S2PA 1KSWA 1UWHA 2JKQA 4IH8A 4KKGA 4QO9A 4WNKA 4R6VA 4D0XA 4NKAA 3PIYA 5EDRA 4BR3A 4AGUA 4Z7GA 3QQHA 4D4VA 3R9NA 2J0MB 5IUIA 1PXNA 2PVJA 2VX3A 4AOJA 3D2IA 3R30A 2JBOA 1YI4A 3LOKA 5KE0A 4AGCA 1YQJA 3IGOA 4DTKA 4IC7A 4JG6A 4RJ3A 4E4XA 5HIEA 4YURA 2EUFB 2UW4A 4WSYA 1Q61A 2QLUA 3E64A 5ACKA 5HGIA 4QP1A 2JEDA 1Y6AA 2G1TA 3HRBA 3QYZA 4QMQA 4BDAA 4L42A 3ROYA 1CMKE 3ZFYA 4HZRA 3RBWA 4GSBA 4ZTRA 5M07A 4YZ9A 1WMKA 3HEGA 3QGYA 4E6DA 1OIRA 3FMLA 3CTHA 3O17A 4KRDA 4QMUA 2HZIA 2X7GA 2J9MA 3HRFA 4G6OA 2V5QA 4YC3A 4AN2A 1PMUA 1RDQE 4XLVA 4UY9A 1XR1A 1YDRE 4R78A 3Q9WA 4OTRA 5J95A 4GG5A 1MQBA 1OKYA 3GNIB 5AUUA 3C1XA 1YRPA 2C6EA 5BUJA 3A8XA 2HZNA 2WMSA 4WNOA 4EHVA 2WFYA 3ZO3A 2W99B 2R0UA 5EYMA 2OK1A 3AD5A 2WEVA 3ZTXA 4MCVA 3REPA 3KXHA 4KABA 5AP7A 3R1NA 3ZSHA 4GUEA 3BQRA 3R8MA 4B4LA 5CAUA 2WMRA 3TV7A 5AUWA 4DT8A 4KIKA 1BL6A 4YO6A 3AXWA 4QP6A 4X3FB 5AP5A 1X8BA 4B8LA 5B2LA 4R1YA 1JVPP 3IW6A 4ANMA 4O7WA 2WTWA 4OBQA 4WUNA 4CMTA 3B8RA 3DXNA 5G1XA 1Y8YA 4CTCA 1Q3DA 3VVHA 2FSMX 4F64A 2E9VA 5HBHA 2W96B 2BKKA 1YVJA 2UZNA 2JIUA 5CI6A 4I22A 2X81A 2O63A 3RTPA 3SGCA 4NM3A 1OKWA 3QRUA 3OWJA 5CAVA 3L9LA 3GOKA 3GU4A 1Q62A 2B55A 1IA8A 2F2CB 2JBPA 3BEGA 3MWUA 4UWCA 4LV5A 3VBTA 3VRYA 1WCCA 4IAIA 4FMQA 5J8IA 2GU8A 3ACKA 3DJ6A 5FM2A 3TM0A 4MXYA 3QU0A 4E4LA 2REIA 4O6EA 3LFDA 4AE6A 2CNQA 3PTGA 5H8EA 4BDCA 3THBA 2CGWA 2C6KA 3S0OA 5CXHA 4FT0A 4YZDA 4FL2A 3U9NA 4G5JA 4HCVA 4I5CA 4I6FA 5F1ZA 4BICA 5CEPA 4FEXA 3LXNA 4C4FA 5D11A 3IW8A 3Q4CA 3V5JA 2BFYA 2OI4X 5FUTA 5GIOE 1P4FA 3WE4A 2C3IB 4ZEGA 3VS6A 2ZM1A 3F9NA 4PX6A 4FZFB 3BGZA 5HG5A 4A07A 4G34A 4EZ3A 2CGUA 4CKJA 4FV6A 3ULZA 4ZZNA 5KHXA 4XV1A 3QZFA 2BDWA 5DIAA 2WQOA 4KKEA 1PXIA 3OOGA 2YACA 3A7JA 4RQKA 3P7BA 3VS1A 2RG5A 3KMUA 3ZM4A 4USDA 1H28A 3ZCLA 3QLFA 4O0UA 2ZB1A 5LCJA 3SG8A 1NW1A 2ZYBA 5C8NA 4O7NA 4RG0A 2YJRA 4DH7A 1PW2A 4EH2A 5ITAA 4LI5A 2C6OA 2C6DA 3P86A 3UNJA 1A48A 3MS9A 4JL9A 4IWQA 3DS6A 4RJ7A 4WOVA 4L3LA 3R9OA 2B4SB 2ITTA 3DJ7A 2GPHA 3C7QA 3UJGA 1H26A 3W55A 3W32A 4TWPA 5CEQA 2W5HA 3PPZA 4CT2A 4O2PA 4CRSA 4MAOA 1PXOA 3KU2A 5JH6A 2QC6A 3I1AA 3QKMA 4W4YA 2BZHB 3NNUA 4WSQA 4BWPA 3VS5A 1J1BA 3FV8A 2WMAA 4OAVB 4QPSA 1H07A 5DHJA 3A62A 2ITQA 5HBEA 4F99A 4ZY5A 1NXKA 4E6QA 3COKA 3ODYX 3SLSA 3MA3A 4TY1A 1XKKA 2WO6A 5FGKA 4RA4A 2CLQA 4AOIA 4AQCA 3PZHA 2HXLA 4FYNA 4TXCA 5TE0A 5A3XA 4BYJA 1YWVA 1TVOA 1R0PA 4JDHA 4FZDB 5BVKA 3QCYA 4DEAA 4G3DA 4RVLA 5AADA 3QC9A 3QX4A 4IVAA 4DEEA 2WHBA 3I0QA 4FKPA 4D1SA 3FZSA 1E1XA 3MFRA 3W10A 4DGOA 5LMKA 3I5NA 4FKIA 2ZJWA 5HTBA 4ZS4A 3UIUA 4DCAA 5I0BA 3QQKA 3MFTA 3Q52A 2GCDA 4GFGA 3HP2A 1Z5MA 4AU8A 1R0EA 2IW6A 5BUEA 3BX5A 1UU8A 3GUBA 3C4XA 4HGSA 3WZDA 3IO7A 3P7CA 4ACMA 2W1IA 3KEXA 4P90A 4GJ3A 3E8NA 4FSTA 2XBAA 3PY3A 3DY7A 4O84A 1YOMA 4J8MA 1GZ8A 1Q8WA 3M1SA 1FPUA 5AX3A 2YITA 2ITXA 5ANGA 3IW5A 5TKDA 4YC6A 4XHKB 5DI1A 4ALUA 5EDPA 4M66A 4J71A 4OTHA 4PNIA 2QO9A 4QMYA 4C37A 5M09A 3LAUA 4L43A 4Y5QA 4W9XA 2HY81 4O7SA 4IVDA 5A4CA 4GV1A 3NPCA 3W8QA 5CSHA 5JN2A 3FDNA 4E26A 2WOTA 1OKZA 3DGKA 5HCZA 1KV2A 4GFMA 3CP9A 2QOBA 3MW1A 5H9BA 5E4HA 5HD7A 1M2PA 4QMSA 3FC1X 3O51A 4R3RA 4C4EA 4CFNA 3BU6A 4C62A 3ULIA 2X7OA 3FXWA 5IQBA 3Q9ZA 2C0OA 4IQ6A 3RNIA 2Y4IC 1FGIA 4FYOA 2XIKA 4D9TA 2FGIA 