4EWHA

Co-crystal structure of ack1 with inhibitor
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
275
structure length
274
Chain Sequence
LTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Activated CDC42 kinase 1
publication title Synthesis and optimization of substituted furo[2,3-d]-pyrimidin-4-amines and 7H-pyrrolo[2,3-d]pyrimidin-4-amines as ACK1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 78
structure length 274
sequence length 275
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ewhA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ewhA01
2G01A 5CF6A 2C3JA 4LRMA 3CKWA 1PMNA 1RW8A 4DG2E 4EC9A 4AF3A 2B4SB 3DK3A 5HBHA 3LKMA 1JKLA 2WNTA 4ZY6A 2PZ5A 2VWBA 3JR1A 5KHXA 3A2CA 4K9YA 4KWPA 4O82A 1W7HA 4R6VA 5A9UA 2EUFB 3G0EA 2WZJA 1PHKA 4IAKA 5E8VA 1G8AA 2WQOA 2VWWA 1X8BA 4HZRA 1QMZA 2W1GA 5HD7A 4AW2A 3DNEA 5IUIA 1MP8A 1TKIA 2ERZE 3OBGA 4YTCA 1F5QA 4EK5A 2QODA 3B2WA 4PDOA 2QURA 4OGRA 4QP7A 3VS0A 2PZIA 3UGCA 4AOIA 4UMPA 1MQ4A 5ETFA 3RK5A 4FSUA 5F4NA 3F5GA 4L6QA 1R1WA 4P90A 5IISA 3LM5A 3QGYA 3UYSA 4EEVA 1B6CB 2OBJA 4TY1A 3A7HA 2PVRA 3KL8A 4XRJA 3BGZA 3PJ1A 3OMVA 3M42A 3D94A 4FYNA 3MPAA 4DLIA 3S4QA 4BKYA 4PTGA 3GP0A 4QO9A 4RFYA 4F9CA 4O0RA 5I9YA 1WBTA 2PE2A 4ASDA 3F3WA 1IA9A 5GZ9A 3OW3A 4RPVA 1P4OA 3GNIB 3CTQA 2EVAA 3QQGA 5EFQA 5EM5A 3TKHA 5IH5A 5L2IA 1OKZA 3UBDA 1G5SA 3LQ8A 4S31A 4W4WA 4R78A 2OFUA 4RX9A 4CYIA 4ACMA 4ZP5A 5K3YA 3MWUA 2H9VA 2HZIA 4FF8A 4QP4A 3LAUA 3EIDA 4FVPA 2I6LA 3BE2A 4C33A 5D12A 4YR8A 2PULA 1FINA 3ACKA 4G3DA 3CR0A 4O1PA 4L3LA 3BLQA 4EYMA 3E3PA 3N51A 5M53A 4QOXA 5CF5A 4YO6A 4EC8A 4B6LA 3DTCA 4R3CA 5AV1A 2E9PA 3VF8A 1Q8TA 2FGIA 3V01A 4ASZA 3H9RA 3KA0A 4HVGA 1XBBA 4FIIA 4D1ZA 4M8TA 4QRCA 3DU8A 2OJFE 2XM9A 4KRDA 1GAGA 1RJBA 4FSMA 4MD9E 3RHKA 2XEZA 3RNIA 2C30A 1GZOA 4AGCA 4FIFA 5FQDC 1MRUA 4YTIA 4U41A 5CZHA 3D2IA 3O0GA 4DFLA 5AJQA 3OUKA 4WBBB 3HRFA 4LGDA 3BV3A 4DLJA 4JBPA 4GL9A 3ZH8A 4FKSA 3UE4A 4EOPA 4FIGA 2HWOA 4I5MA 4JG7A 4D4RA 5E4HA 4WRSA 2E9UA 3PIYA 4EH4A 2ZB0A 3W10A 5FEDA 3TZ7A 4UX9A 3F7ZA 3FLQA 1O6KA 4ANMA 4CFWA 4U3ZA 4BCKA 2WMAA 3TV6A 1KV2A 4PMMA 4BCGA 2QI8A 2VO7A 3O96A 4LRKA 4GEOA 3G5DA 5EHOA 3RI1A 2XK4A 3VUIA 3OCGA 5CASA 3FKNA 5HE3A 4ZLOA 3FMHA 4O0VA 4IWOA 4CFUA 2OO8X 3F3VA 4F0FA 4YJOA 5DOSA 4UXLA 2PMIA 4UMQA 4M12A 3OCTA 4BDCA 3R1QA 4D2RA 3F66A 3PVUA 4BYJA 3DLSA 4DCEA 4YSMA 4QNYA 3P4KA 4USEA 4BGHA 2F7ZE 2VNWA 4YZBA 4ZTQA 4GK4A 4F99A 1YW2A 3EHAA 4I94A 3V8SA 1M14A 5IEVA 3UOLA 4AU8A 4TPTA 5KZ0A 4BCMA 3Q4CA 2QOQA 4H05A 3FSKA 3Q2MA 4G5PA 2JKMA 2P2IA 5AV2A 2GNGA 4NTSA 4M66A 2DWBA 5J9ZA 3ANRA 1JSTA 2VX0A 4XOYA 1APME 2YLEA 3H9OA 5C8MA 3SDJA 3HAVA 3AT4A 1QPDA 3ZDIA 3HYHA 3D4QA 4NM7A 1OKWA 3PA3A 3R00A 4IFGA 4Y8DA 4KIPA 4XS2A 3KREA 2EWAA 3JY0A 1YXUA 2ETKA 4K6ZA 4YUQA 3GC8A 5LCKA 5DA3A 5K9IA 2YZLA 4ID7A 4L52A 4AUAA 2HW7A 2HK5A 3BE9A 3QU0A 4RSSA 5HO8A 