4EWHA

Co-crystal structure of ack1 with inhibitor
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
275
structure length
274
Chain Sequence
LTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Activated CDC42 kinase 1
publication title Synthesis and optimization of substituted furo[2,3-d]-pyrimidin-4-amines and 7H-pyrrolo[2,3-d]pyrimidin-4-amines as ACK1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 78
structure length 274
sequence length 275
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ewhA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ewhA01
5CF5A 4H3BA 3U9NA 2CNQA 1J91A 2J4ZA 3E8DA 4IH8A 4XG9A 3QTUA 4IX5A 4BBFA 5D12A 2PVRA 3TZ7A 4O7LA 4WG5A 3POOA 1OKZA 4FICA 4RX7A 4CMTA 4R77A 3CGOA 2JC6A 3LFFA 3KXNA 3KMMA 4GVJA 5EDRA 3UP2A 2WMAA 3W33A 2VTLA 4FTMA 4WSQA 5HLNA 1WBOA 3MY1A 2QONA 1YWNA 3BGQA 3ELJA 5DT4A 3VS4A 5EH0A 5LCKA 3PWYA 4FT3A 5FP5A 3ZBFA 3V8TA 3D9VA 5AR7A 1GIIA 3RCDA 5HTIA 4J96A 3GU7A 5AAGA 4C2WA 4UMPA 4F9WA 3TEIA 4D2VA 5EI6A 1WMKA 5HNBA 2WQBA 1UWHA 2CN8A 3ZEWA 4QTBA 3ZLXA 3ZSIA 5IQFA 3PZEA 1H1QA 3V5WA 4M15A 4B8MA 5I3RA 3BBWA 3DTCA 1PYXA 1GOLA 2W5AA 3LFAA 2YIRA 3PIZA 3QLGA 1PXMA 5GZ8A 1UU3A 1YXXA 4FE2A 4GKHA 3QRIA 3R6XA 4C0TA 5JFSA 3FMJA 3PY0A 3U6JA 1GY3A 2B53A 4YZBA 4DG2E 5M4CA 2W9FB 4K2RA 4MQ1A 2I1MA 3NZ0A 2UW0A 4EH3A 2YCSA 1DI9A 3I5ZA 3R00A 3TV4A 5M4UA 2GS6A 3HMNA 4OTDA 2IZSA 4TWPA 5ANGA 4EQMA 3PJ3A 3DS6A 4XX9A 4I5PA 5CEMA 4FEVA 5L2TA 4WBOA 2CPKE 1FMOE 1T46A 4G17A 4I41A 3OT8A 4QP3A 4RT7A 4CGAA 2XK4A 3WF8A 1X8BA 3BCEA 3ZSGA 2XKFA 4Y8DA 3QKLA 5DWRA 1CM8A 3RALA 1YW2A 2UVXA 3DLSA 5JN2A 3KVWA 1OPJA 2C3LA 4U45A 2EXMA 2BILB 5ANOA 4AZSA 4FZAB 4ONAA 3KFAA 4P7EA 4D0XA 4HCUA 4L43A 3HZTA 5CVFA 1YWRA 2PY3A 3F3ZA 4QMXA 4CSVA 4ZEGA 2IZTA 1W98A 4RIOA 4CEGA 3FMHA 3OMVA 2XJ1A 4LYNA 2E9OA 5CU3A 5C26A 2GNFA 3NR9A 3PG3A 2C5NA 3K2LA 5M08A 3H30A 3MB7A 1QPCA 4FNZA 4QPSA 1URCA 4FODA 3ZO4A 4H1JA 3ZEPA 5CAOA 4BC6A 4D2SA 2GQSA 1LUFA 1VEBA 3OCBA 4AT4A 5AP4A 3F69A 4TL0A 2YIWA 3LCDA 4YTFA 2C6IA 2BFYA 4O22A 2R3HA 3OT3A 1OKWA 3UIUA 3FMMA 3QQJA 4I24A 4EWQA 1IRKA 3DBEA 2QO9A 3EN6A 3I60A 3W10A 4BICA 4EEVA 3MH3A 2EUFB 2CDZA 4G16A 2UW8A 4N0SA 3TTIA 4RJ4A 2B4SB 2V22A 2IWIA 4RVTA 2QURA 2VTIA 1OVEA 4XLIA 3RP9A 2YIQA 5CEPA 3IW4A 1I44A 4BCKA 4CQGA 5CSPA 3O8PA 3MH0A 4FIHA 3QRJA 3O17A 3BGPA 3Q4TA 4PRJA 5KZ0A 2RGPA 3PRIA 4V01A 2OIQA 2GFCA 4AW0A 2UZOA 5ETCA 1V0OA 3PVGA 4YU2A 4I0RA 3L9NA 2B1PA 2W17A 4U8ZA 5LOHA 3C5IA 2HYYA 5JZNA 3UIMA 4EH2A 3RNYA 4IVCA 5AV3A 2J2IB 3EYGA 4IJPA 3U87A 5IZFA 4L8MA 3THBA 4I6BA 2OG8A 2XKCA 5EG3A 2RFEA 3K54A 4DFBA 3PA4A 3V5JA 2XIKA 3LFSA 3ZLSA 3UNKA 5FDPA 5BNJA 5I0BA 2A1AB 4O0RA 4BFMA 5CEIA 4IM2A 2OO8X 1U54B 2VRXA 4C34A 5L8LA 2GNJA 3OC1A 4MTAA 3CGFA 4B6LA 4EH5A 5BVNA 1S9JA 5I9VA 5JGDA 3SRVB 1SVGA 3FSKA 5JK3A 2H8HA 2ZVAA 3PY3A 2WB8A 3UO4A 4AGDA 4XLVA 1R0PA 2QD9A 3RPRA 4BRXA 3GFEA 5JGAA 4BCPA 2WEIA 4ZMEA 3LLTA 3TKIA 5DFPA 4JR3A 3RK5A 5JQ5A 4EOIA 4MBJA 4U40A 4DTAA 3GC8A 4K18A 2QR7A 3W8QA 4BDFA 4CG9A 2UZWE 2Y8OA 4EOOA 4RZVA 4O7RA 4DF3A 4E6QA 3DXNA 4ARKA 1TQIA 5CAVA 3ORXA 3PJ2A 5JFVA 4PMPA 3VF8A 3TT0A 4O0VA 4TYJA 4R7IA 1H08A 1PXIA 3EQHA 4FV1A 1ZYCA 1H00A 3FXWA 2ITUA 1A9UA 1QCFA 2PL0A 3DKOA 4PDYA 2W4OA 4MXAA 3MPMA 5KNJA 3R8VA 4Y85A 3Q4CA 1LEZA 4AA5A 4RFMA 5C01A 3RINA 3KEXA 4U0IA 4U80A 2OK1A 2I6LA 3MPTA 4FKWA 4KKHA 4ZP5A 2OKRA 4F9YA 4WUNA 5DG5A 4IJ9A 1BI7A 2RSVA 3KREA 3LCTA 4ZAUA 2JKQA 2YWPA 1IR3A 3MY0A 2JDOA 4PMTA 4F0IA 4FTUA 3UYSA 2JLDA 3V3VA 4J97A 4U9AA 3IQ7A 1PMUA 2R64A 4YBJA 3QTXA 4BCHA 5FTQA 4F1OA 2GNIA 4UYNA 3EZVA 1E1VA 3FY2A 3PG1A 1AQ1A 2XK8A 2C6LA 3QRKA 2UZVA 4I3ZA 4J8NA 4R3PA 2DUVA 2VO0A 3COKA 3W2CA 3KRRA 3DAEA 4RIXA 2HZIA 4RMZA 5IDPA 3IS5A 5CF6A 1K2PA 3BU3A 3HL7A 2I0YA 3KB7A 3TJDA 3QTWA 3HRCA 2J0JA 1V0BA 1K9AA 1W0XC 3A8XA 4JDIA 5B7VA 2B9IA 3PLSA 5K5NA 4ASDA 4FSYA 4O96A 1NVSA 2R3KA 3U55A 2CJMA 4EONA 2CKPA 3TN8A 3BE9A 4FTOA 3KULA 3KRXA 4JAIA 3OZ6A 3EN9A 3GQIA 3DFCB 4FV8A 4EK8A 4FEXA 4BKZA 3PSCA 2W1EA 4O82A 3F7WA 5G1XA 4MAOA 4YLLA 5FBNC 4CMUA 3PWDA 4ZTRA 4E5AX 2HW7A 3OW3A 3KF4A 5H3QA 4O0SA 3LPBA 4IFCA 3FZRA 5AUWA 5HG9A 1OIYA 2IO6A 4E7WA 2G15A 4GKIA 2QOCA 1LP4A 5K3YA 4LRMA 4PP7A 2WMWA 4ASXA 4E5BA 2QG7A 3QD0A 4EJ7A 4ACGA 3BU6A 3IONA 3BQCA 4TT7A 4YC6A 4BCNA 3A4OX 3POZA 1CSNA 2QU5A 3NCGA 3ITZA 4NTSA 5IA4A 3UIBA 2BFXA 3DBDA 4BB4A 5C1QB 2E9VA 4RX9A 4BCQA 2XEZA 1G5SA 2QOBA 3OW4A 4O86A 5CF4A 5E91A 4GFGA 4PMSA 3V8SA 3ZC6A 4DGMA 4NFMA 3HV3A 4U97A 4CCBA 3SA0A 2JEDA 4QTDA 3II5A 2C6KA 3KXHA 2A19B 3QCSA 5IQDA 2J51A 4HYUA 2YA9A 3HDNA 3OG7A 3QTSA 1G3NA 2IVTA 1ZZ2A 1ZOGA 4O7WA 3PDTA 1H8FA 2PHKA 5DEYA 3GVUA 2OH0E 2F7XE 2X6EA 2W1GA 2J0KA 4NWMA 3EMGA 3D2KA 4FKUA 4Y46A 1CKIA 1Q24A 3EWHA 1PRYA 4JR7A 3OS3A 5IQHA 3OTUA 5HVKA 3V6RA 1O6YA 2P4IA 4U7ZA 2BAKA 1HOWA 1H27A 3FZPA 4M13A 3ZRMA 4AZWA 5A14A 2XK9A 4BI1A 2C6TA 3LFDA 3COIA 2XH5A 1B38A 3TNWA 5IA3A 2WKMA 3QFVA 4FKVA 4YSMA 4KS8A 3EN5A 2BCJA 5IEVA 4FEUA 4XP2A 4I6QA 3E87A 3VRZA 5IA2A 1DM2A 5EW9A 1YHWA 2VTAA 4MNFA 3GU8A 3QQHA 4KSQA 4QYGA 2C3JA 4E4XA 4DE4A 3O7LB 3MV5A 2CNUA 4K9YA 5EM7A 4KBAA 