3A4PA 5A46A 3TJCA 2YDIA 4JG8A 4S32A 4XLIA 4OBOA 3RNYA 1FVRA 2C4GA 4JR3A 3G9LX 3QALE 1Q99A 3KN5A 4M3QA 3WIGA 3DKOA 1ZYCA 3P79A 3QUDA 4OTFA 3R7VA 2WOUA 5DT0A 4D4YA 5AP6A 1AD5A 3ZS5A 4PPAA 2ETMA 1JPAA 3O8PA 2BFXA 2DS1A 2BTRA 1IAJA 3AT3A 3MBLA 2FA2A 3CTJA 5IEVA 3UE4A 4C57A 5C1QB 2QR8A 3ID6C 3NAXA 3IW7A 3PJ2A 3FMNA 2J50A 5HNGA 4H3PA 3RPYA 2IZTA 3KXNA 4R3CA 4EK4A 4EOKA 4YBJA 4XMOA 4ANNA 3Q4UA 5DBXA 2VTTA 2ITPA 3BYUA 4WBBB 3R71A 4PUZA 5LJJA 3LKMA 4AN9A 2UZOA 4CZYB 3FSFA 4B9DA 1IG1A 5DNRA 5HNBA 2QG5A 3BLHA 4ZS0A 4FF8A 2BTSA 3Q6WA 3POOA 1UKHA 4I0TA 5KZ0A 3FPQA 3GU7A 2W1HA 3ZFXA 5JZJA 3KF4A 1W0XC 2AUHA 3DAEA 4O38A 3Q6UA 3QYWA 3BHYA 4DYMA 3BHVA 3QCSA 3UQGA 1M2QA 3LFBA 5JGBA 2FSOX 3W18A 1NY3A 3FC2A 5HEZA 3QC4A 3RK9A 5IA2A 2WKMA 3QRTA 3PIZA 4HNFA 2XKDA 5EI6A 1GIIA 4XG3A 4RC3A 5AP2A 2OXDA 4U40A 2B52A 3A99A 4D2VA 4IBMA 3T8OA 2A4LA 2H9VA 2PUUA 3HV3A 2GHMA 4EORA 3W2SA 2PUNA 2W7XA 1Q4LA 5KBQA 4U7ZA 4LOPA 4O7YA 4YTHA 4NCTA 2C6LA 4JR7A 4YJSA 3F3VA 4ZZOA 4C58A 3NCZA 2VTJA 3MV5A 2WMXA 3O7LD 1PJKA 3OXIA 4JVGA 3UYSA 4DFZE 2KULA 5KMLA 2E9NA 2CDZA 3AC5A 3W2RA 5IH4A 3P5KA 4D2PA 3MGYA 5IU2A 2UZWE 2X2KA 5J7HA 2HAKA 2RSVA 3L1SA 4RMZA 4AFJA 4HVDA 3G51A 3UO4A 5BYLA 2QR7A 5KZIA 3EKNA 1PYXA 5B2KA 2YEXA 3ZRLA 4RBLA 3W2QA 3NIZA 3HZTA 2XEZA 3EN9A 4B8MA 4DT9A 5HKMA 4FK6A 3VBVA 4NW6A 5JZNA 2J6MA 3GT8A 3LLTA 4FTQA 3UOHA 3WZJA 4C59A 5IQAA 3I7CA 5M4CA 1UA2A 5CVHA 5HX6A 3Q5ZA 4AXAA 3EQFA 1H08A 3HL7A 5DWRA 5D9HA 4AE9A 4EWQA 5KMJA 3OMVA 2WTKC 3EYGA 2CGVA 3OBJA 3VUHA 5BVNA 5HQ0A 1W98A 3I5ZA 3OVVA 4EKKA 2R64A 3GQIA 4UEUA 4PWNA 5EKOA 3HAMA 3SW7A 2Y6OA 4IZYA 3WF8A 3LFEA 3EOCA 4FTTA 3TUCA 2H34A 4UXQA 5M51A 4UMQA 3H0YA 5IA1A 4RRVA 2PTKA 2XNBA 5I4NA 3PP0A 5M4FA 5GJGA 1LP4A 3V8SA 4P2KA 4KB8A 5BYZA 1A06A 3C4CA 4E8AA 3OWKA 3TWJA 3WIKA 4CT1A 1OITA 2W1FA 1NA7A 1PKGA 2A2AA 3GFEA 3LMGA 2P2HA 4XYFA 4PDPA 4E7WA 5HCXA 1Y57A 4ZSGA 3GCVA 2VAGA 5CEIA 4O22A 3N4VA 2O64A 4MD8E 4USEA 3I60A 2QOFA 4O0RA 3DKFA 2QOIA 3COMA 4EQCA 1TKIA 2ITOA 5FP5A 4EJNA 3QZGA 3CPCA 3R00A 4H39A 3V04A 3UQFA 3KXXA 1U59A 5M56A 1KE6A 4I4EA 3V5LA 5HX8A 3NDMA 4X21A 3KRRA 4R7HA 4YHTA 4AA5A 4O1PA 3W1FA 3DCVA 4CTBA 1V1KA 4XEYA 3FHRA 3DBCA 5H2UA 3LFCA 4IAAA 1ZZ2A 4C2VA 4QTEA 3AGMA 3ATTA 4G3EA 3NW5A 3BBTB 2ZM3A 4XRJA 4YP8A 1IA9A 3BHUA 1VJYA 5FBOA 5LQFA 5E91A 1H0WA 3JY9A 3VC4A 4FGRA 3ZU7A 4IANA 1KOAA 1H24A 3CQEA 4RIXB 3POZA 5I9XA 5KCVA 2CKQA 1APME 1M2RA 4F0FA 4UV0A 5KUPA 2C69A 2J5FA 2X7FA 5CI7A 3PY0A 5A4LA 4MX9A 4ASDA 5EW9A 4J53A 2BRHA 2SRCA 4RC2A 1SVGA 2R3GA 5IQCA 3RAHA 3PUPA 4FKQA 4ZMFA 2DQ7X 3QTQA 1XO2B 3NSZA 2C5VA 4E5BA 5LVNA 2QD9A 2HCKA 3QTUA 5AUZA 4PDOA 3WF5A 5EQYA 2JGZA 3RI1A 1WBSA 3KB7A 3PXRA 2XVDA 5HE3A 1O9UA 2RGPA 3AT2A 3M42A 1JQHA 4O0VA 4M97A 3IOKA 4C3FA 2CJMA 3BIZA 3RINA 4HCUA 3C0GA 5CSXA 4UWBA 5F4NA 2IVVA 1OIYA 2ITZA 2OIDA 3A7FA 4GL9A 2CCHA 4NU1A 2JKOA 2UW7A 4F7LA 2X0GA 3G0FA 1OPLA 5AIRA 3PE1A 4YJPA 5JFSA 2UZDA 3SC1A 1O6LA 2QOCA 1ZYDA 2YISA 4I94A 3QZHA 3O0GA 4EHEA 3PXQA 4HGEA 4N70A 2PVFA 4RX7A 4HNIA 4FV9A 4FOBA 3G6HA 4RSSA 4U3YA 4Y85A 4JQ7A 5AMNA 2X4ZA 4ONAA 4YGAA 1GZNA 4ARKA 3F7ZA 4RGJA 5E7RA 3S95A 2VTLA 2JD5A 3DZOA 4ZLYA 5C4KA 1PYEA 1L8TA 4FNYA 4R77A 3ORIA 2BHHA 3PZEA 2Y7JA 5J1VA 