2R3JA 4GT5A 3DPKA 4TYHA 5AA8A 2XIYA 3IW8A 4EOMA 1P4FA 2G2HA 2PE0A 3ALNA 3C13A 4HNIA 4QP8A 4FZFB 5HTCA 1NVQA 4AZVA 4EZ7A 2RFDA 2BR1A 2XJ2A 4GJ3A 3NYNA 3NRMA 4IZAA 4QMXA 3OTUA 5TO8A 3R8ZA 4JQEA 2XUUA 4GS6A 2WU6A 4YP8A 5AP2A 5TT7A 3WYYA 4EOIA 5AR2A 3FLSA 4E1ZA 5HICA 4O38A 5M44A 4TTHB 4II5A 4ITIA 4QYYA 5CAUA 4D4YA 2YA9A 4GT4A 4O86A 4TYIA 5EG3A 3NYXA 4ALUA 4X3FC 3M2WA 3WOWA 3LIJA 2Q0NA 1PXNA 2QU6A 3UC3A 2XM8A 3QALE 5EQYA 1JWHA 4E6AA 5BQ0A 3QTXA 1CKJA 4CZYB 4I5CA 3VS4A 1OGUA 5CEIA 3AMBA 1Q3DA 1JSUA 2O8YA 3EFKA 5EM8A 3RPOA 3RPYA 1YOMA 2W1CA 3CJFA 4KRCA 1Z5MA 4IZ5A 4EONA 2WKMA 5AA9A 2GPHA 2YCQA 3F5UA 4C35A 4RX7A 3GUBA 3FV8A 1OM1A 4K2RA 4XG2A 4U97A 5DI1A 4ZXTA 4Q9ZA 4PRJA 1OPJA 2C6DA 3IECA 2IZUA 5LARA 4O7RA 2B7AA 2OJIA 5DG5A 1PXMA 5J9YA 5KZIA 3IQ7A 3DDQA 3O23A 3ZRLA 3FI2A 2QO9A 5IDPA 2VO0A 5B2MA 1W84A 3MH3A 3BQRA 4GSBA 3VW8A 1IA8A 4G3EA 2IVTA 3T3VA 4KS7A 3KXXA 4ZZMA 5HNIX 3G6GA 1VR2A 1PYXA 3VUTA 4HCUA 4DBXA 3BYOA 5GNKA 1YWVA 3A4PA 4ZZNA 4FTUA 2VO6A 4I0RA 3UOJA 2XF0A 3DTWA 3R1YA 3ZTXA 3ORNA 4F08A 5IU2A 3H0ZA 3NUPA 4TL0A 2OLCA 3UZRA 4LOPA 2UZBA 5AM7A 4ZS4A 4L9IA 3KK9A 3ZO3A 3JVSA 4FKRA 3RPSA 3O8PA 4CEGA 5H8GA 3ZLYA 2YIXA 3GC0A 5HIDA 4D58A 4EZ5A 5F95A 2EXCX 3ZLWA 3MS9A 5L2WA 2W4JA 4XEYA 5DRDA 3D14A 3VQHA 3LLTA 4HVHA 1WCCA 3MVLA 3PSBA 4M69B 4NKAA 5HU3A 2ZDUA 5AP0A 5JGDA 4X0MA 3VUDA 3JYAA 1HCLA 4XV1A 3IKAA 5A3XA 3R8UA 2BUJA 1LPUA 4WT6A 3HAMA 5M51A 2X0GA 4FKQA 4HYSA 2OSCA 1XQZA 3PTGA 2E9OA 4FG9A 2QOHA 1NXKA 5CS6A 3R2YA 5HGIA 3ZEPA 4ACHA 2B9FA 4QTEA 3R30A 1PMVA 4E6CA 3MVHA 4W4VA 3QXOA 4FSZA 4I41A 4QTBA 4D2TA 3OEFX 1YXXA 4IC7A 4CRSA 2WTWA 4XUFA 5AADA 4G34A 3TDVA 5E91A 1CM8A 1M7NA 3OVVA 4YC6A 2GFCA 2ZM3A 3RWQA 1BKXA 4EYJA 2J5EA 4XG6A 4O0TA 4IJPA 3L8SA 3UIUA 4YC3A 3W2CA 3Q53A 2YWVA 2GMXA 3FQHA 1ZOEA 4GMYA 3VS5A 5LWMA 4XHKB 4BICA 2GS2A 4HJOA 4BHNA 5C4LA 1SNXA 5IQGA 2V22A 3E7OA 3EQFA 4PMSA 2IWIA 5GZAA 2XJ0A 5JGBA 4EBWA 2P3GX 4FL3A 3KVWA 4PPBA 3ZO1A 1ZYJA 5AUVA 4RLKA 4D9TA 3QZFA 3BX5A 3KEXA 3AD4A 1OZ1A 5KCVA 4USDA 3F9NA 4FL2A 4DC2A 5BUIA 2RG6A 3PJ2A 2WMTA 2EXEA 3FXXA 2FYSA 5M06A 2Y4PA 3FY0A 3D7TA 3GQLA 3PG1A 4MD8E 5AP5A 4IWQA 2R3FA 4Y72A 3PLAE 3U9CA 1MRVA 3ZCLA 4FSQA 4FZDB 3HX4A 5CAVA 3UIXA 1DI8A 4FV7A 4O6LA 4BDEA 4BDIA 4LV5A 3PXZA 4AA0A 2BKZA 2XMYA 3FZPA 2UW8A 5TOZA 2IZSA 4H39A 4UYAA 2B1PA 2VAGA 4IVBA 2W4OA 3BYUA 3LXPA 4AOTA 4XV2A 5H2UA 3RPRA 4EOOA 1L3RE 5KMMA 3I1AA 4S33A 3QL8A 3C50A 5EYMA 4CCBA 5EK7A 4FNYA 4IB1A 3NNXA 3NMUF 4FMQA 1FMKA 3UOKA 4LM5A 4FV1A 2Z7LA 2ITUA 3MYGA 2BILB 3LQ5A 4AW1A 2YDIA 4BWKA 3P23A 2VWXA 3ZS5A 4IW0A 4PL3A 1JOWB 3QQKA 2OJGA 4C3PA 4EK6A 4Q5HA 4B8MA 1OPKA 1UVRA 3MFSA 4E6DA 3E8CA 2WU7A 3DAEA 3ZRKA 4ANQA 3R22A 3RBWA 4PWNA 4RJ7A 3VUGA 2E9NA 1G3NA 4H3QA 5HE1A 3D5WA 4AAAA 3D15A 3QA8A 3ZHPC 4CXAA 3EQDA 1NA7A 3U55A 1YDRE 3DFAA 5IG1A 4YPSA 5EM6A 2W1EA 3EQPA 5FBNC 4DFYA 3C51A 4AACA 2UZUE 