4ZZNA 2W9ZB 4RSSA 2C0TA 4LGDA 1YXSA 2ZDUA 4ITJA 4FNWA 5JT2A 3GGFA 3QA8A 1OZ1A 3TZMA 4IIRA 5BYYA 2WGJA 3V01A 4XV3A 3MVLA 1IEPA 2W96B 4EH4A 4BTFA 4DG0E 3VS6A 4ANNA 3VUDA 5BQ0A 3L8PA 3PSDA 2WOTA 3FKLA 3R7OA 4C4FA 2G01A 4QP7A 2J9MA 2W1IA 4CLIA 2R3LA 3DTWA 1IAHA 3OWKA 1M14A 4GJ3A 5HCXA 3VUHA 3A8WA 4Z3VA 5KMJA 2Z8CA 5CSXA 4CT1A 2WZJA 2B9JA 3CJGA 5ITAA 4DHFA 1M2RA 1BUHA 4O0TA 4ENXA 2YERA 3LAUA 5AR2A 5H9BA 4A06A 2QOFA 2XMYA 3EL7A 3LE6A 4AOTA 2YCRA 4AT3A 3IDPA 3FSFA 3LQ3A 1M2PA 5HVJA 4D1XA 4Q5EA 4U41A 4AW1A 4I0SA 5CAQA 5CEOA 3BQRA 2CLQA 3QD4A 4C4HA 2R3PA 3HUBA 3BV2A 3IOPA 3V04A 5TT7A 2BRMA 1ZRZA 3FLWA 1Q5KA 3TM0A 3R1NA 4LMUA 5CVGA 4BY9E 4S32A 5LMKA 1OIQA 4AZEA 2Y4IC 1XBBA 4XG2A 4CKJA 3Q52A 3W2RA 4Z7GA 2PVMA 1FGKA 4FKLA 5DLSA 3C4CA 4YHFA 2ZB1A 1PKDA 4G3FA 2ONLC 3CIKA 5C03A 4AF3A 4CMOA 5IG1A 2VU3A 4FTKA 4CCUA 1GJOA 4YR8A 3VULA 5L8JA 4MKCA 4GYGA 4V05A 3R73A 5A4LA 3TNPC 4RC4A 3C51A 3HX4A 4QMOA 5CNOA 5FEEA 5C8NA 2NRYA 1ZLTA 1YWVA 1YXTA 3O71A 3PIYA 5HE0A 1YOLA 2WTDA 4W4XA 4EQUA 3VVHA 4WA9A 4OTIA 2XNGA 3QTIA 4DGLC 2ESMA 4X2FA 2FGIA 3R2YA 4I4EA 3VHEA 2W1ZA 2QODA 3GC7A 5AJQA 5HQ0A 5J1VA 5KMMA 4KWPA 1WBPA 3MH2A 4AZFA 4BWXA 4JJRA 3HYHA 5DH3A 1VYZA 2F2CB 3PXKA 2JDSA 2X4FA 4FT7A 1URWA 4ZK5A 5FM3A 2XNPA 2WTKC 5LXMA 2C5XA 2EU9A 4TN6A 3QYWA 3IGGA 1ZYSA 3OVVA 4QMSA 5M55A 2J0MB 4D4RA 3HKOA 1RQQA 4BCJA 3CPCA 5M06A 3VUIA 5EW3A 2PE2A 3NWWA 1JKSA 5CU2A 3BBTB 5E8YA 3ROCA 3R02A 3Q6WA 1DS5A 2HIWA 3LXLA 4YHJA 2UZUE 4NM3A 3NUYA 3DNDA 1M7QA 3JUHA 3KC3A 1H1PA 4MNEA 5GNKA 3EQGA 3E88A 4TYEA 4B8LA 5JEBA 3UZRA 4NIFA 2ITXA 2QOKA 3GUBA 3ZDUA 2HCKA 2C3KA 5IA1A 4ZTNA 2WMTA 2OZAB 3NS9A 5DE2A 5AUXA 1J7UA 4O7SA 4EH8A 1Q3WA 2YJRA 4GG7A 4NM5A 5FBOA 4FVPA 3K5UA 2C5YA 2CLXA 3GCVA 4FNYA 1F5QA 5CZHA 4D1SA 3TUCA 3R7VA 3R8UA 3P7AA 4BKYA 3FLSA 3E3PA 3QBNA 1O9UA 2B52A 3GNIB 1SVEA 4MEDA 3VQHA 4BTMA 5DRBA 3R7GA 2OJJA 4L9IA 3FI8A 2QO7A 4A7CA 4O2ZA 4L46A 4AFJA 3ORMA 1DAYA 3WI6A 3TUDA 2BUJA 4HYSA 1W7HA 2HY81 3F82A 3Q6UA 3UOJA 1YKRA 3DJ6A 4Z55A 3PLAE 4F63A 1IG1A 3WZEA 3BHTA 3OWLA 2VWYA 4QYHA 5DR6A 3SAYA 5JQ8A 4C3FA 4ZTHA 3KKVA 1L8TA 1YXUA 4OBPA 4PUZA 4YJSA 3VUKA 4FV7A 4V0GA 4F70A 3UMWA 4IE9A 5AUVA 2GSFA 2XJ2A 3LJ0A 4HYHA 4Y83A 5E90A 5HIDA 4A4XA 3LKMA 3HV5A 4OUCA 3UOKA 4AOJA 4GMYA 2VD5A 3SXFA 4RRVA 5HNIX 4FOBA 4R6VA 3Q60A 3VNTA 4YJPA 3ALOA 3C4FA 2YLEA 1AD5A 3FXXA 1RE8A 3KGAA 4V04A 4WNPA 5AAEA 4CG8A 2Q83A 1ZYJA 2QCSA 4AN2A 4D2RA 4PX6A 4BDJA 5F1ZA 4ANOA 2XIYA 3IW6A 3R0TA 4FSZA 4BDBA 4J7BA 5I9YA 4LL0A 3KVXA 4RA4A 4FKOA 4GH2A 5C9CA 2VO7A 2YIXA 2FB8A 1JSUA 2X7OA 5GIPE 3G9LX 5I4NA 4BDHA 1Z57A 2VNYA 4R1YA 5KE0A 2QOQA 3MB6A 4BYJA 3OFMA 4PPCA 5K4JA 4NEUA 3TIZA 2C5OA 4ZJJA 4RX8A 2R3IA 4C4IA 2XM9A 5AUUA 1PXKA 2GCDA 3BI6A 3PIXA 3TNHA 4FVRA 4EUTA 4WKQA 3QKMA 4PMMA 2XNBA 4Q5HA 4QMTA 4GCJA 2PVFA 2YAKA 4CV9A 1YI6A 4MXCA 3W55A 4TYGA 2OJIA 5DVRA 5HORA 2R0UA 4JT3A 4D28A 3EQCA 3SOAA 1G8AA 3MBLA 5LARA 3CXWA 4OTFA 1A48A 1MUOA 3EOCA 3LXNA 3A61A 3NW5A 4XUFA 3R8ZA 3EQPA 3ROYA 2FO0A 3ZC5A 3MWUA 4XHKB 1U46A 4C2VA 3DY7A 4ALVA 3QZHA 4E26A 1SYKA 2A27A 4DYMA 3KXMA 4IVAA 3H9RA 5DR9A 3TL8A 2VTSA 3R7UA 3SKCA 2ITQA 3EKKA 2YLFA 3GOPA 4JQ7A 1ZMWA 3QWJA 5EFQA 4NUSA 4CT2A 2HW6A 5K4IA 2BDJA 4ZSEA 2PZRA 3FZTA 3R9RA 1KE8A 3GBZA 5HX8A 1Y91A 4CD0A 5E8SA 3NIZA 4EJNA 3IK3A 3G6HA 1U5RA 1ERKA 3L1SA 4KKEA 4JI9A 2R4BA 2CKOA 4JXFA 4IFGA 1BLXA 4KKGA 5M4FA 3JY0A 5DMZA 3HMOA 5DGZA 1GAGA 4FG9A 2JIUA 3W2OA 3R7YA 3JR1A 4F0FA 2YCQA 3NUPA 4YPSA 3P9JA 4TNBA 3S0OA 3CS9A 5H8EA 1H28A 4WD5A 5I9UA 2BPMA 3OXIA 3RAKA 3E8CA 3AC3A 4GVAA 3DK3A 4DG3E 1TQMA 4EOSA 5AR5A 1OUKA 2WFYA 3NEWA 2VWZA 2C6OA 4JAJA 4DEBA 5M09A 3WZUA 5FEDA 3CE3A 3D4QA 3TV7A 2OBJA 3OY1A 3QTZA 3KN5A 5EI8A 2C0OA 4QMUA 1LPUA 5B0XA 3HA8A 3TDWA 3FV8A 3MIYA 3R7EA 5KKRB 4GL9A 4AWIA 3QZFA 2FSMX 4OBOA 1YVJA 1P14A 3Q4UA 3UC4A 3A7HA 4EBWA 1WFCA 2WQOA 3MVHA 1BL6A 3P5KA 5CI7A 3W8LA 5AA9A 3G0EA 2O5KA 3MJ2A 2UZEA 4R3RA 2XBJA 4QMMA 4IVDA 4RQKA 3MVMA 2JAVA 2XUUA 1KE7A 3C1XA 2X6DA 4PL4A 4XOYA 3R9OA 3FXZA 3LFQA 4MD9E 4M8TA 4X7QA 4BKJA 4CFVA 4RIYB 2RIOA 3QUEA 1JSTA 4IAIA 4MVFA 4HVIA 1Q97A 4HVGA 1UNHA 4HVDA 2QLQA 2ETMA 3MY5A 2UW9A 5M4IA 2YM8A 3PXRA 4K1BA 4M12A 2PMNX 5KMIA 4DBXA 3PA3A 5AFVA 5TR6A 2X0GA 4DEIA 2YCFA 4X0MA 2BRHA 1JKKA 4BGGA 2WMXA 3I81A 4LOPA 3C0HA 4G6OA 3FI4A 3SHEA 3UGCA 3LM5A 5AM7A 4S34A 3UQFA 2PZPA 2J90A 3PVWA 1H25A 2W4JA 3D7TB 1Q99A 2PUIA 3NGAA 3VF9A 3TUBA 1Q4LA 1NVRA 4TW9A 3OY3A 1KE6A 3WF6A 5J1WA 1O6KA 2G9XA 2YJSA 3EFLA 4BCMA 4FZ7A 4C8BA 4EHVA 2GHMA 4G3CA 2OW3A 1UV5A 3AOXA 2JFLA 4JL9A 3NNUA 5HU9A 2YM3A 1UNGA 4OGRA 4GW8A 5IKWA 3V51A 4D2PA 2IJMA 3P08A 4NW5A 2R3RA 5AR8A 3S00A 4PDOA 2FSLX 2XRWA 3AD4A 2C5VA 3LXPA 5F94A 4XS2A 4PNKA 1XH7A 2XK7A 1WVXA 2Y4PA 2R7IA 4IAYA 3C13A 4CRLA 4RIWB 4U43A 3MH1A 3AMBA 4DLJA 4EOLA 3U8WA 4C62A 2WIHA 4NCTC 4JDKA 3JXWA 3MESA 4F7JA 1A06A 3CPBA 2BROA 3GENA 4PP9A 5EYCA 5C4KA 3KRJA 3U4WA 1OGUA 1SVHA 1WBSA 4FZDB 4ITIA 2QR8A 1GZOA 4BTKA 2H6DA 3NNVA 3FYKX 3OF0A 3B2WA 4QMPA 4F99A 5EHLA 2VWWA 4UMQA 3E63A 5C8KA 3I7BA 4U3YA 4BR3A 2NP8A 3BRBA 2BZHB 4O0WA 5HE3A 5M56A 4YZDA 2RL5A 3DNEA 