1OVEA 3F7WA 3FQEA 4YHJA 5J1WA 1ZMVA 4Y8DA 4JI9A 3QD3A 2R3FA 4FK3A 3FMDA 3AMAA 4FTKA 5LXMA 4NJ3A 4DE4A 4DTBA 3SRVA 4O21A 3RWPA 4CG8A 5EYDA 4MHAA 4YUQA 4Z3VA 4OAUC 3PP1A 4ZMEA 3QXPA 3DQWA 4AT3A 3CGOA 3ZC6A 5CF4A 3GCUA 3OROA 4K0YA 3VUGA 1FBNA 1YOLA 4JDJA 4F9BA 5AM6A 2XA4A 3H10A 3KRJA 3UGCA 5GZ8A 5K5NA 5LMKC 5A4EA 3UOJA 5EDQA 4TNBA 3CJGA 5KMKA 4APPA 4C38A 2W17A 3VIDA 5D10A 3LFSA 3PG1A 3ODZX 4M8TA 1Z9XA 2W9ZB 4N6YA 3CLYA 2YIYA 2ZM4A 3N51A 1LR4A 2Q0NA 2C6MA 4H1JA 5K3YA 3SW4A 4H3BA 4CRLA 4EBWA 3WOWA 3EHAA 3D9VA 5CNOA 3ZC5A 3ZXTA 2PL0A 5JFXA 4ID7A 3ZSGA 3PPKA 3CGFA 4YSJA 4GVJA 1VEBA 3BYOA 2VN9A 3K5VA 4F9AA 3GU5A 3FZTA 3VS2A 4IAZA 3NGAA 3RVGA 3VS0A 3R6XA 5B0XA 2VWYA 4DH5A 4QTBA 3OWLA 5I3OA 2CPKE 2BKZA 2Y0AA 3BV3A 3QD0A 2VO7A 3F5GA 4TT7A 2JC6A 1ZARA 2R3HA 3KREA 3CKXA 3JS2A 4O7LA 5AV2A 1OZ1A 1XBAA 4K6ZA 2OSCA 3ZBXA 2WPAA 3ZFMA 4NH1A 3Q04A 4NJDA 3HVCA 2OJ9A 3ZRKA 3S1HA 2I40A 5HVKA 4WRSA 2NRUA 3EN7A 4QP8A 4IX6A 4YLJA 3RP9A 2AYPA 3RK5A 1GY3A 4O86A 3TDVA 3KRWA 5AAGA 4EH3A 4PRJA 1BL7A 1ATPE 2HK5A 4X2KA 3QQLA 1P4OA 2OKRA 4KWPA 2EXCX 2QONA 2W4JA 2ZDTA 4W8DA 3ELJA 5CVGA 2VTNA 3FLWA 1XWSA 5DYJA 3VF9A 3CCNA 3DU8A 1OL5A 2VWWA 2B54A 4O0SA 1H0VA 4D58A 3G0EA 4M7IA 4ZZMA 3TG1A 5E8UA 4EOIA 3FAAA 4D0WA 4DH8A 4CNHA 4XG7A 3R73A 3TNQB 3HAVA 4ORKA 4MXOA 3TL8A 4FIHA 1TQMA 2JAVA 3OT3A 1BMKA 2VWZA 4JS8A 3V3VA 2CN5A 4IB0A 2WGJA 2OIQA 1WBWA 3MY0A 2YABA 3I0OA 4YLKA 4CD0A 1E9HA 3QHRA 4H1MA 3FZRA 4LFIA 1YW2A 1ZY5A 5KKRB 2YHVA 5I9VA 1KUTA 4GFOA 4Z55A 3ZO4A 4R5SA 4F1OA 4IACA 4DF3A 2YCRA 5C8KA 3ZMMA 4FR4A 1JKKA 3QRKA 4QTAA 4HJOA 1OUYA 3KCFA 4JT3A 4X2JA 4F0IA 2YLEA 2WMWA 1WBPA 3A7GA 3GC7A 2WTCA 3D2KA 3LXPA 3QAME 3RGFA 4K2RA 1GOLA 2YIRA 3OEZA 4LGDA 3UVPA 3GC0A 5CU3A 1JKTA 3QKKA 5ANDA 3D0EA 4DLJA 4FTIA 2I0YA 4NSTA 1FOTA 2P3GX 3QQUA 2O2UA 3FPMA 2GMXA 3TUBA 4KIKB 3UODA 3FLQA 4KBAA 2GQGA 1M7NA 2GS2A 2PE0A 2VTRA 3LM0A 4GG7A 4YNOA 3VWAA 4PDYA 5M08A 3OCBA 1GIJA 4I0SA 4IB3A 4XG2A 3OG7A 4AA4A 5CU4A 4XRLA 3V5QA 5J9YA 5J9LA 3UPZA 3RM7A 4CSVA 1XBBA 2UVYA 5CZHA 2YFXA 2VNYA 4K11A 5BX0A 4BCOA 3PXYA 1YWRA 4AP7A 1YXTA 1KWPA 2HWPA 5HE2A 2OXYA 1XQZA 2VTPA 4FV2A 3MTFA 4UBAA 1CKPA 2FSTX 3O7LB 4PDSA 4XG4A 4GK4A 2UZEA 4IVBA 2JIIA 3TZ7A 3FEGA 4C34A 4CKRA 2R9SA 3SXRA 5AFVA 3NNWA 4IWPA 5JK3A 5DH3A 4L01A 5HHWA 4QYHA 3WZKA 2YERA 3G5DA 2UW8A 4DBNA 5C9CA 2VRXA 4ENYA 3V51A 2VTOA 3NUSA 5C03A 4EZ7A 5KKRC 4YTIA 3TIZA 4C33A 3HRCA 3PA3A 4FTMA 4ZAUA 2ITUA 2XIZA 3JR1A 4WD5A 4U79A 2RFEA 1YWNA 3D5WA 4X7QA 5CSPA 1MP8A 4OT5A 4DEDA 2FO0A 3DK3A 4XOYA 2OU7A 3HNGA 3OEFX 5DN3A 4IFCA 4L3JA 1WZYA 3R8UA 4D2SA 4XG9A 3QXOA 4AG8A 5BPYA 3U55A 3WF9A 3GU8A 4Q2AA 3W2PA 4ITIA 3K5UA 1KE9A 4FKOA 4BGHA 1PY5A 2NPQA 4HOKA 4XH6A 4BCNA 4BDDA 4UYAA 5K5XA 2QO2A 2FUMA 3NAYA 4FKLA 4C4IA 2CKEA 3OTUA 4X2NA 3ENMA 3ZSIA 4MH7A 3UPXA 4FX3A 4YZNA 3NX8A 3SX9A 3OP5A 4FTNA 4F6WA 4X3JA 2HYYA 3LXLA 1PRYA 3TIYA 4U45A 4M68A 2BAJA 4G6LA 5DR2A 3C50A 4MD7E 1V0BA 2YAKA 3I79A 5K0XA 1KE8A 4HYSA 3CBLA 5I9UA 3NUXA 4E5AX 5IH6A 3UC4A 4LGGA 4BF2A 4OW8A 1QCFA 4S33A 2VTHA 2XK6A 2IG7A 5CF5A 4FSUA 4CVAA 2YIWA 4RLLA 4BDIA 4AW0A 3PXKA 4FSRA 1U54B 4QP3A 3VO3A 5F94A 1PXJA 2PZPA 2F7EE 4GEOA 3OWPA 3HYHA 4O96A 4AFEA 4EH9A 2YJSA 4R8QA 4K18A 