1ZLTA 3C9WA 5BVWA 3QCSA 3ZU7A 3QGWA 3ZEWA 2G15A 1IEPA 4MNEB 4CVAA 2P0CA 2UVYA 2YM6A 3ZO4A 3OZ6A 4EHGA 2CN5A 2GNFA 5CXZA 5J1WA 1DAWA 5K5XA 2BPMA 2B9HA 4AX8A 3QAME 2QVSE 1SZMA 3NPCA 3Q9YA 4OUCA 3MA3A 4D5KA 4DGNA 1H4LA 4DEEA 4F0IA 4O21A 1PMUA 2PVJA 3LJ0A 4FYOA 4MQ2A 3CGFA 4GG7A 4QT1A 4EHZA 4K1BA 3LXKA 2BRGA 5FXSA 3UTOA 3CD8A 3TTJA 4BCQA 3DCVA 1KE5A 4WSQA 3O50A 3U6IA 4L3JA 2QQ7A 4JRVA 4ACGA 2HXQA 2WMWA 1U5RA 4ZOGA 4U43A 5HNBA 2JDTA 4DFZE 3TDWA 2RFEA 1G8SA 3HVCA 1W8CA 3TG1A 3UO6A 4EQCA 4LL5A 2J50A 4FKGA 3D2KA 3QRIA 4QD6A 3DBQA 4IQ6A 3NX8A 1OL2A 3FLWA 3QZHA 3EB0A 4XJ0A 2X81A 5E1SA 5HZNA 2HCKA 3ERKA 4GW8A 1QPEA 4DG3E 1GNGA 5FTQA 4DH8A 3T3UA 1SVHA 3IGOA 3MY1A 4MKCA 3DS6A 4O7LA 3BELA 3MFRA 3WBLA 3SW4A 3WARA 1H0WA 4QMVA 3R7GA 2CGVA 2OU7A 4FKIA 2OXYA 5GIPE 4OBPA 3R7EA 1I44A 4IMYA 4BCNA 4BTKA 2R3MA 4FA2A 2PVLA 3ZO2A 1UU7A 5KE0A 3ZMMA 4EK3A 3N4TA 2UZTA 5C1QB 1JAMA 4AN3A 4OTRA 1ZWSA 2W17A 4I6QA 5CQUA 1UWJA 3BGQA 3EFWA 3RP9A 2CNUA 2W0JA 3CSVA 3ORTA 3QQUA 3FL4A 2ZAZA 3LW0A 3NAYA 4XP3A 1FVVA 2GHGA 3COHA 3FLNC 3R9HA 4E73A 4DBNA 3OW4A 4E5WA 5LMKA 3LFSA 3PRFA 4U44A 1YXTA 4QMLA 3V3VA 2R0IA 3QBNA 5AMNA 4FK6A 4QQCA 2PVKA 2UV2A 5CXHA 3PFQA 4MXAA 3QQHA 2HELA 2VZ6A 2P33A 1V0PA 2LGCA 2WPAA 1VZOA 5KKRB 3D0EA 3UP7A 5AWMA 3TIZA 2YERA 2JFLA 4B99A 2ERKA 4LL0A 5AP6A 3LJ1A 3LE6A 4A7CA 5HORA 4ZTSA 1NY3A 5C8NA 1IRKA 4V0GB 2ITXA 4ACCA 2BHEA 5HO6A 3KXGA 2BCJA 4GU6A 4WUAA 2KULA 5C8KA 3NW7A 3G51A 4E7WA 1ZZ2A 4FV9A 4K77A 3MW1A 2ITVA 4C4EA 4C2VA 3E87A 4BN1A 4Z16A 3QC4A 4KA3A 4G16A 4R3PA 3VJNA 4ZLZA 2X1NA 5M4IA 2ONLA 3A4OX 2X8DA 2XCHA 3PPZA 5E8ZA 3B8QA 4HCTA 4Z9LA 2OH4A 4E8AA 5IKWA 2B54A 4B8LA 3Q2JA 4BY9E 2BRHA 3R28A 3NUYA 2CCIA 3ZLSA 3ACJA 3CY3A 4WNPA 2PTKA 4C37A 1L8TA 3HL7A 2JKOA 3QLGA 3FXZA 4ZJVA 1UU3A 4JJRA 4IDTA 3GEQA 3C4WA 4KKHA 1OIRA 3WI6A 5HTBA 3Q52A 1M2QA 1FBNA 3S2PA 1R0PA 4BBEA 4BCFA 1F0QA 2CMWA 3NVMB 3UVQA 3E62A 2HY81 4UZDA 1BMKA 4NIFB 1ZARA 3EJ1A 4PDSA 5BUJA 3POZA 1KE7A 4BIBA 5AIRA 5G1XA 2JAVA 2WB8A 4F9AA 3ORKA 1Q62A 2Z7QA 2QLQA 3ALOA 4M7IA 3COIA 3BLRA 3OHTA 4I1ZA 3W2RA 3EL8A 3MN3A 4AXAA 4YNOA 4QQJA 4DT9A 3TZMA 3W8LA 2PZRA 3SAYA 1JVPP 3COMA 4JDJA 4FKLA 5AP4A 3THBA 4CKRA 5L8JA 4IANA 2JITA 2X9FA 5LVMA 5FXQA 2G2IA 4J8NA 4E4LA 3I79A 2OJ9A 1WFCA 4MWHA 3V04A 3SA0A 2C1AA 1U54A 1ZYLA 4J98A 5D41A 3BYMA 5AX9A 1URWA 2ITTA 4PTEA 3QTSA 3B2TA 3QCXA 4P5QA 4YHFA 4TYEA 2OIQA 4ZTNA 2QU5A 3EL7A 4C3RA 3FAAA 4YGAA 4MHAA 5DEYA 1AQ1A 3MBLA 4QYHA 3DQXA 5HG7A 5BYYA 2VX3A 4D2WA 1H1QA 3LCOA 3CS9A 4OT6A 5CNNA 3LFNA 3E8EA 4U45A 2BAKA 4TZRA 1SVEA 2WQBA 3TNIA 3C5UA 3TZ8A 3KCKA 5BPYA 4QMSA 4FC0A 3R8VA 4D4SA 4EKKA 4FVRA 4KBCA 4RIXB 4YZCA 1Q97A 4AT3A 3CPCA 2YM7A 3NNWA 3R2BA 4PX6A 3ZFXA 3ZM9A 3M11A 2VNYA 1RDQE 4YURA 1AGWA 4O91A 4S30A 3LFBA 5J8IA 2FSLX 1XH5A 3QWJA 3TI1A 4Q5EA 2OF2A 2VTAA 4FV2A 2CLXA 4JBOA 1PXLA 4PQNA 4QTAA 2R9SA 2XK7A 2GS7A 3EQCA 3CC6A 