3GQLA 2XYUA 3OEZA 3Q04A 4MBIA 4PPBA 4O7VA 2GNGA 1CDKA 2VWBA 2GS2A 5H8GA 1KE9A 4TRLA 4PV0A 1FBNA 3PP0A 2YM6A 4S33A 4CZUA 4Z16A 3FMLA 4WRSA 4C59A 1Q8WA 4XOZA 3DGKA 4FG7A 4IC7A 4NK9A 5I3OA 4OTHA 4O84A 3HAVA 4AACA 3OOMA 5E7RA 1DAWA 2XIXA 4CQEA 4RWJA 3IW7A 4GS6A 2R3NA 2XKEA 3I1AA 5EDQA 3NUSA 2W4KA 3MI9A 4KNBA 5DR2A 5AEPA 1ND4A 1RJBA 5CX9A 4CFFA 5LMBA 2XVDA 2Y7JA 4FZFB 5HICA 1H07A 3FE3A 3HV4A 4IB0A 4R3CA 3WZDA 3HAMA 4LV5A 1AGWA 4DEHA 2WTCA 4G6LA 2W5HA 3ZRLA 2BKKA 3GB2A 2Q0NA 3A60A 2JBPA 4J1RA 4XP3A 3BZ3A 4NCTA 2XBAA 4WNMA 4YURA 3GU5A 2YDKA 3COHA 3VS7A 2JFMA 3BV3A 4TTHB 4A9TA 2VO3A 3BHUA 3GI3A 4ANLA 3S1HA 4RJ5A 3M42A 3ZM4A 4FOCA 5HX6A 1YDTE 3ZM9A 3FBVA 3CCNA 4YTCA 4WUAA 1NY3A 3EIDA 1OBGA 1ZXEA 4ZXTA 4E3CA 2CCIA 3ZUVA 4J99A 1REJA 5E1EA 4C02A 3LFNA 1KOAA 2WMVA 4JBVA 4I93A 1PJKA 3W32A 3LVPA 4QNAA 4RZWA 3P7CA 3PYYA 3S2PA 2I40A 1OPKA 2WPAA 5LVPA 1OUYA 3BPRA 4OTPA 4GUBA 5A6NA 4U44A 2PMIA 1WZYA 2B55A 3HV7A 4F9AA 3FMKA 4A9RA 3LM0A 3PY1A 4U3ZA 5C27A 4JG7A 2OF4A 3A7GA 4PL5A 5J9ZA 1QMZA 4DINA 1Z9XA 4AN9A 3EN7A 4FTIA 1PW2A 2GU8A 4FF8A 3IW5A 2BZIB 4JOAA 3I0OA 3ZXTA 2UZNA 3BGZA 4X21A 5F20A 2VNWA 3ID6C 4AGUA 3GT8A 3GP0A 1ZZLA 2QG5A 2WQMA 4JX7A 4QTAA 4YJVA 5CSHA 2P33A 2RF9A 4N57A 3ZO3A 4AZTA 3L9LA 1GZKA 4LRKA 4IDVA 1M52A 4DEGA 3WOWA 2JDRA 3A4PA 3PRFA 2C68A 4EK3A 2FUMA 4IB5A 5BVOA 2UW5A 2O3PA 2OJGA 2P2IA 3Q9YA 2KTYA 3QKKA 4TWCA 3B8QA 5IEXA 4NFNA 2E9UA 4KIPA 5EOLA 3FDNA 5BUEA 3REPA 2BKZA 3D5UA 3RBWA 3UZPA 3WYYA 5LJJA 3IGOA 3QGWA 2P0CA 2PUPA 5A9UA 3N4VA 4FIFA 3PJ1A 1KOBA 3A99A 4MXXA 3H9OA 4BYIA 3R8MA 3O23A 5IUIA 3DA6A 3RPSA 2PMLX 5GJFA 4DFXE 3AMAA 3MW1A 2E2BA 3KXZA 4E73A 3EN4A 1SMHA 4EHZA 3WARA 3SVVA 1YDRE 4HCVA 3FEGA 5EQYA 4EYJA 2NPQA 3ORIA 1OB3A 3OCSA 1UU9A 4OTRA 4EK6A 1MQ4A 3ZO1A 1DI8A 2Z7QA 4F08A 3D15A 3I5NA 3ZH8A 4DT8A 3IW8A 1M17A 5BYZA 4BZOA 3W2QA 1P4FA 3AC8A 5J95A 5AX9A 4E5WA 2C0IA 3A7IA 5HZNA 4AN3A 3R2BA 3RGFA 2X8EA 3R83A 3LJ1A 5IEYA 4UMUA 4HGTA 3ZYAA 3PPJA 2FYSA 4FG8A 4F0GA 3RNIA 5FP6A 4RJ6A 1Q8UA 4Y5QA 3LQ8A 4CZYB 4ZOGA 3G90X 3VBWA 2PZIA 4FL2A 4H3PA 3CTHA 4D1ZA 3NNXA 2R7BA 3VUGA 3VQUA 3ET7A 4DCEA 2OWBA 2X81A 4LGGA 2E9PA 5HG5A 4TNDA 2ZV9A 3PJCA 4P4CA 3RM7A 2QOOA 5ANJA 5HTBA 3D7ZA 2GTMA 3DOGA 3PFQA 4FUYA 4AA0A 2BZJA 3C9WA 4LMNA 4D0WA 4EWHA 1PKGA 5EKNA 3E8EA 4LQMA 3AGMA 2YABA 4U5JA 3UYTA 2J5FA 5DI1A 5AR4A 1FVVA 3NX8A 3ZUTA 4IZ5A 3DBCA 4FKTA 4KABA 2PK9A 5BMMA 4RJ7A 4AT5A 4EKLA 4BHNA 4P90A 5D41A 3O51A 4D4VA 5CTPA 4EZ3A 3ZZWA 3U6IA 3FPMA 4I92A 5EYDA 2HZ4A 2F49A 2XNMA 5CSWA 4ZLZA 4M69A 4X3JA 4MF1A 3A2CA 3HUCA 3L8VA 3E64A 5E8XA 4IWDA 3FI3A 2UZTA 4IAAA 5GHVA 4BIBA 3QZIA 3UO5A 1YHSA 3MFTA 5CEQA 2J50A 3FY0A 4PL3A 2JIIA 3QWKA 5LWMA 4F4PA 3GU6A 3KMWA 4N6YA 3FZSA 1WVYA 5BX0A 5FXRA 3JY9A 3E7VA 4R5YA 4D2TA 2FSTX 3F3WA 3L8SA 3OXZA 4NM7A 3ULZA 1FPUA 4CFMA 3TZ8A 3KXXA 3HVCA 4GK4A 4L00A 2WNTA 2IZUA 2HZ0A 1VZOA 3F2AA 3LIJA 3WYXA 3D5VA 5ETIA 4FTLA 2W1DA 3ZSHA 1H1WA 3LOKA 2OIDA 2BHHA 5EI2A 3ZO2A 5A4QA 4BL1A 5DPVA 1YOMA 4BDAA 3SW4A 2WHBA 4HNFA 4I23A 1QPDA 2XM8A 1JNKA 2QOLA 3RVGA 3NMUF 3PSBA 1B6CB 3AT4A 4UV0A 3Q2JA 2BRGA 4XG6A 4CTBA 4YBKA 1OKVA 5CXHA 5K0XA 3VUMA 5IUGA 5IDNA 3O0GA 4ASEA 4X2JA 5LMKC 2ZOQA 3D83A 3KCKA 3FJQE 4QPAA 3NAXA 4BZDA 2BAQA 5HG8A 1ZARA 5E8WA 3UZTA 3FMEA 3OHTA 2JKMA 2KULA 4OLIA 4U6RA 4B4LA 2GQRA 4FIJA 5FQDC 4JRNA 2QU6A 3KXGA 3DXQA 4IAZA 4EZ5A 3M11A 5L8KA 4QPMA 4DEDA 2WU7A 3PP1A 4BDEA 4QRCA 2R3FA 4TY1A 3HA6A 5IQIA 4AUAA 3EQBA 1MRYA 1OPLA 5LCJA 5FEQA 5HO7A 5HO6A 5A3XA 5IF1A 2PMOX 5IQCA 5E4HA 4KSPA 4Z7HA 2R2PA 3LXKA 4DEAA 1APME 1STCE 3COMA 4GT4A 5HLWA 5EQEA 1XH6A 4A9UA 1H24A 2I7QA 2C3IB 2DWBA 4IEBA 2W1HA 2O64A 4BBMA 2PULA 3KRLA 4DH5A 2B9HA 2ZB0A 4RWIA 4BDCA 2C1BA 4XRJA 2BAJA 3FL4A 4L01A 4XYFA 2XS0A 5M51A 2ITTA 3QRTA 4FYOA 4DITA 3CKWA 2HY0A 4RIXB 5M44A 2JAMA 5HOAA 3T9IA 2ITVA 4IWQA 5FM2A 4Q9SA 5DRDA 3CKXA 4NU1A 3ZCLA 4EOMA 4S31A 2QNJA 4E6DA 1H01A 4FKSA 5KMLA 2BHEA 2IN6A 2RFSA 2P2HA 1R0EA 4QQTA 4O6LA 4UY9A 2PPQA 4RG0A 5CASA 3CQUA 4Y5HA 4GRBA 1VJYA 3Q3BA 4JLCA 5F9EA 4D4SA 1FQ1B 3KULB 3PPZA 5J5SA 4FV3A 3ULIA 3OCGA 3W16A 3VS2A 3R9DA 3QL8A 4I1ZA 3BHHA 4FKQA 4FV6A 3P7BA 1LEWA 3C4ZA 4FKPA 3SLSA 4DTBA 1JPAA 4J8MA 3Q5ZA 3UO6A 4AX8A 3DZOA 1GNGA 2VX3A 4YPDA 5D7VA 1UU8A 5AP2A 1Q41A 3F9NA 4C37A 4L42A 2JBOA 3JPVA 1ZMVA 4W9WA 4F6SA 2GNLA 4KS7A 4FC0A 3G5DA 2J5EA 4DFYA 4XG8A 4O27B 4Q9ZA 4M68A 4E6CA 4X3FC 2WU6A 3R28A 5ACKA 5AMNA 5JRQA 1UVRA 1VYWA 4QQCA 3P79A 1BKXA 3PXQA 3QZGA 4G3EA 4UXLA 5L2QA 3I4BA 4OTGA 4MQ2A 5IH5A 3AXWA 5IUHA 1ZOHA 3DLZA 3ORPA 3F3UA 3TACA 1IASA 3UNZA 4M66A 1BYGA 2XCHA 4CYJA 3L9PA 4DH7A 3RTPA 4FL1A 2OI4X 2JGZA 1PY5A 4MHAA 4E93A 4YO6A 3CJFA 4F64A 4YLKA 4YO4A 2PUNA 4CLJA 1PXOA 4MD7E 4YHTA 2UW3A 4ITHA 5DHJA 2OU7A 1PMNA 4GT3A 4L6QA 1MQBA 2AUHA 2XA4A 3QQGA 5LWNA 3VBVA 3WF9A 1E9HA 3SV0A 4ZTMA 2BTRA 3QLFA 4FV0A 3DKCA 1OL2A 4TPTA 5CAPA 2Y6OA 3TKHA 2G2IA 4BI2A 4I6FA 3MIAA 2PE0A 4BIEA 3IPHA 4IX6A 1OITA 3CSVA 3TNIA 3VO3A 1Y6AA 4XBRA 1UWJA 4FTNA 1ZYLA 5CY3A 4IMYA 4YNEA 5FD2A 4USEA 3DV3A 4QQJA 2HXQA 5AIKA 2YWVA 3DK6A 2IW6A 2V55A 3SX9A 5AUZA 1M7NA 3E93A 1V1KA 