5T6KA 4B0GA 4CLIA 3QFVA 4GT5A 1GNGA 1Q8YA 1GIHA 2CN8A 3LVPA 4FG8A 4X3FC 4O81A 5HNIX 3LFAA 1SVEA 3NUPA 3LLAA 4AA0A 3RPSA 3VBYA 3VUTA 1J91A 3GCQA 3MYGA 4GYIA 3O2MA 4W4WA 5H8GA 4CYJA 4YJUA 4ERWA 1F3MC 1OGUA 4F0GA 4C3PA 4ZTQA 3BPRA 2Y4PA 1JLUE 4JBOA 1R39A 3F2AA 1F0QA 3OT8A 4RC4A 4TW9A 3ZHPC 3LMHA 4WNPA 4GJ2A 4MBJA 4RVKA 4YHFA 3EQRA 4A9UA 4U80A 3R21A 4R7IA 4BDHA 4CMUA 4EC9A 4FZ6A 3QBNA 4M69B 3DQXA 3FZPA 4BC6A 4EWHA 4BDEA 5ETAA 2ONLA 1I44A 1XH4A 1RE8A 4ZOGA 3NUAA 4ZTSA 4UN0C 1H8FA 4FV3A 4AZWA 3SOAA 4A7CA 2IWIA 3OXZA 4S2ZA 2G15A 1WFCA 2WMBA 3I7BA 2ESMA 3RPVA 1BLXA 5M57A 5TOZA 1JKSA 3PSDA 5DA3A 4F9YA 4WO5A 3EQBA 3LXKA 4RX9A 4BWKA 4XNEA 5IA3A 3UOKA 1DAYA 3G33A 2VZ6A 5IUGA 4EOOA 2NRYA 3IECA 5ACBC 3FWQA 5AR5A 5AAFA 4ASZA 3R1YA 4AW5A 2GFSA 2V7AA 3EFJA 1Q8ZA 1Y6BA 4O0XA 5DT3A 3O23A 2UW9A 3GENA 3KMWA 4B7TA 4EI4A 2PVHA 1F5QA 1OB3A 3Q60A 3IQ7A 2XNMA 5CANA 3T3VA 5KHWA 3FHIA 4S31A 5HO6A 4A4OA 3V5WA 3C4ZA 3KL8A 1J7IA 2G2FA 3A7HA 2QKWB 4GIHA 2PMNX 5FEEA 2WEIA 2JFMA 2OF4A 3VRZA 5HOAA 4RWIA 3E7OA 4RJ4A 5E8YA 3T9IA 2HW7A 3U9CA 4LL5A 5FDXA 4ENXA 1PMNA 5C8MA 4YPSA 4I1ZA 3OW3A 4TTHB 5HG7A 4DINA 4YTFA 5M55A 2OFUA 4I21A 4UXLA 3ZLWA 3HV7A 3JYAA 4S34A 3HP5A 4RPVA 2ITWA 1Q8TA 3MVJA 4QYGA 4RVTA 4OLIA 5I5ZA 3FI3A 4I5HA 3EFKA 3HV5A 4Y46A 4BCIA 4RIOA 1DM2A 1E1VA 4O91A 3UBDA 2WMTA 4QRCA 1PXPA 2IN6A 3ORTA 3VS7A 4KS8A 4F09A 4YU2A 4R3PA 2VV9A 5K0KA 3WI6A 4CFMA 4GK3A 4L44A 2RFSA 1B6CB 3GGFA 4UYNA 5EYCA 3UMXA 3LCDA 4FTAA 3SHEA 3VS4A 5IQHA 2WIHA 4UX9A 1YHSA 2IJMA 4NWMA 4PMMA 4BBEA 4RZVA 2YZLA 2ITYA 4TWNA 3RMFA 4E6AA 3RAKA 4JBPA 5JGDA 5IQDA 4E5WA 5E8SA 4HVGA 3GB2A 4TYJA 4I20A 3R8PA 4F08A 3KMMA 4C7TA 2OH0E 4PV0A 4FEWA 3EMGA 3I4BA 2B9JA 2F7XE 2XF0A 2WQMA 2W0JA 3BEAA 3C51A 4IIRA 5DEWA 4BZNA 2GNJA 1U46A 2XZSA 3FMMA 3QKLA 3MY1A 4D55A 4AX8A 4DN5A 3FI8A 4R5YA 3ORPA 4KD1A 4U81A 3E8DA 1M14A 1SNXA 2Z7QA 4MVFA 2QKRA 3DKGA 3R7YA 5CAPA 3P78A 3WE8A 3R9RA 4JDKA 3RHXA 2B0QA 3OTVA 3ZLSA 4EONA 5L8LA 1YXUA 2P2IA 4DEBA 2BRBA 1RW8A 2PVNA 2J4ZA 3QX2A 4HYIA 4PL5A 1XBCA 4NM7A 3HMMA 2BIYA 4QT1A 5L8JA 4FV7A 3QHWA 2PULA 5HO7A 2YM5A 1FMKA 2HENA 2GQRA 5EHOA 4QYFA 3PSBA 4A4LA 3AOXA 3EN5A 4DH1A 4Q9ZA 3VW8A 1JOWB 4TN6A 4C35A 3GOPA 4EC8A 3W2OA 3QUPA 4LL0A 2A19B 1O6YA 3U8WA 3V8TA 3WBLA 3B8QA 1JNKA 2PSQA 5E8VA 4G3CA 4CFXA 4UALA 4F6UA 3FZOA 5E1EA 3UOLA 3FE3A 3ZDIA 4PMPA 3DBQA 1HOWA 3LCKA 3E92A
chains in the Genus database with same CATH superfamily
3HV4A 3OCTA 2JLDA 5F20A 2C47A 3R0TA 5HE0A 2V0DA 2PVMA 1CTPE 3MPAA 4I5MA 4IWOA 4EEVA 4EK3A 1YXVA 3LJ0A 4BCQA 1UKIA 4BKYA 3EQCA 4D1XA 2BROA 2ERZE 5HIBA 3UTOA 4P7EA 4CYIA 5DVRA 2EB2A 1ZOGA 3DBFA 5L6WL 4O27B 5JT2A 2XUUA 3EZRA 4DEGA 3ZH8A 3SXSA 2XK7A 4A9TA 2X2MA 5IISA 3GVUA 5DPVA 5AR2A 5D7VA 4AZFA 2E2BA 4J95A 2PK9A 2C68A 3F66A 4UZDA 1OPKA 3QRIA 4FKWA 4BCHA 3QTSA 3S00A 1JBPE 3EN6A 4II5A 3UIBA 4GUBA 4PTGA 1R3CA 3FLSA 3V8WA 3UP7A 5JGAA 3H4JA 4GMYA 4NZWB 4JAJA 4FV5A 5GZAA 2A1AB 4HYUA 4FTOA 4O7RA 2Z60A 3JVSA 4TNDA 3HUCA 4RWJA 3D5UA 5AX9A 2UZUE 4QMXA 4CMOA 4KNBA 5DT4A 3KCKA 3RAIA 4C4JA 4JOAA 5DRBA 1ND4A 4JX7A 3QL8A 3QWJA 4DITA 3BLAA 4BDBA 3KGAA 3BYMA 1XMMA 4MD9E 4Y95A 5HU3A 4KSQA 4CFWA 3F61A 1LUFA 4EHGA 1V0OA 3CC6A 3LE6A 4RX5A 5AR8A 4EQUA 