3MH0A 5EYDA 3TN8A 3VQUA 4CCUA 2ZM4A 3HMNA 3QUEA 4A4OA 1PRYA 4APPA 1Y91A 2JGZA 4RQVA 4CSVA 1YI3A 2BTRA 1UNLA 3EWHA 4IWDA 1PXOA 4NM0A 3FC1X 3QRJA 2PY3A 4X6QC 4C62A 2NO3A 4YJQA 4QMTA 4DFXE 5HQ0A 1SVGA 4QP9A 4NYEA 2UW3A 3ODYX 3TNPC 4CKJA 3F7WA 4RA5A 4CMUA 4G3GA 3QFVA 2QCSA 5B0XA 2QG5A 2XK3A 5E8SA 3PJ8A 4G1WA 4L45A 4DEBA 4G6OA 1Y8GA 3HP2A 4DFNA 3EFJA 3KKVA 5FLFA 3BCEA 4O22A 3BU3A 3PXQA 3QQJA 3QD0A 4IZYA 3ZUTA 4D4VA 3NUSA 4KS8A 2W1HA 4QMYA 3SRVB 3L9NA 4HNFA 4QPAA 3ZZEA 2PWLA 4D2PA 3D83A 3IOKA 4EH5A 5A4LA 3NUAA 5I0BA 3E3BX 1V0OA 3I6UA 2QOKA 2YCFA 3F61A 4KNBA 3P1AA 3A8WA 4QP2A 1O6YA 3ZZWA 3SLSA 1U5QA 3RZFA 1NW1A 5T68A 2XNNA 4XG7A 4I6HA 5J9LA 3E88A 2Z60A 2RGPA 4K18A 4HGSA 3KRXA 4C4FA 2BIKB 3SGCA 2PUPA 3JUHA 4C58A 2R3RA 4YZ9A 3VBQA 1JLUE 4OT5A 5KMNA 5IQAA 5AP7A 2FO0A 3TCPA 2HXLA 5M56A 2RG5A 3ZM4A 2VTMA 4FGBA 2RKUA 4FR4A 3QTRA 5AV0A 5K0KA 4IE9A 3R1SA 3REPA 4M69A 2CCHA 2J6MA 4I22A 4ZTHA 3F2RA 5L2QA 4R7BA 5KMKA 4RJ4A 4M0ZA 4ENXA 3S3IA 2GHLA 3BWJA 3SW7A 5FDPA 5JT2A 2X7OA 4EOQA 2UZNA 5KBRA 3K5UA 5FP5A 4G6LA 5ANDA 5AR4A 3V5PA 3WIKA 4RQKA 4AE9A 3C4EA 3K54A 2OF4A 4CTCA 5J1VA 3NIZA 3HA8A 2WOUA 1FVTA 3I4BA 3FZSA 3IOPA 4I5PA 2JLDA 4IM0A 5JGAA 3PSCA 4FNXA 5CEMA 2CKOA 4TW9A 4MYGA 4C38A 1H25A 3OROA 2W96B 4RIYA 1KE9A 5CY3A 2XYUA 5EW9A 4N6YA 4EKLA 1Y8YA 3L9LA 2XIXA 2IO6A 3PRIA 4NL0A 2HIWA 1W98A 2YN8A 4BCIA 4CLIA 3FMKA 5IA1A 2B53A 4FT9A 3TZ9A 4GK3A 3L1SA 4O0YA 4F7JA 1FGKA 3NDMA 2VWIA 4A9RA 4FIHA 2WTDA 4EI4A 4EZ3A 4DHFA 3VF9A 1JBPE 3IDCA 4K0YA 3KK8A 4NU1A 4QYGA 4DINA 2R3LA 2XCKA 4N0SA 2OJJA 3DZQA 4S34A 2ITQA 3QQFA 3KULB 4EH7A 1UNHA 4DA5A 1QL6A 3FYJX 3OC1A 4EHVA 2PSQA 4U7ZA 2KTYA 4OTPA 2ZV9A 1H01A 5CF4A 1B39A 2VWVA 3PXFA 4AWIA 4WRGA 2F4JA 5IA3A 5FEEA 5IZFA 4X3JA 2HAKA 3WZJA 4F4PA 4V05A 3E64A 3MTFA 5ANKA 1WAKA 3L9MA 3PG3A 3CP9A 1MRYA 1PW2A 4IB0A 3V5LA 1ZY5A 4TKSA 2W5AA 2F49A 1KUTA 2OKRA 3OTVA 4FG8A 3KN6A 4FKTA 1BUHA 4WSYA 2J0LA 2PZYA 5HLWA 3R7VA 3C0HA 1LR4A 5DGZA 3OXTA 4FEVA 4TYJA 1U59A 5ETCA 2C4GA 4AZFA 3HDMA 4YLJA 4D1XA 3NAXA 3BYSA 4EH8A 5LQFA 3IW4A 4GU9A 3G9NA 3UIBA 1IR3A 3R83A 2IVSA 4ERKA 1OBDA 4YJUA 4GUEA 5DEWA 3AC1A 3UMWA 5A46A 4FIEA 5EDPA 2AUHA 4K8AA 4M13A 4PNIA 4WNOA 4C59A 4CT1A 5HI2A 1ND4A 3MGYA 2VUWA 2JBOA 4IXPA 3RTPA 3WF7A 3PP1A 5B2LA 5T6KA 5HKMA 3SHEA 4YMJA 1UNGA 4X2KA 3ZONA 4Z7GA 3F88A 3NLBA 5DBXA 4FTTA 3GU4A 4GJ2A 2RIOA 5LMKC 3UQFA 2XYNA 4C7TA 3QCYA 4RVTA 3O71A 2V62A 2G1TA 3QXPA 3OXZA 4IH8A 4XG3A 4YNEA 3TKIA 3QWKA 3ZC5A 4W8EA 2BZKB 4ASXA 4DGGA 2Z02A 3Q32A 3QZIA 1K2PA 3KN5A 2H6DA 3WF9A 4FEQA 4D5HA 5GHVA 5JSMA 3MI9A 1AD5A 4UB7A 4QQTA 3MDYA 2VTQA 2QLUA 4YC8A 5L6WL 2UZLA 1KWPA 2R2PA 4HYUA 4OTIA 4UMTA 4DEGA 2SRCA 2W9FB 4EL9A 2CPKE 3GC9A 5AAEA 1OVEA 2Y6MA 4C4IA 3QA0A 5JZJA 4X3FB 2WTCA 4F9YA 1DAYA 4A4XA 3QUPA 4L42A 1HCKA 4J96A 4H58A 4RJ3A 4JNWA 4OTFA 4IIRA 5AEPA 2VN9A 2ONLC 3ZXTA 4NJ3A 3PY1A 4AP7A 3PIZA 