3DBQA 5HBJA 3F5PA 4AP7A 4IWOA 4KRCA 2PVHA 4PTEA 3UQGA 1T45A 1H0VA 2ITWA 3UBDA 5FRIA 4OAVB 4LL5A 4QTCA 4X3FA 5AP1A 3DAKA 4A07A 3QD2B 4C3PA 3VBYA 2OSCA 2R3QA 4O21A 4J52A 3H0YA 4BN1A 3E3BX 4R1VA 1OL5A 3OUKA 4NJDA 3H0ZA 4UBAA 3VBTA 5BVWA 3QC4A 1PYEA 1REKA 3I6WA 4FT0A 4JG8A 5HNGA 1L3RE 5HBHA 5AADA 4FT9A 2PZ5A 4M67A 1GIHA 5CI6A 3TI1A 1EH4A 2P3GX 4KIQA 4YJRA 3GEQA 3HNGA 2P55A 3PZHA 3ERKA 4YUQA 4HOKA 4D2WA 2AC3A 4G2FA 2PTKA 3DQXA 3DT1A 3GU4A 2BRNA 5A4CA 3O8TA 5HCZA 1NW1A 4FK6A 4L53A 1ATPE 4G9CA 4ENYA 2X8IA 3LJ2A 3HECA 4MF0A 2ZV7A 4YC8A 3MSSA 4YP8A 3R63A 5ANKA 1XO2B 2QO2A 3EZRA 3SGCA 1QL6A 1FMKA 1PXNA 3G6GA 4EH6A 2G1TA 4BZNA 4DGGA 1ZAOA 3R7IA 5I9XA 3TDVA 4PNIA 3OBJA 3QA0A 4ALWA 4PTCA 4JIKA 3BEGA 2OZOA 3FAAA 4NTTA 2YISA 2YM7A 4TYIA 3UG1A 3FC1X 1VR2A 3MA6A 4EK5A 2HK5A 3JVRA 4ZTQA 4BF2A 2HWPA 3AD6A 3FMDA 3Q9ZA 3BYUA 2X7FA 4GUEA 2JIVA 4UALA 5FXQA 5T3QA 4BWKA 4CYIA 4QP8A 3UVPA 2PVJA 2OXDA 4XEYA 4CKIA 4W9XA 4BDKA 4II5A 1R1WA 4FKIA 4L67A 2OFUA 4KBKA 4M84A 1JOWB 2ACXA 3UOLA 4PY1A 5B2KA 2CKEA 2XJ0A 2C6DA 4QYYA 3G0FA 4AFEA 4D55A 2IVVA 2XP2A 3P86A 3R1QA 4HGLA 5GJDA 1JWHA 4M14A 3EL8A 4OT6A 5EHOA 4KIKB 4N6ZA 1KUTA 3NW7A 2QLUA 5L4QA 2VWVA 5KX8A 3DCVA 4IZ7A 5AP6A 2WQNA 2I0HA 3W2PA 5F4NA 2DYLA 4UX9A 4NKSA 3D0EA 4FZ6A 5IH6A 3ZU7A 4CFXA 3WBLA 3QCYA 4FX3A 4B9DA 2X39A 4NYEA 5DA3A 4DFLA 4HW7A 3FMNA 3F3TA 5IMEA 3WILA 4LGHA 1GIJA 4CNHA 2OJ9A 5AP3A 1O6LA 2EVAA 4PPAA 4EQCA 4FV2A 3DK7A 5IQBA 1BI8A 5E8UA 3RM6A 5A6OA 2FH9A 4WG3A 3NYVA 3OTVA 4XH6A 5BVEA 3DXPA 3V5LA 3N4UA 2WTWA 4TWNA 2UW4A 3V8WA 5FTOA 1H0WA 3BKBA 3LZBA 4YJUA 3ZDIA 2ERZE 3NLBA 3TG1A 3K5VA 4DT9A 3D5XA 3ODZX 3ACJA 4IX3A 3R9NA 2A4LA 2OFVA 2W1FA 1Y8YA 2ZM1A 4MNEB 3UP7A 4DN5A 3EQFA 4GFOA 4NIFB 5IA0A 3VS5A 2Y4IB 1XH9A 3OWPA 5HBEA 4CVAA 1SM2A 2WD1A 2JKOA 5GZ9A 4C58A 2F7EE 2HWOA 3F2RA 3H4JA 4JDHA 3QTRA 4RIWA 3NRMA 4I5CA 3HRFA 4U79A 3ZRKA 3OBGA 2UVYA 4JX3A 5HGIA 4MX9A 4RGJA 2EB3A 3DPKA 5FGKA 3RMFA 2CMWA 2WMBA 2VO6A 3FLNC 2J0LA 3VN9A 4ZLYA 5KHWA 3F88A 4F6WA 3CY3A 4HPUE 3PE1A 3ZONA 4X6QC 5HIEA 1S9IA 4AE9A 4G5JA 4DCAA 1XBCA 4G31A 4IW0A 5CLPA 1OECA 1UU7A 3T8OA 4N4SA 5ETAA 2O0UA 4GFMA 4ZLOA 3P0MA 5TKDA 3MFUA 4NKAA 3HMMA 2R0IA 2WTKB 3NCZA 5KBQA 1PHKA 5L6OA 4ZY5A 1MRUA 2QQ7A 3UIXA 5CQWA 4AZVA 2E9NA 3CR0A 3EFWA 3IOKA 2OXXA 3RK7A 2VTQA 4EYMA 2ITNA 4QMYA 3ODYX 3IO7A 5AM6A 3MTLA 3CEKA 3NYXA 3NYNA 5J7HA 2WTIA 3ZHPC 4MXYA 1P2AA 3A7JA 3FL5A 3SC1A 5IISA 3BLRA 5HD4A 3IKAA 4E20A 4V0GB 4UXQA 4O7TA 2J7TA 4YLJA 2PZYA 5L2SA 3T3VA 4EK4A 4ACCA 4M0YA 4W4WA 3E5AA 5HI2A 4KUJA 4AGCA 1H1RA 1NA7A 3BE2A 3VW8A 1YI3A 1P5EA 3IG7A 1JSVA 1Y8GA 2ZMDA 3C0GA 5GIOE 4ZSLA 1UA2A 4CFUA 3AQVA 3A62A 1RDQE 3VJNA 4N70A 2PVYA 4CZTA 1MP8A 4I0TA 4O1OA 2W5BA 3V6SA 3FLYA 4TKSA 3RWQA 2PUUA 3ZFYA 5HE2A 3U6HA 2O2UA 4ZS4A 5FG8A 3TJCA 4FT5A 4FK3A 5JFXA 2VTPA 2ZDTA 3JYAA 3S95A 2NO3A 5BUIA 5TF9A 4ORKA 1KWPA 1W83A 5HLPA 3SDJA 3PVUA 4D5KA 3UODA 5LVNA 3QF9A 2YDJA 2FA2A 2WAJA 2YM4A 3DKFA 2UW7A 4F09A 3ANRA 1JVPP 4K0YA 4PDSA 1Q8YA 4K11A 3VC4A 2R3MA 1U54A 4O6EA 3VWAA 4PQNA 3VIDA 2JD5A 3SRVA 2UZDA 5L3AA 4QTEA 2BMCA 3E62A 3C4XA 1G8SA 3HP5A 4O91A 3F66A 2VZ6A 2Z7RA 4Y72A 2GHGA 5H8BA 4TWOA 2IW8A 3FQEA 3MN3A 2YDIA 2X2MA 3C50A 2Z02A 3BELA 5I9ZA 2VX1A 2ITOA 5J7BA 2GNHA 3OWJA 5DBXA 2ZV8A 2OLCA 2XRUA 2V5QA 5TOZA 5JRSA 2CN5A 3VBQA 2RG6A 3P78A 4L3PA 5HCYA 4TYHB 3AMYA 5KHXA 3RPVA 3P23A 4C33A 3IDBA 4MXZA 3VHKA 1W82A 3BX5A 5DT0A 3ZXZA 1HCKA 3OROA 4HVSA 4RX5A 5CANA 3TZ9A 4ZJVA 4FSQA 1PXLA 4UZDA 4EOJA 3EKNA 4O7YA 3MDYA 3IDCA 5EK7A 2PVLA 3NDMA 1IA9A 3WIGA 4FSTA 4LUDA 1JBPE 3DBFA 3PXZA 4GK3A 4TZRA 1BMKA 5AUYA 3OCTA 3RK9A 4ZSAA 2GFSA 4YJOA 3CBLA 4DTKA 4CKRA 3B8RA 5LQFA 4ACHA 4DH1A 4NH1A 4J98A 4C36A 4WIHA 2JITA 2B7AA 4CTCA 2VAGA 4USFA 4F1TA 4GEOA 4IADA 3PXFA 3ZMMA 5BUJA 1ZOEA 3E7OA 4QO9A 3V5QA 4QMWA 4JNWA 3MPAA 2XF0A 3ZTXA 3JS2A 4LOQA 2AYPA 3UNJA 2ITPA 4L52A 3ORTA 3AG9A 4QP4A 3ANQA 3MFSA 4A9SA 1OBDA 4BIDA 2GDOA 4J71A 3CP9A 4XCUA 4A4LA 4EL9A 5AR3A 2XIRA 2CGWA 5BVKA 1J7LA 5CENA 3PE2A 3FKNA 1J1CA 4FV9A 3AD5A 4IM3A 5CT0A 4MXOA 1YHVA 1FVTA 2V7OA 3ZUUA 3U9CA 2ZAZA 3RWPA 2F4JA 2W06A 2PU8A 1SZMA 3GC0A 3NPCA 5CAUA 1JAMA 3QQFA 5CS6A 5AUTA 4RVMA 3H10A 1JKLA 4XP0A 4DLIA 4ZS0A 4FGRA 2VN9A 3Q32A 2X9FA 4FSRA 5J79A 5JZJA 4B0GA 3FWQA 5D1JA 2XKDA 3BYMA 3PA5A 4I5MA 3RAIA 3I0QA 3O8UA 4LFIA 2RG5A 1Y6BA 2WMRA 3WE8A 4EHEA 5AV1A 2PVKA 3G51A 3DDQA 3M2WA 5DN3A 4RBLA 2B54A 1E1XA 2QI8A 1OL7A 4FYNA 3UMXA 3ZFXA 4A9YA 2XEYA 3LW0A 3FC2A 4APPA 1ZWSA 2R3OA 2VUWA 3TKUA 4E6AA 4I94A 4K33A 2O8YA 3KN6A 5KMNA 3SXSA 3UTOA 4F65A 2BTSA 4AE6A 4OW8A 4FSWA 2X2LA 1M2QA 3I7CA 2H9VA 3BEAA 3DFAA 3UPXA 4AS0A 5EDPA 5AV2A 3SD0A 5AWMA 2YZLA 1TKIA 4IXPA 3QGYA 4I20A 4FSUA 4S30A 4OAUC 3EFKA 3Q9WA 5CSVA 3U51A 5CZIA 5F95A 4CFNA 2UZLA 4E4MA 4F7NA 5FUTA 3GFWA 2F7ZE 5C4LA 2Z60A 5DT3A 4DH3A 2Z7LA 4FIIA 3G9NA 3NUNA 4GG5A 5DIAA 5HEZA 4QYEA 1NT2A 2V7AA 3NAYA 3TXOA 3TIYA 1Y57A 4FL3A 4PF4A 5B2MA 4BHZA 3CC6A 4RJ3A 4IX4A 3FLZA 5IPJA 3KK8A 4BDGA 4P5ZA 2LAVA 4BI0A 3ATTA 4RWKA 4E1ZA 5TE0A 3QALE 3CTQA 3NUAA 3CQEA 3Q2MA 4F6UA 4CXAA 2J6MA 4LG4A 5D9HA 4C35A 1U4DA 2WTJA 