4QQ5A 3N4TA 2G2IA 1WBOA 4FIGA 2XIXA 5KMIA 4RVMA 2QG7A 3NUUA 2XK4A 3MH3A 3PFQA 5EOBA 3F3TA 2YCSA 3TT0A 2XMYA 3FUPA 3AD6A 2YCQA 2QO7A 5CU2A 1PXKA 2IO6A 4IFGA 4XBUA 5JEBA 4TZRA 2QU6A 4IDTA 1FQ1B 1YDTE 4IJ9A 2C1BA 3A60A 1URWA 4NM5A 1IEPA 2OZAB 3CJFA 4QOXA 2I0HA 4BN1A 4CEGA 4EK8A 4EJ7A 2YA9A 3HDMA 4GS6A 4BB4A 2ZDUA 5M53A 4ZY6A 1Q5KA 3U54A 2R4BA 2YCFA 4FV4A 4GYGA 4RIWB 1LEWA 5M4UA 4FT3A 4J1RA 3ZM9A 5IA4A 2E9PA 3TTJA 3DDPA 5DGZA 4FA2A 4I5PA 2BAQA 4B99A 2FB8A 3QUEA 4W9WA 2QLQA 3C0HA 4LGHA 5EKNA 3TNIA 4FTLA 4DEIA 5LVLA 5AIKA 4PTCA 3PY1A 3DTCA 2XNNA 2O8YA 4X6QC 4PF4A 5AR7A 1U5RA 3ETAA 3GCSA 3R2BA 5B7VA 3OOMA 4F70A 4QQJA 4F4PA 2GQSA 5CT0A 3FKLA 3OUNB 4TWOA 4L8MA 3ZUUA 2OFVA 3A8WA 2JIVA 1UNGA 1V0PA 3Q9XA 4LRMA 3KQ7A 4FT9A 4ZP5A 1YDSE 3CTQA 2XM8A 4FKSA 3ZZEA 4EH7A 4RFZA 5BVDA 1B38A 4JLCA 3FMEA 3GCPA 3FY0A 3SG9A 3A2CA 2PHKA 3KRXA 3F3WA 5IEYA 2IPXA 4GT4A 5CU0A 4X0MA 2UZBA 3TTIA 3KVXA 4LG4A 3OY1A 3TEIA 4G3FA 4IB1A 1H1QA 1OM1A 2R5TA 4WA9A 3AGLA 2PMIA 3NLBA 4HPUE 4M15A 2OO8X 4N4SA 4GT3A 2YDKA 2J5EA 3FL5A 5LWNA 1G5SA 3DOGA 5K4JA 1VYZA 3EZVA 4J96A 3P08A 3Q2MA 3PXZA 3I6WA 3SQQA 4BHZA 4PMSA 3T9TA 4DEHA 3UO5A 3E8EA 2R7BA 4NL0A 4Q9SA 3DK7A 2W5AA 3QTXA 5CAQA 1XH8A 3PXFA 1LEZA 1RJBA 2WB8A 5CEMA 3V6SA 5AUYA 2IW9A 4QP7A 2C30A 3HMOA 3K3JA 3EFWA 3MVLA 5TO8A 5IPJA 2YLFA 2UZTA 4EK5A 2XEYA 4N0SA 4OUCA 2V55A 3QWKA 5CY3A 3VNTA 4U9AA 4YR8A 5BNJA 3F2NA 3ZRMA 4O6LA 4PL3A 4BI1A 2UW3A 3MA6A 5BVEA 3DAJA 4IADA 5CX9A 4DGLC 2PMLX 3W0SA 3D15A 4BBFA 4KIOA 4BCGA 4AXDA 5IDNA 4F65A 2J0KA 2V62A 5HTCA 3MPTA 3ZXZA 3NIEA 2OGVA 4H36A 4ANLA 2Z8CA 3FLZA 3VBXA 5FP6A 3PA4A 2FYSA 4FT5A 3DAKA 4GCJA 5ETFA 1H1PA 4FNWA 3V5TA 2NNWB 3O71A 2RKUA 4PP9A 5ETCA 3DZQA 2W1EA 4AS0A 3WZUA 2XK9A 4YJQA 4GRBA 2PU8A 1XH7A 2QODA 3MDYA 4FTJA 3GI3A 1REJA 3E8CA 1ZMUA 3U51A 3DTWA 3TZMA 2CNUA 4YO4A 2I1MA 4YNEA 5FM3A 2CCIA 2GTMA 3EQIA 4UWYA 4BTMA 3L9PA 3KN6A 3PJ8A 3FI4A 3SAYA 4BKJA 3KC3A 5AV1A 3CIKA 4IZAA 4IVCA 3HMNA 5LOHA 2UW6A 5AP1A 4L00A 2BDJA 3MY5A 3OD6X 3IGGA 1SZMA 3RKBA 3DV3A 4BL1A 2C0IA 4BTFA 3EQHA 3FKNA 3ZOSA 5L6OA 5E90A 3PJ3A 2VWVA 2GNGA 4O7TA 3Q4ZA 4RLKA 1NVSA 3AC3A 5FLFA 2A27A 2CHLA 3DA6A 3LFNA 4PP7A 4D5HA 3FMJA 1ZZLA 3VUIA 4D28A 4UMUA 4C4GA 5IUHA 3MIAA 3RJCA 2ZVAA 5KNJA 4ANSA 3MPMA 1R78A 1S9JA 3C13A 1UU7A 5AV4A 3MH1A 4O4EA 4OTDA 4XP0A 3AC2A 4JRNA 4Z16A 2QOHA 3W0RA 4FBXA 4FIIA 4RQVA 3C5UA 3ERKA 5CNNA 4C61A 3UDSA 2XCKA 3HKOA 3OBGA 4MBLA 5HVYA 5FTOA 4C02A 5IQGA 3EB0A 4O0YA 4YZBA 3S3IA 4LQMA 4OTQA 4CV8A 2FVDA 3SDJA 1NT2A 2ZOQA 1WBTA 2PYWA 3DBDA 4FV1A 4KS7A 2ZV2A 3OCSA 5FTGA 2CMWA 3VJNA 2WELA 2WQEA 4I93A 1ZOEA 4DDIA 4OTPA 2RL5A 3GU6A 5CTPA 5A54A 2AC5A 2LAVA 4BBMA 4QMNA 2J90A 2ONLC 4AW2A 4ZTLA 4I41A 3MSSA 2IVUA 2QOOA 2C5OA 3CPBA 3PVUA 4FKUA 3P23A 4EL9A 2O5KA 5G6VA 4YTCA 4BYIA 4QMWA 5IA0A 4DHJA 3KXZA 4KBKA 2WTKB 1H1WA 4LUEA 5I9YA 1WVYA 5LVMA 4B6LA 1Q97A 1QL6A 4L7SA 3N9XA 2X39A 3FL4A 3UG2A 4XP3A 4AW1A 4U0IA 3NNXA 2EU9A 4FT7A 4O2ZA 3SKCA 4CV9A 2W05A 1TFFA 2YM8A 4EOLA 3MFUA 4E3CA 2C5NA 4G9CA 5KMNA 1OL2A 3BE9A 4JMQA 4QMPA 5E8ZA 3QQGA 1ZWSA 2RIOA 5CU6A 1J7UA 4RA5A 4FVQA 5I9WA 3C4EA 3TV4A 2ERKA 3OXTA 2QNJA 4QTDA 2XH5A 4BCPA 1OI9A 4FZAB 4C8BA 3MI9A 3R7GA 3C5IA 2BRGA 3T3UA 2I7QA 5CSVA 