2UVXA 2FSTX 3DXNA 4UALA 4XCUA 4O2PA 4D28A 4BB4A 2XRWA 4EOKA 5J95A 3K3JA 2UW4A 1XH6A 4MD7E 5HESA 3MY5A 4X2GA 4FGRA 1YXSA 4CFXA 2QR7A 2J2IB 3V5JA 3ZYAA 3SG9A 2A19B 4UYNA 2YDJA 4X2NA 4Y46A 4CG9A 1YOJA 3PXYA 3LCDA 3P7AA 3U6JA 4R5SA 2HOGA 3F82A 3TWJA 4F7SA 3Q6WA 3MVMA 3A7IA 3O8TA 4EWHA 4DG0E 4AZEA 4XV9A 1ZOGA 4ZY4A 5DPVA 4RFMA 3PDTA 2VTHA 5J79A 2XZSA 3NGAA 3SX9A 4TWPA 3TV7A 2QOBA 5M57A 2VWUA 4NEUA 3W2OA 3IK3A 1O9UA 3BHVA 3OFMA 3QTZA 3TUDA 3ORIA 4W9WA 3WYXA 2YZAA 3K2LA 2BDFA 4KIKB 1SYKA 2C6TA 3TEIA 4CFVA 3ZRMA 5AUUA 1ZXEA 3AT3A 2WTKB 3Q4ZA 5E8UA 3MV5A 5AUXA 2VO3A 3O8UA 1UKIA 1BYGA 5IUHA 4BCHA 4I6BA 2Z2WA 3FEGA 4HYIA 3W2PA 4DTKA 3RAKA 3U51A 4MWIA 4XLIA 2X9EA 3CTHA 4ARKA 2GHMA 4X2JA 4BWPA 3G2FA 5AAFA 4B7TA 2WQNA 4I5HA 4KKEA 5JFVA 4KSQA 4BDHA 4ZIMA 4U9AA 4L43A 4CV8A 3DY7A 4LGHA 3NUNA 3VC4A 5BMSA 1FPUA 3FMJA 3V6SA 3GFEA 3KMWA 2XBAA 1UU8A 3QF9A 4UWYA 3QC9A 1YI4A 1I09A 4ZTRA 4U79A 5CU6A 2OK1A 1XJDA 4ZSAA 4FTOA 1ZRZA 3S1HA 3NS9A 5DRBA 4IDVA 1GZKA 5FD2A 3OWLA 4LV8A 4D1SA 4JR7A 4EJ7A 1FQ1B 4RGJA 1Z57A 4OTHA 3OY1A 2ZV2A 2A1AB 2WHBA 4JAIA 1Y57A 4KBKA 2C68A 3RCDA 2QHMA 3LFEA 4MBJA 2AYPA 5IQDA 3SXFA 2R0UA 5BX0A 3EN6A 3QTIA 4K33A 3PYYA 3R02A 3SOCA 5CYIA 3SV0A 3AD5A 3IDBA 1GJOA 4Z7HA 3P9JA 2C6OA 3Q9XA 3R7YA 2OWBA 3AQVA 1XHAA 3UODA 3VAPA 5H8EA 4E4NA 4DF3A 1PY5A 2C3KA 4IVCA 5M4FA 3OF0A 4IAZA 3QLFA 4E93A 5CZIA 5A4EA 2P4IA 5JFXA 3EKNA 4RMZA 1OL1A 5EW3A 4EQUA 3L8VA 4XBUA 3HV7A 3ZDUA 3GFWA 4AZSA 2O0UA 4TNDA 4Y5HA 3DJ5A 5CENA 3L8XA 4QP6A 2ZMDA 2VTJA 4MTAA 1F3MC 3MB6A 3OD6X 4TYGA 3VS1A 4LGGA 3KF7A 3VBYA 4JDIA 4BDJA 1JKKA 5AR5A 2R3GA 2YIRA 3DNDA 3MSSA 3DBFA 2GQRA 4JLCA 4RG0A 3L9PA 3FPQA 5E8WA 2ZV7A 4ANNA 5AR7A 4EOLA 5LMBA 3DXQA 5D1JA 4F09A 5L4QA 4DTBA 2ITWA 4S32A 1S9JA 4C3FA 3CD3A 5CVGA 4ZSJA 4G9RA 2V5QA 4TT7A 2ZVAA 1OBGA 3U8WA 5HVJA 4QYEA 2GTNA 3D5VA 3GU6A 3GT8A 5AP3A 4LOQA 2WEVA 3FHIA 3HMIA 5D11A 3V5WA 4AZTA 4DGOA 3HMOA 1H26A 3VRZA 4ALWA 2BMCA 3C1XA 4O1OA 3VUHA 4YO4A 1XH8A 4GIHA 4RX8A 4R1VA 3OWKA 5FTGA 3WZEA 3ORLA 2CHLA 2HZ0A 1WBSA 3K5VA 2JEDA 3NZ0A 4RIWA 3PE2A 5HVKA 4YJVA 5AV4A 4QPMA 4FKWA 1P5EA 5K4IA 3AC2A 3HUBA 4W4YA 2BFXA 4RIXA 4TXCA 3HP5A 3NCGA 1TQMA 3H4JA 3OP5A 2WELA 3ZSGA 4YLLA 3Q96A 4ANOA 3QQLA 4H3BA 3OS3A 4IACA 2WIPA 5IUGA 1O6LA 2E2BA 1WMKA 4G3CA 4CZUA 4EH6A 4FTIA 4RA4A 2A4LA 2B0QA 1KOBA 5HCZA 3HZTA 1YKRA 3TUCA 3GU7A 2OG8A 4HOKA 3CGOA 5EQEA 3UP2A 5HNGA 4J99A 5D7VA 3TIYA 2DUVA 4LUDA 3PXRA 5H8BA 3R01A 4I0SA 2WMSA 1WVWA 1GIHA 5I9XA 4WIHA 4OTWA 5DIAA 2P55A 4NCTC 4PPAA 5HBJA 3FY2A 1OKYA 3HMMA 4IB5A 4WBOA 5L6PA 3G0FA 1ZAOA 3ZUVA 2Y7JA 4I92A 2XKCA 5A6NA 4OLIA 2GNLA 4E3CA 3ZLXA 4NK9A 4QTDA 4ZY5A 2CN8A 3BEGA 3ZXZA 1B38A 4CFNA 3DV3A 3FZOA 4R1YA 5K0XA 4Y95A 5HBEA 3V6RA 2XBJA 2EU9A 3QCQA 4C4JA 4H1MA 3SRVA 5CVHA 5HLPA 4NFMA 5D10A 1BI8A 5HTIA 5FDXA 3LOKA 3DBCA 2VU3A 2W1FA 5H9BA 3R71A 4JBVA 5KMOA 3AGLA 3I60A 1CKIA 