4RJ8A 4YNOA 4C4GA 3OEFX 4I21A 5HHWA 5KUPA 4FTTA 2UUEA 4IQ6A 4DBNA 4IM0A 4UWBA 4FKGA 3HEGA 4JG6A 4ANSA 3PJ8A 2JKKA 2GMXA 3PPKA 1OL6A 4RWLA 4L45A 3FKOA 3NUXA 2CGVA 4H39A 3ZFMA 2UZBA 4M0ZA 3U54A 5GZAA 3EHAA 4G5PA 4F9BA 4DH8A 4ANQA 3R1SA 2EWAA 4L44A 3KQ7A 2VV9A 3KRWA 3FI2A 3H3CA 3WF7A 2Z7SA 4MWIA 3MJ1A 1OL1A 4UZHA 4JIAA 4ACMA 4HZRA 2WMUA 4S2ZA 4HYIA 1LR4A 3LLAA 4JS8A 4L68A 3F6XA 4FMQA 5FLFA 1HCLA 5J9YA 5CU4A 4WNOA 4YJNA 4FTJA 2GS7A 3MA3A 4BCGA 3FQSA 1WBWA 4KINA 4QP9A 1UKHA 3TNQB 3N51A 2CGUA 3UG2A 5BMSA 3A7FA 3BU5A 5G6VA 5IMXA 3LMGA 3L9MA 2IG7A 3HLLA 4FI1A 5IH4A 3CTJA 4WO5A 2R3GA 5CU6A 2IVUA 4BGHA 2F57A 3EQIA 3ATSA 3NW6A 5EM6A 3S4QA 2HXLA 3QUDA 5E1SA 5BPYA 3LFBA 4NW6A 2BR1A 3GC9A 3LFCA 4O38A 4FUXA 3ZZEA 2HOGA 4HGEA 4IDTA 3L8XA 4L7FA 4RC2A 5M57A 3HV6A 1XH4A 3GXLA 4G3DA 3N9XA 4KAOA 3FUPA 3FPQA 3R8PA 3RAHA 4UN0C 3QX2A 1J7IA 4GSBA 2JDTA 3T9TA 4CFWA 2ITZA 5CU0A 2ZJWA 5LMAA 1ZY5A 1YOJA 1SNUA 4QOXA 2C4GA 3OOGA 5D11A 4QP1A 3C0IA 1FVRA 3E92A 4YTIA 1XHAA 1JKTA 5ANIA 4K6ZA 3R8LA 2QC6A 4ZTLA 2ITYA 2GQGA 2FVDA 3D94A 2WEVA 3FYJX 3BYSA 4W4VA 3DAJA 4FKJA 4WHZA 5L2WA 3R22A 4ZIMA 2XYNA 2ZV2A 5FDXA 1WBTA 3NNWA 4YZNA 4QMVA 5K9IA 3K3JA 3RZFA 2ZM3A 4GJ2A 4BCIA 4UB7A 4H1MA 4XV1A 5L6PA 5JSMA 4XBUA 5AAFA 3UVQA 4DGNA 2QVSE 3FZ1A 3ORLA 4NJ3A 4BWPA 5KMKA 2OJFE 3AC1A 1WBNA 3WIKA 4FTRA 4X2NA 2W99B 5E8TA 2UV2A 3NSZA 4M3QA 2UW6A 2NNWB 2QHMA 4C3RA 2DQ7X 1PMEA 2R9SA 3Q9XA 4LM5A 1WBVA 1FGIA 2QOHA 3EQRA 4QP6A 5AV0A 3U4UA 5L2IA 3O50A 4LV8A 3K3IA 1Q8TA 3NYOA 5D7AA 2IW9A 2YEXA 3CD8A 1XH5A 4IACA 3VS1A 5DYJA 2ERKA 5HD7A 5A54A 1NVQA 4FR4A 4H58A 4D58A 4FV4A 5E92A 4NM0A 2VTTA 3V5PA 4JDJA 2YM5A 4GYIA 4LRJA 3C7QA 3S3IA 2IVSA 4KA3A 3O2MA 4IWPA 3ZOSA 2WXVA 1R78A 2XNNA 4F1MA 4YSJA 3QCXA 2YZAA 3HDMA 2IPXA 4MWHA 4NSTA 4AGWA 3F5XA 3OUNB 3DZQA 4JVGA 4RC3A 4RLKA 5FXSA 4EUUA 4UMRA 4QMQA 5EQPA 3QXOA 4L7SA 4UWYA 3C4EA 1V0PA 2F9GA 2WTVA 1W84A 4RLLA 3AT3A 4KB8A 2QKWB 4MD8E 3R30A 4LOOA 3LCKA 3D2IA 3DB8A 4OTWA 3BLHA 5A46A 2Y0AA 2LGCA 3BLQA 3QQUA 2CGXA 4J53A 1R39A 4I4FA 3AC4A 3C4WA 3HGKA 3SOCA 2C30A 3ORZA 4XG3A 2CCHA 2O65A 1B39A 1CMKE 1GZNA 4O0XA 4IAKA 4XV9A 3NVKI 4EH7A 4Q2AA 2OZAA 2Y6MA 1Q8ZA 1Q3DA 3BHYA 5EM8A 4FSMA 2W7XA 4ALUA 3KMUA 4B99A 1WAKA 4IB3A 5BVFA 3G2FA 1F0QA 3M1SA 4BBEA 1PF8A 4W8EA 4IAFA 4O0YA 4ZZMA 5AV4A 2VGPA 5HKMA 1P4OA 1QPEA 4B7TA 1OM1A 3ZBXA 5KZIA 2WMQA 2GPHA 4J95A 2I0EA 2WELA 2YAAA 4I6HA 4LUEA 3QC9A 3MFRA 3OP5A 4GIIA 4HVHA 1CKJA 1YDSE 3EFJA 4FIEA 3AC5A 4GK2A 2A0CX 4U42A 3QXPA 1XKKA 4MBLA 5AP5A 3UOHA 2QHNA 3Q96A 4PDPA 4RA5A 1Q62A 1XQZA 4JRVA 4FKRA 4ZY6A 5L6WL 4QD6A 4R5SA 4XMOA 1UKIA 5J87A 1W8CA 4L3JA 1ZYDA 2QKRA 1JQHA 2VTHA 4UYAA 3FHRA 2GHLA 3ORKA 4DFNA 3VS0A 4YZMA 2BVAA 2J0IA 2W0JA 2XK6A 5ANEA 4ZSGA 3LMIA 4IVBA 3I6UA 4D9UA 2NRUA 2OICA 3NIEA 3SG9A 3HMIA 3NVMB 2WOUA 4EC9A 3N4TA 4IHPA 4G34A 4W8DA 1UNLA 3D5WA 2JDVA 1OIUA 2O63A 2CHLA 5AP7A 4C4JA 3RAWA 3HRBA 4IZAA 4NZWB 4YZ9A 5CXZA 5CEKA 3BYVA 4XNEA 5CT7A 4WBBB 3LCOA 4WSYA 4EOPA 2YN8A 3R21A 1XR1A 3BIZA 1XJDA 1KE5A 1OI9A 4QMZA 1BL7A 1KV2A 4PTGA 4KD1A 5AP0A 4FA2A 5HU3A 4M69B 5E8ZA 4JBOA 1KSWA 5CVHA 4XRLA 2V62A 5HVYA 2CKQA 1TQPA 4G3GA 4EC8A 3R01A 4G1WA 5I5ZA 1I09A 4RVKA 4H05A 2X4ZA 1U5QA 1KV1A 1TVOA 4XJ0A 4BCOA 3RHKA 1JLUE 4DC2A 5ANDA 4O7ZA 4KIKA 3R04A 4O0UA 4RQVA 1U59A 4QT1A 2EXCX 4QNYA 2DS1A 3RJCA 5HESA 4HNIA 2B9FA 3AT2A 4QYFA 2CSNA 2OIBA 4UMTA 2X1NA 5JKGA 4Y95A 2FSOX 3ACKA 3FHIA 4YMJA 4R7BA 3MYGA 5TO8A 4FGBA 4RFYA 4F7LA 4KIOA 2W05A 2X9EA 4ACDA 2H96A 1H4LA 4I5HA 4IB1A 5AA8A 3SG8A 4CRSA 4ZMFA 2PWLA 2PVNA 2PSQA 3QUPA 3WF5A 1IAJA 2YFXA 3HMPA 4TXCA 4USDA 1OIRA 4W4YA 1QPJA 2R3JA 5AX3A 1Z5MA 2XCKA 4XG7A 2ZYBA 2YACA 3RHXA 3EYHA 3QYZA 3PXYA 3FZOA 3RZBA 4DAWA 1WCCA 4EKKA 5I9WA 3EB0A 4FEWA 4ANBA 3JVSA 3BYOA 5A4TA 2BIYA 2H34A 2X8DA 3RI1A 4O7NA 4F9CA 5KKRC 4I22A 2QOIA 4IC8A 3QHWA 4FNXA 1Q61A 4C57A 5JH6A 2XIZA 3KK9A 3SQQA 1CKPA 4UEUA 2Q0BA 5K0KA 2VWXA 4YJTA 3NUUA 4DGOA 1R3CA 3CQWA 4GT5A 3PUPA 2EXEA 5JMSA 2RKUA 2VTMA 5DNRA 3MVJA 4OBQA 5HE1A 3W1FA 5IQAA 5M53A 4HPTE 3QAME 4KRDA 4P2KA 4P5QA 2I0VA 2XZSA 4FTCA 3DJ5A 2OGVA 3WE4A 5GINE 4EBVA 2ONLA 2AC5A 4XV2A 2YITA 3VUTA 3BHVA 3CY2A 3GCPA 3VW6A 4APCA 4E4NA 1OMWA 2VGOA 3RKBA 5J8IA 3UE4A 4PWNA 4A4OA 1YXVA 3ALNA 3QQKA 2WMSA 2XNOA 3RCJA 3TWJA 4DFZE 3LHJA 4YTHA 3ZLWA 3OD6X 3GCQA 3W2SA 4ASZA 4JQ8A 5CNNA 2ZM4A 4AXAA 5T68A 3UC3A 3DDPA 2VWIA 2PYWA 4LI5A 5JGBA 4EORA 4L3LA 4C61A 3KF7A 2GTNA 4EH9A 4NL0A 4JQEA 4FTAA 4AW2A 2W1CA 1PXPA 3UDBA 2WIPA 4GV1A 5ICPA 5BYLA 4D5HA 5CYIA 5H2UA 2BRBA 3ENMA 5EOBA 5BVDA 3F5GA 1J3HA 1MRVA 1IA8A 1RW8A 4AOIA 4DFUA 1FOTA 1NXKA 4G6NA 2EB2A 4FTQA 3EH9A 2R5TA 3MTFA 4FSNA 4AA4A 3P4KA 3AGLA 4DEEA 4BGQA 5KMOA 3ETAA 3QTQA 3VS3A 5CALA 5EYKA 5M07A 3ORNA 5HG7A 3KU2A 3KCFA 4GU9A 5EW8A 2VTRA 4AAAA 3PTGA 3VAPA 4FBXA 4IZYA 4FVQA 4ZTSA 2BALA 3V5TA 4X2KA 3SXRA 4E8AA 4H3QA 2XB7A 5AIRA 3O96A 3IECA 3QD3A 1SNXA 4Y73A 4RIYA 4M7IA 3QU0A 4ZSJA 2ETKA 4WNKA 2VTOA 4FV5A 4D4YA 2YIYA 3FLQA 2OH4A 3H9FA 2C47A 3UVRA 4C38A 3LFEA 3QRUA 4BVUA 4UWCA 3FQHA 4RPVA 4FEQA 4WG4A 4O1PA 4HZSA 4MH7A 3R9HA 3RPYA 4F7SA 4O81A 3CLYA 