3WF7A 4MF0A 5C01A 2PVLA 5GHVA 4EH5A 3UO6A 4XJ0A 1SMHA 3VQHA 3CE3A 3KVWA 4AF3A 3OZ6A 4YPDA 3PLAE 4M84A 1CKIA 3G6GA 2BIKB 3C4FA 2V7OA 1Q24A 4IJPA 5CZIA 4J8NA 5HG8A 5L2WA 3LMIA 2ITVA 1MQ4A 2CLXA 3QTWA 2XYUA 4BHNA 1DS5A 4BVUA 2RF9A 5IKWA 2O3PA 3E5AA 2O0UA 3R22A 3UNZA 5HD4A 3PVGA 2CNVA 2X8DA 4ACHA 4BDKA 1QPEA 2BMCA 4RFMA 1NVQA 4GW8A 1JSTA 3HA6A 2Y9QA 5E9EA 5FEQA 1XH6A 2P33A 4YMJA 5JQ8A 5IA5A 4KINA 1H25A 4NFNA 3UC3A 4F9CA 2PUPA 4P5QA 3F69A 4AQKA 2B9HA 5IF1A 2QOLA 3L8PA 3ORKA 4AT4A 4ZJVA 4IM2A 3PJCA 4NFMA 5T68A 1FINA 4E1ZA 2VU3A 5I3RA 5HZNA 3BZ3A 4BIBA 1BKXA 3MB6A 4HCTA 3NFGB 3CY3A 3TI1A 4U44A 3V5PA 1QPDA 4ZXTA 4KSPA 4QMMA 5E92A 4CCBA 3U87A 1EH4A 2W1DA 3FBVA 4UMPA 2ZFYA 4HPTE 5FTQA 4AAAA 2ZV9A 5AEPA 4BTJA 3PUFC 2GNIA 2P0CA 4XX9A 3NRMA 3TZ8A 4L68A 2JAMA 4LV8A 4FEUA 3PIXA 4APCA 4PL4A 4UB7A 2HIWA 4GIIA 3TZ9A 4JRVA 4NUSA 4K8AA 4M0ZA 2GS7A 1VZOA 4N6ZA 4W4VA 1Q3WA 1WVWA 4CZTA 5AAEA 2AEGA 2VO3A 4Y5HA 5D41A 3EL7A 2ZMDA 2GS6A 4A9SA 4IAKA 2OW3A 3LIJA 4RFYA 3SXFA 5FDPA 4JQ8A 3H9FA 2CKPA 2G01A 2HY0A 2PE1A 4EK6A 2WTDA 1ZXEA 3VF8A 4CFVA 1STCE 1Q41A 4W8EA 5TT7A 4HGTA 3V01A 4WNMA 4NYEA 4XV9A 4QQTA 3QA0A 4DFXE 3SVVA 3EFLA 1YHVA 4J97A 4G6NA 4RT7A 1TZDA 4HW7A 3H9OA 3W2CA 3PRFA 5T3QA 3UDBA 2IF8A 4BCJA 1OL6A 3DT1A 3TKUA 3TACA 3WF6A 3IDBA 2PUIA 2QHMA 3D14A 3IW4A 4IXPA 4U5JA 3EWHA 4E4NA 5J87A 3EQGA 4G17A 3S4QA 1H01A 4AUAA 5AJQA 3JPVA 1YXXA 2Z7LA 4QPMA 4C4HA 3MESA 3PWDA 3TNHA 5K9IA 2PPQA 1YOJA 2PVYA 4YZCA 5HG9A 2C6IA 4F9WA 2VTIA 4OGRA 4YJOA 5CVFA 3IPHA 3K54A 5LVOA 1YI6A 1HCLA 4JBQA 3LFFA 2C3JA 3ZYAA 3ET7A 3DK6A 2Z7SA 1U54A 3FLYA 5H8BA 2WTIA 2UW5A 2J0JA 1P5EA 3NCGA 4FG7A 4O0WA 5FG8A 3AC4A 4O82A 4LRJA 3NW7A 4KKHA 4BCKA 4LDTA 5C27A 3TCPA 3UZRA 3O8UA 3RHKA 4OBPA 4O7VA 3UQCA 3DB6A 4HVHA 2YM6A 2QOQA 4MQ1A 2V22A 3LM5A 3QQFA 3NNVA 1UWJA 1NVRA 3VUKA 5KMMA 2GNHA 3H30A 3DNEA 4I24A 4ASXA 3F5UA 4IX4A 3L9MA 1OMWA 3V6RA 4YC8A 3EIDA 2XBJA 4ZY4A 4G9RA 3FJQE 2FH9A 3BYVA 2JDVA 4TRLA 4U97A 3AC1A 3CD3A 4FG9A 1J7LA 3TDWA 5IDPA 2YM7A 5EH0A 1FGKA 4ZSLA 5TF9A 4AZSA 2JDRA 1W84A 4FL3A 5EM8A 4GU6A 3FYJX 3QRJA 2YIXA 3LW0A 4M69A 4RX8A 2UW0A 3PVWA 2WIPA 3RCJA 4MNFA 5KMOA 3PYYA 3VHKA 1W82A 4CQEA 5FD2A 4K9YA 3O96A 2PZ5A 3BELA 5HLPA 1G3NA 3R8LA 2XB7A 5CLPA 4PTEA 5CF6A 4JG7A 5EHLA 4I4FA 2X9FA 3KXMA 3HV6A 3NYXA 5D1JA 4FIJA 1BYGA 3CD8A 2JDTA 3MH2A 4FSMA 4ZJJA 1OKVA 1ZMWA 3AG9A 4IWDA 4AGDA 3DNDA 1P14A 2OZOA 2HW6A 2WD1A 3QD4A 2GDOA 4CCUA 4F7JA 4GKIA 3NMUF 4XUFA 4MF1A 4K77A 3HMIA 3KF7A 2B9IA 3NUYA 4ALVA 2JDOA 3NYNA 4KBCA 4E20A 1UV5A 2J0LA 3ZLYA 5KO1A 4DG2E 4RJ8A 3R01A 5HESA 1UU9A 4U43A 4ZTHA 3VUDA 3GBZA 1CSNA 5AM7A 3P7AA 3PRIA 4M14A 5EW8A 3G15A 4EOPA 2GNLA 3ZO2A 3NWWA 4FIEA 5IQEA 3W0QA 1ZYSA 3CXWA 2OJFE 3TJDA 4I6BA 5JQ5A 4FSNA 2P55A 1TQPA 2W1CA 4UMTA 3QGWA 4WBOA 2B7AA 2B9FA 2J7TA 2ZMCA 1OECA 3F3ZA 3HA8A 4G5PA 1KE5A 4X6RA 2XS0A 2W9FB 4Z9LA 3ZUVA 3JVRA 4G31A 3BGQA 4AZVA 3U6JA 3WARA 3LQ3A 3IDPA 3ORLA 4EHZA 3CQWA 4RIYA 3PA5A 1Y8GA 4FGBA 4JAIA 3AQVA 1WVXA 4AT5A 4DG0E 4IX5A 4J52A 4QQCA 1Z57A 5CEOA 5LWMA 1JSUA 2XK8A 5J79A 3ZO1A 2Z02A 1QPJA 5JKGA 4CFUA 4NT4A 4MXZA 4AACA 5CF8A 4CG9A 3LCTA 4LM5A 5JFWA 4R7BA 5CEKA 2XRUA 4Y83A 4QPAA 2F7ZE 1WAKA 2WZJA 2XKFA 3BRBA 3KA0A 4RIYB 