2OIBA 2Z7RA 3QD3A 4GFMA 3LHJA 5LMAA 2Y9QA 4IM3A 2PUUA 2B55A 4I21A 4HGEA 4L53A 4DTAA 3UVRA 2NRUA 1CSNA 4ASEA 5FRIA 2UZDA 1TQPA 2IW8A 4DYMA 2X2MA 2YJSA 3PJCA 4PY1A 2Q83A 4FNZA 2JFMA 3Q9WA 2OICA 5ANGA 5M07A 4FKOA 2I0VA 3IO7A 3RNYA 4A9SA 4BDFA 4BVUA 5LVOA 4D55A 2V7OA 1YHVA 3QX2A 3R7UA 2JDOA 4BHZA 5DNRA 5J5SA 1YDSE 4FODA 4XRLA 1UKHA 4O0XA 5AUTA 2F2UA 4EK4A 1ZYSA 2BDWA 5FM3A 5CANA 1LP4A 4BGGA 5LOHA 5KMIA 4C34A 2OZAB 3TJDA 2JD5A 4AFEA 2QO2A 2WQEA 3VHKA 4A07A 1J7LA 4E6QA 1OITA 3BGPA 2ZJWA 3C4ZA 1FVRA 4MVFA 4U40A 3FKLA 4FOCA 1WZYA 3HNGA 3HRCA 1U4DA 2X39A 1J7UA 3W1FA 2WTIA 2HY0A 1JQHA 1VYZA 2GDOA 2YM4A 4G3FA 2QOFA 2EXMA 3OXIA 3DT1A 4AW0A 5L2TA 3AD6A 4PDYA 4A9YA 2VTOA 4Q9SA 3A60A 2R64A 2R7BA 4BDGA 1Q8YA 2WMRA 2Y6OA 3D9VA 5GJGA 5IQCA 3KB7A 5D9HA 1CKPA 3WILA 2I0EA 3ENHA 2X4FA 4GKHA 1GZ8A 2C6EA 4TYHB 2HZNA 5ANJA 4I4EA 3QTQA 2FA2A 4RJ6A 5CI7A 5JFSA 3RJCA 1E9HA 5GIOE 5EDQA 1J3HA 3QD2B 4FL1A 1XWSA 4JX7A 4JQ8A 4RWLA 4U81A 4DH7A 3HV4A 4O96A 1ZY4A 1K9AA 3FLZA 3KRRA 1TQIA 3LFAA 4J8MA 5M55A 1YDTE 2EB3A 4J52A 5LJJA 2I40A 4RJ8A 3LJ2A 5JQ5A 2C6MA 4BBFA 1JKSA 2PMNX 4F9BA 2FUMA 5HOAA 3RHXA 4CLJA 3CCNA 4CT2A 4NFNA 4LI5A 2IJMA 5T3QA 1YOLA 4GH2A 4L46A 5CI6A 3UZPA 4F6UA 3FMNA 5HG5A 4YJSA 3UVPA 1ZMWA 3AMYA 3E92A 4XP2A 4NT4A 1NVSA 3AOXA 2CJMA 2XRUA 5DYJA 3EQGA 2BDJA 3BU5A 4RIOA 5I3OA 4EWQA 3FJQE 3LXLA 2REIA 3H30A 2QOIA 3PSDA 2QONA 3IPHA 4I6FA 2F57A 3UJGA 4WNKA 5CALA 3FMLA 3DK7A 1A06A 1ZYDA 4FBXA 4ZTMA 5HLNA 4DT8A 2ITOA 5DLSA 3E63A 3KRLA 3DKOA 3VBXA 3KY2A 4AZWA 5KX8A 2R3QA 3EQHA 5E92A 4ZK5A 2B9JA 2C0IA 4BBMA 4D0XA 4BIDA 1Z9XA 4GCJA 3FYKX 2GQSA 2YAKA 4UWBA 1YHWA 3O7LB 5IA0A 4DEIA 3SC1A 2Y4IB 5C03A 1VJYA 2UW9A 2VRXA 2VTPA 1IAJA 5EOBA 3ATTA 3VS3A 3CQEA 3R04A 4IX6A 4CQEA 3V51A 2ESMA 4XYFA 5FTOA 2B9IA 2FSMX 2YIQA 4RC4A 5E7RA 2YFXA 4J95A 3VHEA 4F7NA 2XIKA 5CT0A 3EKKA 3TKUA 2YITA 4JBQA 4NUSA 4PL4A 3LZBA 4RVMA 2R7IA 5DVRA 4CFMA 4DEDA 3R9NA 4AGUA 1FOTA 4ZAUA 2ITNA 3QKMA 3SXSA 3WE4A 2C5OA 1LUFA 2O64A 3GOKA 3VNTA 4OTQA 3RMFA 3G15A 1GIIA 3EMGA 5EI8A 4GRBA 5A14A 5KKRC 3BHTA 4M15A 4UWCA 5AX3A 3UYTA 1ZZLA 5ITAA 3BU6A 3QX4A 5EKOA 5CX9A 4EUTA 5BVNA 5IDNA 4O7YA 4O83A 4FVQA 5HE2A 4W8DA 3LM0A 4FSTA 2GTMA 1BX6A 2XK8A 4CMTA 4EBVA 3PLSA 2WMBA 3GCSA 2LAVA 4QMWA 4FZ7A 2JAMA 5CU0A 1Q3WA 3RZBA 5IMXA 1SM2A 2OH0E 3AMAA 4J53A 5JKGA 2OW3A 3PVGA 4BF2A 1PKDA 4H3PA 5IQFA 4GYIA 4F1MA 1YRPA 1WBNA 4ANSA 5E1EA 4JAJA 3F5PA 4MXYA 3R7IA 1Q8UA 4YZMA 4F9WA 1UV5A 5IQIA 2VGOA 3CE3A 3JXWA 1WBVA 3ULIA 2QG7A 2UW7A 4CTBA 2XK6A 3G33A 4JX3A 2C5VA 3QRKA 1REKA 4GIIA 3WF6A 4OAVB 4BC6A 4O7VA 3COKA 4O27B 4QMNA 1CTPE 4BZNA 5CU2A 3CLYA 4JG8A 1R3CA 3RWPA 2PMLX 5GINE 1JNKA 2RF9A 2PUNA 1PKGA 3OY3A 4LQMA 2JIIA 2XEYA 4JS8A 3ZBXA 3G90X 5EHLA 4O0SA 5CSVA 2OZOA 1W83A 3QYWA 2O65A 2YWPA 4WKQA 3D5XA 3UPZA 3VS7A 5ETIA 1OPLA 1R78A 2WMXA 4J1RA 1WVXA 4JDKA 4ALVA 3LMHA 3U54A 3KXZA 3EN4A 