2C69A 3RPOA 4JBPA 4YGAA 1YRPA 5JFWA 1PMVA 2OF2A 3WZJA 3DKGA 4OTQA 4DA5A 2WQEA 5A4EA 5HO8A 5LVOA 3LCSA 2BDWA 4HCTA 2VWUA 4O83A 3Q5IA 3D7TA 3UJGA 4ZZOA 2VTNA 5GJGA 3LQ5A 2X7GA 4C7TA 3GOKA 3EQDA 4KBCA 5IA5A 3MS9A 3DU8A 3Q53A 5KBRA 2C6MA 3HP2A 3QCQA 3LMHA 5FWKK 5ETFA 1K3AA 4ZJIA 4ERWA 3DJ7A 3I79A 3PVBA 4OR5A 3W18A 3P1AA 4GU6A 4BDIA 4E4LA 3OXTA 4Z9LA 4AQCA 5IQGA 2A2AA 2HELA 3B2TA 4OT5A 3AC2A 5K5XA 3E8NA 4QP2A 5KCVA 4EI4A 5C8MA 3MGYA 2XK3A 4QMLA 4GIHA 5KO1A 4U81A 1XBAA 3F2NA 3QX4A 3Q4ZA 3C5UA 2YHVA 2BDFA 3R71A 4JBQA 4QQ5A 3BWFA 4ERKA 5EYMA 1GZ8A 2PE1A 3F5UA 4WT6A 3GCSA 5IU2A 5CQUA 3CD3A 2HAKA 1BX6A 3QHRA 4IBMA 4TYHA 3BWJA 4BCFA 4YJQA 3ZLYA 4X3FB 2X2KA 3KY2A 5LVLA 5J9LA 2HENA 5EM5A 4MYGA 1PXJA 2Z2WA 4CV8A 4H36A 3ENHA 5D10A 4MCVA 5E8VA 3VJOA 5B2LA 1J1BA 1ZY4A 2XNEA 3G33A 2VTJA 4G9RA 2OXYA 4XG4A 4C4EA 2C1AA 4RFZA 3TTJA 5FTGA 1OKYA 2ZMCA 4BDDA 5T6KA 4EZ7A 3KA0A 4X6RA 2B0QA 4ANMA 4D9TA 2BIKB 4WRGA 4AG8A 2VX0A 4ZY4A 2HZNA 4AU8A 2SRCA 2REIA 4MK0A 5EHYA 4R78A 4FIGA 3EJ1A 4R8QA 3SW7A 4R7HA 2G2HA 5DOSA 5ACBC 1WVWA 4EHGA 4RVLA 2IZRA 3F61A 5J5TA 1XH8A 3UPZA 5LVMA 5IQEA 1ZMUA 2ETRA 4IANA 4M97A 3DB6A 4YZCA 5DEWA 5CF8A 4ID7A 3R1YA 4EOKA 1YI4A 2V0DA 4QMNA 2RFNA 2WO6A 3D14A 2C6EA 3VRYA 3KL8A 2Y9QA 1CTPE 4K8AA 1H26A 5HTCA 3T3UA 3F7ZA 4HGSA 1YQJA 2G2FA 3O7LD 5E9EA 4X2GA 2RFDA 3GCUA 2UVZA 4WOVA 5CWZA 2F2UA 5EKOA 4NT4A 1FINA 3UQCA 3TCPA 2CNVA 4YC3A 3WZKA 3DQWA 4HJOA 3F3VA 1H1SA 2BZKB 1F3MC 3TV6A 5HIBA 1XWSA 4EOQA 4O2PA 3ZS5A 4AW5A 3G15A 4BTJA 3QQLA 3VBXA 4K77A
chains in the Genus database with same CATH superfamily
5CF5A 4H3BA 3U9NA 2CNQA 1J91A 2J4ZA 3E8DA 4IH8A 4XG9A 3QTUA 4IX5A 4BBFA 5D12A 2PVRA 3TZ7A 4O7LA 4WG5A 3POOA 1OKZA 4FICA 4RX7A 4CMTA 4R77A 3CGOA 2JC6A 3LFFA 3KXNA 3KMMA 4GVJA 5EDRA 3UP2A 2WMAA 3W33A 2VTLA 4FTMA 4WSQA 5HLNA 1WBOA 3MY1A 2QONA 1YWNA 3BGQA 3ELJA 5DT4A 3VS4A 5EH0A 5LCKA 3PWYA 4FT3A 4FRFA 5FP5A 3ZBFA 3V8TA 3D9VA 5AR7A 1GIIA 3RCDA 5HTIA 4J96A 3GU7A 5AAGA 4C2WA 4UMPA 4F9WA 3TEIA 4D2VA 5EI6A 1WMKA 5HNBA 2WQBA 1UWHA 2CN8A 3ZEWA 4QTBA 3ZLXA 3ZSIA 5IQFA 3PZEA 1H1QA 3V5WA 4M15A 4B8MA 5I3RA 3BBWA 3DTCA 1PYXA 1GOLA 2W5AA 3LFAA 2YIRA 3PIZA 3QLGA 1PXMA 5GZ8A 1UU3A 1YXXA 4FE2A 4GKHA 3QRIA 3R6XA 4C0TA 5JFSA 3FMJA 3PY0A 3U6JA 1GY3A 2B53A 4YZBA 4DG2E 5M4CA 2W9FB 4K2RA 4MQ1A 2I1MA 3NZ0A 2UW0A 4EH3A 2YCSA 1DI9A 3I5ZA 3R00A 3TV4A 5M4UA 2GS6A 3HMNA 4OTDA 2IZSA 4TWPA 5ANGA 4EQMA 3PJ3A 3DS6A 4XX9A 4I5PA 5CEMA 4FEVA 5L2TA 4WBOA 2CPKE 1FMOE 1T46A 4G17A 4I41A 3OT8A 4QP3A 4RT7A 4CGAA 2XK4A 3WF8A 1X8BA 3BCEA 3ZSGA 2XKFA 4Y8DA 3QKLA 5DWRA 1CM8A 3RALA 1YW2A 2UVXA 3DLSA 5JN2A 3KVWA 1OPJA 2C3LA 4U45A 2EXMA 2BILB 5ANOA 4AZSA 4FZAB 4ONAA 3KFAA 4P7EA 4D0XA 4HCUA 4L43A 3HZTA 5CVFA 1YWRA 2PY3A 3F3ZA 4QMXA 4CSVA 4ZEGA 2IZTA 1W98A 4RIOA 4CEGA 3FMHA 3OMVA 2XJ1A 4FJVA 4LYNA 2E9OA 5CU3A 5C26A 2GNFA 3NR9A 3PG3A 2C5NA 3K2LA 5M08A 3H30A 3MB7A 1QPCA 4FNZA 4QPSA 1URCA 3KIOC 4FODA 3ZO4A 4H1JA 3ZEPA 5CAOA 4BC6A 4AXEA 4D2SA 2GQSA 2XAOA 1LUFA 1VEBA 3OCBA 4AT4A 5AP4A 3ML1A 3F69A 4TL0A 2YIWA 3LCDA 4YTFA 2C6IA 2BFYA 4O22A 2R3HA 3OT3A 1OKWA 3UIUA 3FMMA 3QQJA 4I24A 4EWQA 1IRKA 3DBEA 2QO9A 3EN6A 3I60A 3W10A 4BICA 4EEVA 3MH3A 2EUFB 2CDZA 4G16A 2UW8A 4N0SA 3TTIA 4RJ4A 2B4SB 2V22A 2IWIA 4RVTA 2QURA 2VTIA 1OVEA 4XLIA 3RP9A 2YIQA 5CEPA 3IW4A 1I44A 4BCKA 4CQGA 5CSPA 3O8PA 3MH0A 4FIHA 3QRJA 3O17A 3BGPA 3Q4TA 4PRJA 5KZ0A 2RGPA 3PRIA 4V01A 2OIQA 2GFCA 4AW0A 2UZOA 5ETCA 1V0OA 3PVGA 4YU2A 4I0RA 3L9NA 2B1PA 2W17A 4U8ZA 5LOHA 3C5IA 2HYYA 5JZNA 3UIMA 4EH2A 3RNYA 4IVCA 5AV3A 2J2IB 3EYGA 4IJPA 3U87A 5IZFA 4L8MA 3THBA 4I6BA 2OG8A 2XKCA 5EG3A 2RFEA 3K54A 4DFBA 3PA4A 3V5JA 2XIKA 3LFSA 3ZLSA 3UNKA 5FDPA 5BNJA 5I0BA 2A1AB 4O0RA 4BFMA 5CEIA 4IM2A 2OO8X 1U54B 2VRXA 4C34A 5L8LA 2GNJA 3OC1A 4MTAA 3CGFA 4B6LA 4EH5A 5BVNA 1S9JA 5I9VA 5JGDA 3SRVB 1SVGA 3FSKA 5JK3A 2H8HA 2ZVAA 3PY3A 2WB8A 3UO4A 4AGDA 4XLVA 3AKKA 1R0PA 2QD9A 3RPRA 4BRXA 3GFEA 5JGAA 4BCPA 2WEIA 4ZMEA 3LLTA 3TKIA 5DFPA 4JR3A 3RK5A 5JQ5A 4EOIA 3PFYA 4MBJA 4U40A 4DTAA 3GC8A 4K18A 2QR7A 3W8QA 4BDFA 4CG9A 2UZWE 2Y8OA 4EOOA 4RZVA 4O7RA 4DF3A 4E6QA 3DXNA 4ARKA 1TQIA 5CAVA 3ORXA 3PJ2A 5JFVA 4PMPA 3VF8A 3TT0A 4O0VA 4TYJA 4R7IA 1H08A 1PXIA 1W2CA 3EQHA 4FV1A 1ZYCA 1H00A 3FXWA 2ITUA 1A9UA 1QCFA 2PL0A 3DKOA 4PDYA 2W4OA 4MXAA 3MPMA 5KNJA 3R8VA 4Y85A 3Q4CA 1LEZA 4AA5A 4RFMA 5C01A 3RINA 3KEXA 4U0IA 4U80A 2OK1A 2I6LA 3MPTA 4FKWA 4KKHA 4ZP5A 2OKRA 4F9YA 4WUNA 5DG5A 4IJ9A 1BI7A 2RSVA 3KREA 3LCTA 4ZAUA 2JKQA 2YWPA 1IR3A 3MY0A 2JDOA 4PMTA 4F0IA 4FTUA 3UYSA 3TYKA 2JLDA 3V3VA 4J97A 4U9AA 3IQ7A 3UDSA 1PMUA 2R64A 4YBJA 1VLRA 3QTXA 4BCHA 5FTQA 4F1OA 2GNIA 4UYNA 3EZVA 1E1VA 3FY2A 3PG1A 1AQ1A 2XK8A 2C6LA 3QRKA 2UZVA 4I3ZA 4J8NA 4R3PA 2DUVA 2VO0A 3COKA 3W2CA 3KRRA 3DAEA 4RIXA 2HZIA 4RMZA 5IDPA 3IS5A 5CF6A 1K2PA 3BU3A 3HL7A 2I0YA 3KB7A 3TJDA 3QTWA 3HRCA 2J0JA 1V0BA 1K9AA 1W0XC 3A8XA 4JDIA 5B7VA 2B9IA 3PLSA 5K5NA 4ASDA 4FSYA 4O96A 1NVSA 2R3KA 3U55A 2CJMA 4EONA 2CKPA 3TN8A 3BE9A 4FTOA 3KULA 3KRXA 4JAIA 3OZ6A 3EN9A 3GQIA 3DFCB 4FV8A 4EK8A 4FEXA 4BKZA 3PSCA 2W1EA 4O82A 3F7WA 5G1XA 4MAOA 