4C2WA 4C3RA 3RWQA 1OUKA 5EI8A 4F7NA 1XH9A 3U6IA 3OHTA 5KBRA 4FSQA 4HZSA 4EUUA 2VNWA 3M2WA 2BVAA 5JMSA 3L8VA 1GZOA 2IZRA 3H3CA 4TYGA 4X3FA 3IONA 3Q9YA 3PWYA 4H58A 2UZLA 4LRKA 5E1SA 1AGWA 2XYNA 5D12A 4R1VA 3Q5IA 3HLLA 2GNFA 4WT6A 3R7OA 5L3AA 3O8TA 5ICPA 1PF8A 3ORMA 4WRGA 4FI1A 5GIPE 4QTCA 4ERKA 2YDJA 3SOCA 3VS3A 3FKOA 4PPBA 4TYEA 4DC2A 3QZIA 4IX3A 5GZ9A 3D94A 3W16A 3F6XA 2XP2A 3R83A 1SVHA 3W8LA 3ZLXA 2QCSA 4F1MA 2WNTA 3U6HA 4TWCA 5AUVA 5JSMA 3CEKA 5B2MA 4BJJB 3TXOA 4D4SA 4DBXA 2QI8A 4EH8A 4FUXA 2UUEA 4EH6A 2H6DA 3QLGA 2YWVA 4J99A 4D1ZA 3FI2A 3A4OX 4KIPA 2WXVA 5AV0A 5TR6A 4PPCA 4PY1A 4Y72A 4YJTA 4FC0A 4ACGA 2DUVA 2Y6MA 1OIUA 4V05A 4KAOA 3NS9A 4EZ5A 4CGAA 3CS9A 4BTKA 3FZ1A 2XIYA 1H1SA 4JXFA 3PVBA 4V0GA 4ZK5A 3TKHA 5M4IA 3G90X 2C0TA 3DFAA 5JRQA 1IAHA 3BWFA 5CS6A 5ANKA 3E7VA 3BCEA 2IZSA 3QTIA 1RQQA 2E9UA 3IKAA 4LMNA 1SYKA 3FY2A 1DI9A 4JIAA 1BX6A 3UMWA 3EH9A 2GSFA 5HO8A 2OIBA 4UMRA 5KX8A 1JAMA 5HTIA 3BLQA 4IE9A 4O0TA 2PMOX 4AXCA 4V0GB 5CAOA 3NR9A 1W83A 1OBDA 1WBVA 4MKCA 3R7EA 1PXMA 4L6QA 4E4MA 2H96A 3RAWA 2C6TA 2F49A 4FUYA 4JDIA 2ZV7A 3P5JC 2HZ0A 3DXQA 3TKIA 4NKSA 5L2QA 4QMOA 5HVJA 4EOMA 3R9DA 2ACXA 3K2LA 3P0MA 2WMUA 2BAKA 3Q53A 3VUMA 2XJ0A 3G2FA 3M11A 1ZYLA 3VBWA 3UZTA 4H05A 2VUWA 2VGPA 3HECA 2C3KA 4CLJA 1K9AA 4FV8A 2WQBA 4FIFA 3NEWA 1JKLA 4IAYA 5GINE 3RPOA 3G9NA 3F5XA 3O50A 4D9UA 4WKQA 4FKGA 5L2SA 4LV7A 4MWHA 4FJVA 5FWKK 3RZBA 2NP8A 2Y4IB 1TQIA 3DDQA 2OF2A 2IVSA 3DLZA 3Q4TA 2VWIA 3ENHA 4IHPA 5IEXA 5D7AA 5EHYA 3BYSA 3BL7A 2HWOA 4FTRA 4FV0A 4ZSEA 4KRCA 5DFPA 5DOSA 4CKIA 3ZEPA 2BHEA 2BZKB 3FQSA 4IM3A 4BI2A 2IZUA 4BIEA 4EH4A 5LVPA 4NCTC 2YIQA 4NEUA 3TNPC 5HLNA 5J5SA 2BPMA 2R3RA 3LHJA 3OCGA 2OXXA 5CQWA 2B53A 3TN8A 5LCKA 1VR2A 3UG1A 4S30A 4BI0A 2WMVA 2ZAZA 5E8TA 4QP9A 3I6UA 4XG6A 3ORXA 4HGLA 4ACDA 4V04A 4XOZA 3SD0A 3COHA 4M12A 1H00A 2C1AA 3VN9A 4A9RA 2PE2A 4M0YA 4QNYA 4AXFA 2VX1A 4I6QA 2Q0BA 5DR6A 4CZUA 2X9EA 2BZIB 4YLLA 4AZEA 4QMVA 2X6EA 3D4QA 4FSYA 5LMAA 2I0VA 3OS3A 2OZAA 4Y73A 3R1SA 4FL1A 3WYXA 4GH2A 4ZTNA 2PWLA 3NZ0A 3PPJA 4ANQA 5IMXA 3GQLA 4FKJA 2XK3A 3WYYA 4AZTA 3R7UA 4RIWA 4HVSA 5A14A 5AR4A 5IZFA 5A6NA 2BCJA 1KE7A 1OL1A 2W06A 2XCHA 2CKOA 1ZYJA 4LOQA 3CSVA 3L8SA 3CQUA 5A6OA 4XV3A 3F88A 2F4JA 4OTIA 5ANJA 3EQPA 2GHGA 2BRMA 3FXXA 3KY2A 3OY3A 3P9JA 5EQPA 3D5XA 3KK8A 3NVKI 2UVZA 3Q96A 1IR3A 2VO0A 2YZAA 3MN3A 1Y91A 4XCUA 5F95A 5GNKA 5DMZA 4ZJIA 3OFMA 4X2FA 4CQGA 4YBKA 3MB7A 3ORZA 4FTCA 1FVVA 5A4TA 4M67A 4FNXA 4AOTA 5HORA 3ORNA 1GZKA 2QURA 3F2RA 1U4DA 4FODA 4WUAA 1W7HA 3R02A 5BMSA 3NUNA 1XJDA 4RJ6A 1ERKA 4BDGA 4PNKA 3VBQA 5JFVA 1CKJA 1H4LA 1WBNA 2C5YA 3BV2A 3DBEA 4K1BA 4MXAA 4YSMA 5FQDC 3RZFA 4U41A 3QF9A 2BUJA 4UZHA 4OR5A 5CALA 3GC8A 4FNZA 4TKSA 5EM6A 3DB8A 3U4UA 4EYMA 3JXWA 3O5AA 4IAFA 2BRNA 1REKA 3BE2A 3OUKA 4O7ZA 5LMBA 1M52A 1YHWA 2XJ2A 4FOCA 4P5ZA 4MQ2A 5ANEA 4FE2A 4DFBA 5IQFA 4U8ZA 4ZLOA 4DFYA 5BVOA 4PQNA 4RWLA 2F9GA 4IC8A 4I6LA 5EFQA 1UVRA 2J51A 4G2FA 4DFUA 1QPCA 2ZB0A 2EVAA 2Z7RA 3E93A 3D83A 5AA9A 4LMUA 4QMZA 1MUOA 3VULA 1XHAA 2HOGA 3AMBA 2OJIA 4ALWA 2B1PA 4MNEA 4U6RA 1YKRA 3OF0A 3PG3A 5CSWA 5AA8A 3AT4A 3WZEA 2XNGA 3HUBA 2R3JA 4QMTA 3KFAA 4TYIA 3ZBFA 4ANBA 5L2TA 3A7IA 4LYNA 4DGGA 2X4FA 5H3QA 4KUJA 