4YSJA 5TE0A 3TL8A 4ZEGA 2VD5A 2R5TA 5L8LA 1PJKA 3DB8A 4X6RA 3VO3A 2J0MB 3U6HA 3Q60A 3D7TB 2JKQA 4BDAA 4E4XA 3Q6UA 2J90A 5M4CA 4FT0A 2A0CX 3LFDA 4F1TA 3DLZA 1ATPE 3EN9A 4RWIA 2UVZA 4X7QA 4H1JA 3RK7A 4OBQA 1OECA 2YM5A 2ACXA 3MJ1A 5EYKA 3EQBA 3UG2A 4D2VA 4C2WA 4E5AX 2IZRA 3I7BA 5FGKA 4MBLA 4NTTA 3Q4UA 5DHJA 3VJOA 4L68A 3DB6A 4KUJA 2XNBA 4Z3VA 2RFSA 5FEQA 4RX5A 1FMOE 2PE1A 4BZOA 1H00A 4PP7A 3ZSHA 4YU2A 1YVJA 2X6EA 1IAHA 5CU3A 3KGAA 2J51A 5HD4A 5EDRA 2ETRA 3PPJA 5EKNA 3FI3A 2H34A 4MXCA 4BFMA 5DH3A 3R9RA 3RGFA 4BTMA 4AT5A 1OL6A 3LCKA 2FSOX 4BDDA 1BL6A 2C5NA 3Q5IA 5DMZA 4BI1A 2C6LA 2JDSA 4JRNA 1SMHA 1YXVA 1DM2A 5KNJA 5BUEA 2ZOQA 4FTCA 4LOOA 3UMXA 3C7QA 5EOLA 4LMUA 4G17A 3F3TA 2W9ZB 3CQUA 5BVDA 2R4BA 4Y83A 3AC3A 4QMPA 5CEKA 1OUYA 2ZDTA 1YI6A 2OXXA 5DT0A 3AT2A 4QMQA 3LCSA 4UMUA 2NNWB 5CEPA 4L7FA 4E26A 2Y8OA 2C5XA 3ATSA 5HHWA 4MX9A 4PUZA 1XO2B 3CPBA 4FSWA 1J1CA 3KCFA 4HYHA 4V01A 4XG4A 1RE8A 3Q5ZA 2UUEA 1IG1A 3KU2A 3BV2A 3R6XA 4YJNA 1IASA 5AUWA 1EH4A 4AN9A 3S00A 5LCJA 3U87A 5L6OA 4JIAA 4FEXA 3GCVA 4NW5A 2BIYA 3H9FA 3KMMA 3TACA 1W0XC 4PNKA 2I0YA 2PU8A 1XH7A 2X8EA 3TV4A 4HGLA 3ROCA 3G6HA 3OT3A 4ZSLA 2UZEA 3W16A 4AFJA 4XG8A 2CNVA 3FQEA 3RM6A 4Z55A 3NYOA 3A7GA 4IEBA 3R7OA 2WOTA 2ZV8A 2ZYBA 5IQEA 2QO7A 3N4VA 4E20A 4G2FA 4NCTA 3PVBA 3PWDA 4LFIA 4RFZA 2JDVA 5CVFA 3W8QA 5HG8A 3QTUA 2G9XA 3W55A 3LQ3A 4FV3A 1ZYCA 2R3IA 4FNWA 1QPJA 4PP9A 4UY9A 1GIJA 5ANEA 3TNHA 4D9UA 1DS5A 4I93A 4JT3A 4PMTA 4PPCA 2X7GA 3ZFMA 3BYVA 5IA4A 5I9ZA 2BTSA 4YTHA 3KRJA 3MPMA 2F9GA 4WG5A 4D2SA 1OKVA 4BRXA 4F6WA 4MEDA 1BL7A 1P2AA 3DGKA 4N70A 5IA5A 5I3RA 3EQIA 3PIXA 4AGDA 3EFLA 1H1SA 3MB7A 4IBMA 4YBKA 3NCZA 1GZNA 3ORXA 4YJPA 2ITYA 2X2LA 3HA6A 3OCBA 4U6RA 4C8BA 4BDKA 4R77A 4UN0C 1S9IA 3WIGA 1BLXA 5BYZA 1NVRA 4ZJJA 2PHKA 4FUXA 3FPMA 3M1SA 4OW8A 2AC3A 2WFYA 2VTLA 4QPSA 1PXJA 4AS0A 3ZBFA 3AC5A 2Z7SA 4GUBA 3PVWA 5DE2A 3HEGA 3UNZA 4QTCA 2W4KA 4GYGA 4OTGA 2CKPA 2VV9A 2YCSA 4CQGA 3HMPA 2XIRA 4EJNA 2ITPA 3DKCA 4USFA 5ACKA 3PZHA 4AE6A 5M4UA 3QKLA 4ITHA 4DH1A 4FSYA 2VTSA 5TF9A 1JKTA 3QHRA 3CKXA 3UO4A 5E8TA 5ANOA 3AG9A 5CSWA 2CGWA 3BKBA 4QYFA 4CMOA 4ZSEA 4N57A 4K11A 2YHVA 4EOSA 4M97A 5AM6A 3PE1A 4MAOA 5B2KA 4QMUA 2QHNA 4YPDA 4MK0A 5DN3A 4FV6A 2W99B 2CGXA 3NIEA 3IS5A 3RKBA 5CAQA 3UNKA 5IQBA 3QRUA 2F7XE 4ZTLA 3MY0A 3VUKA 4DCAA 1UA2A 3QRTA 3A62A 3BBWA 3FZTA 1PXIA 3UQCA 4B0GA 3ZSIA 1E1VA 1FGIA 1H1RA 3FZ1A 3WZKA 5AR3A 5ANIA 5I5ZA 5CNOA 3CTJA 5F20A 1T45A 2WIHA 3BHUA 4U5JA 2C3IB 3T9IA 2YCRA 3DK6A 3F69A 3DJ7A 4O0WA 5I9WA 1Q8ZA 3SKCA 3TNQB 5HIEA 1UWHA 4FSRA 2WTJA 4IHPA 4MF0A 1Q24A 5HX6A 5K4JA 4AG8A 4DH3A 3LPBA 1OI9A 4MXZA 5H3QA 4DN5A 4NZWB 4MNEA 3R21A 4HPUE 3ULZA 2XKEA 3PUPA 3BI6A 4GG5A 4EQMA 1M52A 2OXDA 5EM7A 3R1NA 3P5KA 5JEBA 4C4HA 3OOMA 4P5ZA 2VWZA 4HCVA 5E8XA 2BZJA 1WBPA 1XBAA 3FHRA 3ITZA 3WF8A 5GZ8A 1QPCA 4TN6A 4IB3A 3U9NA 3VS6A 3HV5A 1OIYA 2O5KA 2XS0A 