4YLLA 5FBNC 4CMUA 3PWDA 4ZTRA 4E5AX 2HW7A 3OW3A 3KF4A 5H3QA 4O0SA 3LPBA 4IFCA 3FZRA 5AUWA 5HG9A 1OIYA 1ST4A 2IO6A 4E7WA 2G15A 4GKIA 2QOCA 1LP4A 5K3YA 4LRMA 4PP7A 2WMWA 4ASXA 4E5BA 4AAYA 2QG7A 3QD0A 4EJ7A 4ACGA 3BU6A 3IONA 3BQCA 4TT7A 4YC6A 5L2QA 4BCNA 3A4OX 3POZA 1CSNA 2QU5A 3NCGA 3ITZA 4NTSA 5IA4A 3UIBA 2BFXA 3DBDA 4BB4A 5C1QB 2E9VA 4RX9A 4BCQA 2XEZA 1G5SA 2QOBA 3OW4A 4O86A 5CF4A 5E91A 4GFGA 4PMSA 3V8SA 3ZC6A 4DGMA 4NFMA 3HV3A 4U97A 4CCBA 3SA0A 2JEDA 4QTDA 3II5A 2C6KA 3KXHA 2A19B 3QCSA 5IQDA 2J51A 4HYUA 2YA9A 3HDNA 3OG7A 3QTSA 1G3NA 2IVTA 1ZZ2A 1ZOGA 4O7WA 3PDTA 1H8FA 2PHKA 5DEYA 3GVUA 2OH0E 2F7XE 2X6EA 2W1GA 2J0KA 4NWMA 3EMGA 3D2KA 4FKUA 4Y46A 1CKIA 1Q24A 3EWHA 1PRYA 4JR7A 3OS3A 5IQHA 3OTUA 5HVKA 3V6RA 1O6YA 2P4IA 4U7ZA 2BAKA 1HOWA 1H27A 3FZPA 4M13A 3ZRMA 4AZWA 5A14A 2XK9A 4BI1A 2C6TA 3LFDA 3COIA 2XH5A 1B38A 3TNWA 5IA3A 2WKMA 3QFVA 4FKVA 4YSMA 4KS8A 3EN5A 2BCJA 5IEVA 4FEUA 4XP2A 4I6QA 3E87A 3VRZA 5IA2A 1DM2A 5EW9A 1YHWA 2VTAA 4MNFA 3GU8A 3QQHA 4KSQA 4QYGA 2C3JA 4E4XA 4DE4A 3O7LB 3MV5A 2CNUA 4K9YA 5EM7A 4KBAA 4ZZNA 2W9ZB 4RSSA 2C0TA 4LGDA 1YXSA 2ZDUA 4ITJA 4FNWA 5JT2A 3GGFA 3QA8A 1OZ1A 3TZMA 4IIRA 5BYYA 2WGJA 3V01A 4XV3A 3MVLA 1IEPA 2W96B 4EH4A 4BTFA 4DG0E 3VS6A 4ANNA 3VUDA 5BQ0A 3L8PA 3PSDA 2WOTA 3FKLA 3R7OA 4C4FA 2G01A 4QP7A 2J9MA 2W1IA 4CLIA 2R3LA 3DTWA 1IAHA 3OWKA 1M14A 4GJ3A 5HCXA 3VUHA 3A8WA 4Z3VA 5KMJA 2Z8CA 5CSXA 4CT1A 2WZJA 2B9JA 3CJGA 4O4CA 4DHFA 1M2RA 1BUHA 4O0TA 4ENXA 5ITAA 2YERA 3LAUA 5AR2A 5H9BA 4A06A 2QOFA 2XMYA 3EL7A 3LE6A 4AOTA 2YCRA 4AT3A 3IDPA 3FSFA 3LQ3A 1M2PA 5HVJA 4D1XA 4Q5EA 4U41A 4AW1A 4I0SA 5CAQA 5CEOA 3BQRA 2CLQA 3QD4A 4C4HA 4JMQA 2R3PA 3HUBA 3BV2A 3IOPA 3V04A 5TT7A 2BRMA 1ZRZA 3FLWA 1Q5KA 3TM0A 3R1NA 4LMUA 5CVGA 4BY9E 4S32A 5LMKA 1OIQA 4AZEA 2Y4IC 1XBBA 4XG2A 2NYAA 4CKJA 3Q52A 3W2RA 4Z7GA 2PVMA 1FGKA 4FKLA 5DLSA 3C4CA 4YHFA 2ZB1A 1PKDA 4G3FA 2ONLC 3CIKA 5C03A 4AF3A 4CMOA 5IG1A 2VU3A 4FTKA 4CCUA 1GJOA 4YR8A 3VULA 5L8JA 4MKCA 4GYGA 4V05A 3R73A 5A4LA 3TNPC 4RC4A 3C51A 3HX4A 4QMOA 5CNOA 5FEEA 5C8NA 2NRYA 1ZLTA 1YWVA 1YXTA 3O71A 3PIYA 5HE0A 1YOLA 2WTDA 4W4XA 4EQUA 3VVHA 4WA9A 4OTIA 2XNGA 3QTIA 4DGLC 2ESMA 4X2FA 2FGIA 3R2YA 4I4EA 3VHEA 2W1ZA 2QODA 3GC7A 5AJQA 5HQ0A 5J1VA 5KMMA 4KWPA 1WBPA 3MH2A 4AZFA 4BWXA 4JJRA 3HYHA 5DH3A 1VYZA 2F2CB 3PXKA 2JDSA 2X4FA 4FT7A 1URWA 4ZK5A 5FM3A 2XNPA 2WTKC 5LXMA 2C5XA 2EU9A 4TN6A 3QYWA 3IGGA 1ZYSA 3OVVA 4QMSA 3W0RA 5M55A 2J0MB 4D4RA 3HKOA 1RQQA 4BCJA 3CPCA 4O4EA 5M06A 3VUIA 5EW3A 2PE2A 3NWWA 1JKSA 5CU2A 3BBTB 5E8YA 3ROCA 3R02A 3Q6WA 1DS5A 2HIWA 3LXLA 4YHJA 2UZUE 4NM3A 3NUYA 3DNDA 1M7QA 3JUHA 3KC3A 1H1PA 4MNEA 5GNKA 3EQGA 3E88A 4TYEA 4B8LA 5JEBA 3UZRA 4NIFA 2ITXA 2QOKA 3GUBA 3ZDUA 2HCKA 2C3KA 5IA1A 4ZTNA 2WMTA 2OZAB 3NS9A 5DE2A 5AUXA 1J7UA 4O7SA 4EH8A 1Q3WA 2YJRA 4GG7A 4NM5A 5FBOA 4FVPA 3K5UA 2C5YA 2CLXA 3W0PA 3GCVA 4FNYA 1F5QA 5CZHA 4D1SA 3TUCA 3R7VA 3R8UA 1G8JA 3P7AA 4BKYA 3FLSA 3E3PA 3QBNA 1O9UA 2B52A 3GNIB 1SVEA 4MEDA 3VQHA 4BTMA 5DRBA 3PUFC 3R7GA 2OJJA 4L9IA 3FI8A 2QO7A 4A7CA 4O2ZA 4L46A 4AFJA 3ORMA 1DAYA 3WI6A 3TUDA 2BUJA 4HYSA 1W7HA 2HY81 3F82A 3Q6UA 3UOJA 1YKRA 3DJ6A 4Z55A 3PLAE 4F63A 1IG1A 3WZEA 3BHTA 3OWLA 2VWYA 4QYHA 5DR6A 3SAYA 5JQ8A 4C3FA 4ZTHA 3KKVA 1L8TA 1YXUA 4OBPA 4PUZA 4YJSA 3VUKA 4FV7A 4V0GA 4F70A 3UMWA 4IE9A 5AUVA 2GSFA 2XJ2A 3LJ0A 4HYHA 4Y83A 5E90A 5HIDA 4A4XA 3LKMA 3HV5A 4OUCA 3UOKA 4AOJA 4GMYA 2VD5A 3SXFA 4RRVA 5HNIX 4FOBA 4R6VA 3Q60A 3VNTA 4YJPA 3ALOA 3C4FA 2YLEA 1AD5A 3FXXA 1RE8A 3KGAA 4V04A 4WNPA 5AAEA 4CG8A 2Q83A 1ZYJA 2QCSA 4AN2A 4D2RA 4PX6A 4BDJA 5F1ZA 4ANOA 2XIYA 3IW6A 3R0TA 4FSZA 4BDBA 4J7BA 5I9YA 4LL0A 3KVXA 4RA4A 4FKOA 4GH2A 5C9CA 2VO7A 2YIXA 2FB8A 1JSUA 2X7OA 5GIPE 3G9LX 5I4NA 4BDHA 1Z57A 3TMOA 2VNYA 4R1YA 5KE0A 2QOQA 3MB6A 4BYJA 3OFMA 4PPCA 5K4JA 4NEUA 3TIZA 2C5OA 4ZJJA 4RX8A 2R3IA 4C4IA 2XM9A 5AUUA 1PXKA 2GCDA 3BI6A 3PIXA 3TNHA 4FVRA 4EUTA 4WKQA 3QKMA 3UDTA 4PMMA 2XNBA 4Q5HA 4QMTA 4GCJA 2PVFA 2YAKA 4CV9A 1YI6A 4MXCA 3W55A 4TYGA 2OJIA 5DVRA 5HORA 2R0UA 4JT3A 4D28A 3EQCA 3SOAA 1G8AA 3MBLA 5LARA 3CXWA 4OTFA 1A48A 3BLAA 1MUOA 3EOCA 3LXNA 3A61A 3NW5A 4XUFA 3R8ZA 3EQPA 3ROYA 2FO0A 3ZC5A 3MWUA 4XHKB 1U46A 4C2VA 3DY7A 4ALVA 3QZHA 4E26A 1SYKA 2A27A 4DYMA 3KXMA 4IVAA 3H9RA 5DR9A 3TL8A 2VTSA 3R7UA 3SKCA 2ITQA 3EKKA 2YLFA 3GOPA 4JQ7A 1ZMWA 3QWJA 5EFQA 4NUSA 4CT2A 2HW6A 5K4IA 2BDJA 4ZSEA 2PZRA 3FZTA 3R9RA 1KE8A 3GBZA 5HX8A 1Y91A 4CD0A 5E8SA 3NIZA 4EJNA 3IK3A 3G6HA 1U5RA 1ERKA 3L1SA 4KKEA 4JI9A 2R4BA 2CKOA 4JXFA 4IFGA 1BLXA 4KKGA 5M4FA 3JY0A 5DMZA 3HMOA 5DGZA 1GAGA 4FG9A 2JIUA 3W2OA 3R7YA 3JR1A 4F0FA 2YCQA 3NUPA 4YPSA 3P9JA 4TNBA 3S0OA 3CS9A 5H8EA 1H28A 4WD5A 5I9UA 2BPMA 3OXIA 3RAKA 3E8CA 3AC3A 4GVAA 3DK3A 4DG3E 1TQMA 4EOSA 5AR5A 1OUKA 2WFYA 3NEWA 2VWZA 2C6OA 4JAJA 4DEBA 5M09A 3WZUA 5FEDA 3CE3A 3D4QA 3TV7A 2OBJA 3OY1A 3QTZA 3KN5A 5EI8A 2C0OA 4QMUA 1LPUA 5B0XA 3HA8A 3TDWA 3FV8A 3MIYA 3R7EA 5KKRB 4GL9A 4AWIA 3QZFA 2FSMX 4OBOA 1YVJA 1P14A 3Q4UA 3UC4A 3A7HA 4EBWA 1WFCA 2WQOA 3MVHA 1BL6A 3P5KA 5CI7A 3W8LA 5AA9A 3G0EA 2O5KA 3MJ2A 2UZEA 4R3RA 2XBJA 4QMMA 4IVDA 