3D7ZA 5M06A 5E8WA 3VAPA 2NO3A 1ZOHA 2H8HA 1MRYA 3C0IA 4Z7HA 1FMOE 2YM3A 4BKZA 4OTGA 3IG7A 4BY9E 4L53A 2ETRA 4ZTMA 5AWMA 5FRIA 2XNOA 4J98A 4MNEB 4DH3A 1G8JA 2X8EA 3NVMB 4I3ZA 2R3LA 5EQEA 3E3PA 2EXEA 3QCXA 4GKHA 2PZRA 1HCKA 3ALOA 3UIMA 2ITNA 3QA8A 3HMPA 4ZSJA 1Q8UA 4U3ZA 5M44A 2WMQA 5CWZA 2F2UA 1K2PA 2OG8A 1OBGA 3MTLA 5AP4A 2R3OA 4HVIA 2VTMA 2OBJA 4J7BA 5GJFA 5C4LA 3C4WA 3FLNC 2XNPA 1UNHA 4KA3A 2VTSA 3GP0A 5BV3A 3KXGA 2R3NA 4LOOA 4D2RA 3EL8A 2C3LA 1FVTA 4NK9A 4WG3A 3VHEA 4HYHA 1UU3A 1QMZA 2W1GA 3H9RA 1ZLTA 3OC1A 4H3QA 3QTZA 1BUHA 4USFA 1U5QA 3LFQA 3ZEWA 4BZOA 1PMVA 1URCA 4FVPA 3BGPA 4Q5HA 3ZZWA 3QTRA 5I9ZA 2X1NA 4L7FA 4TYHA 4QD6A 3TV6A 2FSLX 4BCMA 1W2DA 1M17A 4A06A 4FSZA 4MWIA 2IVTA 4O4DA 4L45A 3GC9A 4CFFA 4YZMA 1G8SA 3Q2JA 2YM4A 2J2IB 2GFCA 3ANRA 3BU5A 4NIFA 1J3HA 4ANOA 2WTVA 1L3RE 4E93A 3UZPA 3KKVA 5C26A 4EBVA 2EB3A 3IDCA 4DA5A 1MRVA 2R3QA 2PY3A 2BR1A 2YAAA 3BU3A 4JNWA 4TYHB 1A9UA 3DPKA 2YN8A 2VD5A 5BUIA 4MBIA 2WU7A 5HLWA 4FKRA 2BZJA 4CXAA 5EK7A 2R3PA 5E8XA 3CKWA 2X6DA 1J1CA 4NIFB 4OTWA 3BQCA 4YJRA 2WTJA 4ASEA 4Q5EA 5AP3A 5GJDA 3A61A 1IASA 3I81A 3D7TB 3N4UA 4YJNA 3EYHA 4I0RA 4E6CA 3RK7A 2XIRA 5AUXA 4LUDA 4JQEA 5HIDA 4OT6A 5J5TA 4L46A 3VW6A 5BYYA 4D2TA 5EW3A 3QD2B 2C5XA 1PMEA 5BVWA 4QP2A 3R1QA 4QDVA 2ZV8A 4QYYA 4FSWA 3D7TA 2O65A 4IDVA 5J7BA 2Y8OA 2XM9A 2R3KA 2XKCA 3L9NA 3P1AA 4MYGA 4L52A 1R1WA 5FXRA 5AR3A 4IW0A 1ST4A 3BHHA 2CGXA 4WG5A 4P4CA 2OICA 1B39A 2W5BA 4D5KA 2F57A 2X0QA 4E73A 4FEVA 5FEDA 3H0ZA 3JY0A 3RM6A 4DGMA 2PVRA 4AN3A 3QQJA 3R9HA 4F7SA 2WQNA 3DFCB 3ITZA 2VGOA 4KIQA 3DKCA 3W0MA 1DAWA 2QOKA 4JJRA 4A4XA 3F3UA 3F5PA 3D5VA 2PZYA 2I0EA 4MXXA 3ZDUA 4IMYA 1BI8A 1H1RA 5HCYA 4WHZA 3VQUA 1YXSA 4EOQA 4MUQA 2X2LA 3RCDA 5DG5A 1PHKA 5DRDA 3Q3BA 2GHLA 3ANQA 4JBVA 3SV0A 3C9WA 3PJ1A 3UVRA 4EQMA 2OLCA 3RALA 3BI6A 2E9OA 3LPBA 4D2WA 4D4RA 3W33A 2R3IA 4EOSA 3LJ1A 3HGKA 4DHFA 2ETKA 4GVAA 5A9UA 2G2HA 4TL0A 1K3AA 1VYWA 2YWPA 3B2WA 4W4XA 3ML1A 4FTUA 5DEYA 4GK2A 1BI7A 4FKVA 4NTSA 4ITHA 4C36A 2Q83A 1GAGA 3K3IA 4RIXA 4WIHA 3ALNA 2HXQA 3DJ5A 3F82A 1T45A 3NW6A 4IZ5A 2UVXA 3FXZA 2OH4A 4DLIA 4AGWA 2Z2WA 1PXLA 3FQHA 5CYIA 4BFMA 4XG8A 4ITJA 3E88A 3FMKA 4QMLA 5CENA 3GXLA 3KRLA 4NW5A 5ETIA 5HICA 2EXMA 3E63A 4I6HA 3SA0A 3BWJA 5DLSA 1S9IA 4RWKA 3FYKX 4EKLA 5FXQA 2WU6A 3LJ2A 4BRXA 2WAJA 2P4IA 1CM8A 3MIYA 3COIA 2IW8A 2VO6A 4WG4A 4RZWA 3EN4A 3LCOA 3U4WA 3R8VA 5HBJA 5IH5A 3E3BX 4G3GA 3IK3A 5IMEA 5F9EA 3ZUTA 1JSVA 1T46A 1H27A 3MJ2A 1IRKA 1OPJA 3JUHA 3L8XA 2W4OA 3Q32A 3MVHA 3KULB 3R63A 2GTNA 4ZIMA 5ANIA 5HU9A 4L67A 2QU5A 5FXSA 2AQXA 4XS2A 2BDFA 3B2TA 3ACJA 5HI2A 1SM2A 4M13A 4XV2A 3EKKA 1ZY4A 2PVKA 3UNKA 4L9IA 2R0IA 2HELA 4FICA 3UVQA 4YJVA 1KOBA 2JKMA 3KULA 4G16A 4N57A 4TPTA 5DR9A 5EG3A 4DAWA 4FKTA 3LQ8A 4O4CA 2OJGA 2KTYA 2R7IA 2HZ4A 3PSCA 3CR0A 5BVFA 4XP2A 2BALA 2QVSE 4V01A 2DWBA 4DG3E 1LPUA 4QYEA 1W8CA 5BMMA 3AMYA 4NTTA 4BIDA 3DLSA 4C0TA 4DCEA 1O6KA 4DGNA 3FSKA 3SRVB 3VJOA 5EM5A 3LQ5A 4F63A 3MVMA 4F1TA 5CASA 2R2PA 5L8KA 4FVRA 3II5A 3BHTA 4ZLZA 4K33A 3E62A 4JIKA 4BDFA 3TNWA 2XKEA 5EI2A 4EUTA 4FEQA 3HX4A 3BBWA 3KK9A 5CT7A 2VWUA 5HE1A 4DTAA 3R28A 2VWXA 3ATSA 2XJ1A 4I92A 1OIQA 1ZAOA 4O1OA 4A9YA 2VWBA 3LZBA 4PMTA 5DE2A 3RPRA 5A4QA 5L4QA