4RQKA 3MVMA 2JAVA 2XUUA 1KE7A 3C1XA 2X6DA 4PL4A 4XOYA 3R9OA 3FXZA 3LFQA 4MD9E 4M8TA 4X7QA 4BKJA 4CFVA 4RIYB 2RIOA 3QUEA 2IEWA 1JSTA 4IAIA 4MVFA 4HVIA 1Q97A 4HVGA 1UNHA 4HVDA 2QLQA 2ETMA 3MY5A 2UW9A 5M4IA 2YM8A 3PXRA 4K1BA 4M12A 2PMNX 5KMIA 4QDVA 4DBXA 3PA3A 5AFVA 5TR6A 2X0GA 4DEIA 2YCFA 4X0MA 2BRHA 1JKKA 4BGGA 2WMXA 3I81A 4LOPA 3C0HA 4G6OA 3FI4A 3SHEA 3UGCA 3LM5A 5AM7A 4S34A 3UQFA 2PZPA 2J90A 3PVWA 1H25A 2W4JA 3D7TB 1Q99A 2PUIA 3NGAA 3VF9A 3TUBA 1Q4LA 1NVRA 4TW9A 3OY3A 1KE6A 3WF6A 5J1WA 1O6KA 2G9XA 2YJSA 3EFLA 4BCMA 4FZ7A 4C8BA 4EHVA 2GHMA 4G3CA 2OW3A 1UV5A 3AOXA 2JFLA 4JL9A 3NNUA 5HU9A 2YM3A 1UNGA 4OGRA 4GW8A 5IKWA 3V51A 4D2PA 2IJMA 3P08A 4NW5A 2R3RA 5AR8A 3S00A 4PDOA 2FSLX 2XRWA 3AD4A 2C5VA 3LXPA 5F94A 4XS2A 4PNKA 1XH7A 2XK7A 1WVXA 2Y4PA 2R7IA 4IAYA 3C13A 4CRLA 4RIWB 4U43A 3MH1A 3AMBA 4DLJA 4EOLA 3U8WA 4C62A 2WIHA 4NCTC 4JDKA 3JXWA 3MESA 4F7JA 1A06A 3CPBA 2BROA 3GENA 4PP9A 5EYCA 5C4KA 3KRJA 3U4WA 1OGUA 1SVHA 1WBSA 4FZDB 4ITIA 2QR8A 1GZOA 4BTKA 2H6DA 3NNVA 3FYKX 3OF0A 3B2WA 4QMPA 4F99A 5EHLA 2VWWA 4UMQA 3E63A 5C8KA 3I7BA 4U3YA 4BR3A 2NP8A 3BRBA 2BZHB 4O0WA 5HE3A 5M56A 4YZDA 3W0MA 2RL5A 3DNEA 3GQLA 2XYUA 3OEZA 3Q04A 4MBIA 4PPBA 4O7VA 2GNGA 1CDKA 2VWBA 2GS2A 5H8GA 1KE9A 3VONA 4TRLA 4PV0A 1FBNA 3PP0A 2YM6A 4S33A 4CZUA 4Z16A 3AKLA 3FMLA 4WRSA 4C59A 1Q8WA 4XOZA 3DGKA 4FG7A 4IC7A 4NK9A 5I3OA 4OTHA 4O84A 3HAVA 4AACA 3OOMA 5E7RA 1DAWA 2XIXA 4CQEA 4RWJA 3W0QA 3IW7A 4GS6A 2R3NA 2XKEA 3I1AA 5EDQA 3NUSA 2W4KA 3MI9A 4KNBA 5DR2A 5AEPA 1ND4A 1RJBA 5CX9A 4CFFA 5LMBA 2XVDA 2Y7JA 4FZFB 5HICA 1H07A 3FE3A 3HV4A 4IB0A 4R3CA 3WZDA 3HAMA 4LV5A 1AGWA 4DEHA 2WTCA 4G6LA 2W5HA 3ZRLA 2BKKA 3GB2A 2Q0NA 3A60A 2JBPA 4J1RA 4XP3A 3BZ3A 4NCTA 2XBAA 4WNMA 4YURA 3GU5A 2YDKA 3COHA 3VS7A 2JFMA 3BV3A 4TTHB 4A9TA 2VO3A 3BHUA 3GI3A 4ANLA 3S1HA 4RJ5A 3M42A 3ZM4A 4FOCA 5HX6A 1YDTE 3ZM9A 3FBVA 3CCNA 4YTCA 4WUAA 1NY3A 3EIDA 1OBGA 1ZXEA 4ZXTA 4E3CA 2CCIA 3ZUVA 4J99A 1REJA 5E1EA 4C02A 3LFNA 1KOAA 2WMVA 4JBVA 4I93A 1PJKA 3W32A 3LVPA 4QNAA 4RZWA 3P7CA 3PYYA 3S2PA 2I40A 1OPKA 2WPAA 5LVPA 1OUYA 3BPRA 4OTPA 4GUBA 5A6NA 4U44A 2PMIA 1WZYA 2B55A 3HV7A 4F9AA 3FMKA 4A9RA 3LM0A 3PY1A 4U3ZA 5C27A 1XMLA 4JG7A 4LDTA 2OF4A 3A7GA 4PL5A 5J9ZA 1QMZA 4DINA 1Z9XA 4AN9A 3EN7A 4FTIA 1PW2A 2GU8A 4FF8A 3IW5A 2BZIB 4JOAA 3I0OA 3ZXTA 2UZNA 3BGZA 4X21A 5F20A 2VNWA 3ID6C 4AGUA 3GT8A 3GP0A 1ZZLA 2QG5A 2WQMA 4JX7A 4QTAA 4YJVA 5CSHA 2P33A 2RF9A 4N57A 3ZO3A 2XAMA 4AZTA 3L9LA 1GZKA 4LRKA 4IDVA 1M52A 4DEGA 3WOWA 2JDRA 3A4PA 2X0QA 2C68A 3PRFA 4EK3A 2FUMA 4IB5A 5BVOA 2UW5A 2O3PA 2OJGA 2P2IA 3Q9YA 2KTYA 3QKKA 4TWCA 3B8QA 5IEXA 4NFNA 2E9UA 4KIPA 5EOLA 3FDNA 5BUEA 3REPA 2BKZA 3D5UA 3RBWA 3UZPA 3WYYA 5LJJA 3IGOA 3QGWA 2P0CA 2PUPA 5A9UA 3N4VA 4FIFA 3PJ1A 1KOBA 3A99A 4MXXA 3H9OA 4BYIA 3R8MA 3O23A 5IUIA 3DA6A 3RPSA 2PMLX 5GJFA 4DFXE 3AMAA 3MW1A 2E2BA 3KXZA 4E73A 3EN4A 1SMHA 4EHZA 3WARA 3SVVA 1YDRE 4HCVA 3FEGA 5EQYA 4EYJA 2NPQA 3ORIA 1OB3A 3OCSA 1UU9A 4OTRA 4EK6A 1MQ4A 3ZO1A 1DI8A 2Z7QA 4F08A 3D15A 3I5NA 3ZH8A 4DT8A 3IW8A 1M17A 5BYZA 4BZOA 3W2QA 1P4FA 3AC8A 5J95A 5AX9A 4E5WA 2C0IA 3A7IA 5HZNA 4AN3A 3R2BA 3RGFA 2X8EA 3R83A 3LJ1A 5IEYA 4UMUA 4HGTA 3ZYAA 3PPJA 2FYSA 4FG8A 4F0GA 3RNIA 5FP6A 4RJ6A 1Q8UA 4Y5QA 3LQ8A 4CZYB 4ZOGA 1TZDA 3G90X 3VBWA 2PZIA 4FL2A 4H3PA 3CTHA 4D1ZA 3NNXA 2R7BA 3VUGA 3VQUA 3ET7A 4DCEA 2OWBA 2X81A 4LGGA 2E9PA 5HG5A 4TNDA 2ZV9A 3PJCA 4P4CA 3RM7A 2QOOA 5ANJA 5HTBA 3D7ZA 2GTMA 3DOGA 3PFQA 4FUYA 4AA0A 2BZJA 3C9WA 4LMNA 4D0WA 4EWHA 3W0NA 1PKGA 5EKNA 3E8EA 4LQMA 3AGMA 2YABA 4U5JA 3UYTA 2J5FA 5DI1A 5AR4A 1FVVA 3NX8A 3ZUTA 4IZ5A 3DBCA 4FKTA 4KABA 2PK9A 5BMMA 4RJ7A 4AT5A 4EKLA 4BHNA 4P90A 5D41A 3O51A 4D4VA 5CTPA 4EZ3A 3ZZWA 3U6IA 3FPMA 4I92A 5EYDA 2HZ4A 2F49A 2XNMA 5CSWA 4ZLZA 4M69A 4X3JA 4MF1A 3A2CA 3HUCA 3L8VA 3E64A 5E8XA 4IWDA 3FI3A 2UZTA 4IAAA 5GHVA 4BIBA 3QZIA 3UO5A 1YHSA 3MFTA 5CEQA 2J50A 3FY0A 4PL3A 2JIIA 3QWKA 5LWMA 4F4PA 3GU6A 3KMWA 4N6YA 3FZSA 1WVYA 5BX0A 5FXRA 3JY9A 3E7VA 4R5YA 4D2TA 2FSTX 3F3WA 3L8SA 3OXZA 4NM7A 3ULZA 1FPUA 4CFMA 3TZ8A 3KXXA 3HVCA 4GK4A 4L00A 2WNTA 2IZUA 2HZ0A 1VZOA 3F2AA 3LIJA 3WYXA 3D5VA 5ETIA 4FTLA 2W1DA 3ZSHA 1H1WA 3LOKA 2OIDA 2BHHA 5EI2A 3ZO2A 5A4QA 4BL1A 5DPVA 1YOMA 4BDAA 3SW4A 2WHBA 4HNFA 4I23A 1QPDA 2XM8A 1JNKA 2QOLA 3RVGA 3NMUF 3PSBA 1B6CB 3AT4A 4UV0A 3Q2JA 2BRGA 4XG6A 4CTBA 4YBKA 1OKVA 5CXHA 5K0XA 3VUMA 5IUGA 5IDNA 3O0GA 4ASEA 4X2JA 5LMKC 2ZOQA 3D83A 3KCKA 3FJQE 4QPAA 3NAXA 4BZDA 2BAQA 5HG8A 1ZARA 5E8WA 3UZTA 3FMEA 3OHTA 2JKMA 2KULA 4OLIA 4U6RA 4B4LA 2GQRA 4FIJA 5FQDC 4JRNA 2QU6A 3KXGA 3DXQA 4IAZA 4EZ5A 3M11A 5L8KA 4QPMA 4DEDA 2WU7A 3PP1A 4BDEA 4QRCA 2R3FA 4TY1A 3HA6A 5IQIA 4AUAA 3EQBA 1MRYA 1OPLA 5LCJA 5FEQA 5HO7A 5HO6A 5A3XA 5IF1A 2PMOX 5IQCA 5E4HA 4KSPA 4Z7HA 2R2PA 3LXKA 4DEAA 1APME 1STCE 3COMA 4GT4A 5HLWA 5EQEA 1XH6A 4A9UA 1H24A 2I7QA 2C3IB 2DWBA 4IEBA 2W1HA 2O64A 4BBMA 2PULA 3KRLA 4DH5A 2B9HA 2ZB0A 4RWIA 4BDCA 2C1BA 4XRJA 2BAJA 3FL4A 4L01A 4XYFA 2XS0A 5M51A 2ITTA 3QRTA 4FYOA 4DITA 3CKWA 2HY0A 4RIXB 5M44A 2JAMA 5HOAA 3T9IA 2ITVA 4IWQA 5FM2A 4Q9SA 5DRDA 3CKXA 4NU1A