3D7ZA 4RWJA 4XMOA 2C0OA 4EHEA 2BRBA 4FK3A 5JH6A 4ENYA 2PL0A 1YWRA 3AGMA 3Q9ZA 1J91A 3GOPA 1HOWA 4NH1A 3P86A 3VS2A 4R5YA 3BLHA 1OIUA 3PY3A 3HECA 5DR6A 3FUPA 4M0YA 3MFUA 4M84A 3V8WA 3Q04A 4E4MA 4I23A 5A6OA 3FC2A 5KMLA 2OZAA 4XP0A 3UPXA 4MF1A 3DAJA 4U80A 3R9DA 5C27A 3OCSA 4O7TA 4EH3A 5LXMA 4PF4A 5CQWA 3MVJA 3RINA 4JVGA 3JS2A 4G31A 3TJCA 3F3UA 1H0VA 4FE2A 1OL7A 1U54B 3HUCA 3ORZA 4AQCA 4LMNA 2IW6A 2BVAA 2XKDA 4KABA 4G9CA 4KIOA 3GU5A 2IG7A 2BKKA 3RPVA 3PPKA 5KMJA 3MPTA 1H24A 3O7LD 4AOJA 5JRQA 5FWKK 5L3AA 5C9CA 3OOGA 2UW6A 3C4FA 2QKWB 4KIQA 4F6SA 3HGKA 3PP0A 2WXVA 3IW7A 4IX3A 2WMQA 4A9TA 4QP3A 2QOOA 1R0EA 4NM3A 4CGAA 3DA6A 2X8IA 2WO6A 4A9UA 2PYWA 4FSNA 2PUIA 2R3PA 4IVDA 3KQ7A 4TRLA 4DITA 5LVPA 1LEZA 5EQPA 3KXNA 4ZMEA 1DI9A 4IAIA 3Q3BA 5CU4A 3FKOA 4FTKA 2HYYA 1M7QA 4GVJA 2X6DA 4BL1A 4FX3A 1A9UA 4HVIA 4RLLA 2ITZA 4FIJA 4FEWA 3GCPA 3ZOSA 2PVMA 2RL5A 4O7ZA 4RC2A 2YEXA 4BDBA 2R3OA 3ENMA 3WZDA 4O7NA 4YBJA 2C0TA 3QUDA 4P2KA 4V0GA 4DGLC 4NSTA 4XG9A 4FOBA 3E5AA 2HW6A 3A7JA 3HRBA 2OI4X 3DBEA 2I7QA 3PJ3A 3ROYA 5E9EA 3OWPA 4MH7A 2XNOA 1OL5A 3IDPA 3H10A 1Y6BA 4EORA 2UZOA 2YAAA 4ZSGA 2C1BA 4CFFA 2J7TA 5D7AA 3Q4TA 4W9XA 1Q61A 1XH9A 4OBOA 4XLVA 3F2AA 3NNVA 3VBWA 4E5BA 2I1MA 3LFCA 4I0TA 4O2ZA 3FE3A 2JKKA 4L00A 3I0OA 2ZM1A 3AC8A 2I0HA 2VTNA 3KC3A 3MA6A 5C26A 1H27A 4FKJA 2C6KA 3UQGA 2C47A 4L01A 4F70A 3GQIA 2XH5A 4XNEA 4FKUA 3LLAA 1ERKA 4WG4A 3VN9A 4TWNA 5DT3A 4IAAA 2WD1A 2IW9A 4H36A 3KMUA 5CAPA 2WTKC 5DR9A 4NIFA 3TNWA 1VEBA 1YQJA 2C3LA 1WBWA 2XNGA 3LMGA 3EZRA 3F3ZA 3N9XA 3P7CA 3PY0A 4S2ZA 2J0KA 3ZC6A 1BI7A 2Y0AA 4DGMA 2PZPA 3I5NA 4NWMA 3P08A 5GJFA 3T9TA 2FVDA 4GFGA 2E9VA 2GS6A 4G5JA 2R3HA 5GJDA 1V1KA 4XV3A 2YDKA 4MQ1A 4PTCA 3R9OA 4KD1A 2RFNA 3GBZA 3NVKI 3C0GA 2WGJA 3DDPA 3S95A 2NPQA 2XNPA 4WNMA 3ODZX 3N4UA 2VWYA 2CLQA 3IONA 5A4QA 5JRSA 3D5UA 3LMIA 3DOGA 4IC8A 3GGFA 4N4SA 4LYNA 4ANBA 5CSXA 4BCPA 4L8MA 3HV3A 3NYVA 4GV1A 5CEOA 2PVNA 3FMMA 1GY3A 4AGWA 1XKKA 2FB8A 1YHSA 4JIKA 4RIYB 2WMUA 3UIMA 3PWYA 3CJGA 3PA5A 4BCOA 4CNHA 5A4TA 4ANLA 3WF5A 4YJTA 3RAIA 3SOAA 1H28A 4R8QA 4BKZA 2YLFA 3UOHA 3W18A 4L7SA 2W1IA 5AV3A 4CV9A 3NUUA 4JG6A 2IPXA 5HCXA 4MXOA 3UDBA 4BZDA 2JIVA 2PMOX 1OUKA 4FV8A 2GNHA 4UZHA 3B8RA 2WEIA 3FI8A 3W33A 3P0MA 3POOA 4FT7A 4JDHA 4EOJA 5AFVA 2YACA 3SG8A 3UG1A 2J9MA 4DEHA 3KVXA 3V5QA 4EH2A 4UBAA 4UV0A 3BIZA 5M08A 3OG7A 2BALA 2BZIB 3HKOA 3A99A 5CSPA 3LVPA 4RC3A 1URCA 4GVAA 3RVGA 1P14A 2DYLA 4FTMA 4HPTE 4DH5A 5BVOA 4NM5A 3VULA 2GQGA 4F1OA 1PXPA 4I24A 2G2FA 2YM3A 3DZOA 3C5IA 5CT7A 1PXKA 3FWQA 4BTFA 2GNJA 4GK2A 2GFSA 5CF8A 5IH6A 3ORPA 5E90A 2C69A 5I9VA 3IW5A 4ONAA 3GVUA 5LVLA 3TXOA 5I4NA 5FXRA 2W1DA 3C0IA 4ZMFA 1KE6A 5AAGA 4FV0A 2J5FA 4FI1A 1QCFA 2GNIA 1GOLA 1KV1A 3PXKA 4FTQA 5IPJA 4YZNA 3I81A 3V8TA 3TUBA 4KINA 4P7EA 2GSFA 5EHYA 5IMEA 4C57A 5JN2A 1ZMUA 3P78A 3QD4A 2A27A 2QNJA 2X2KA 5DFPA 3V5TA 3NW5A 1JPAA 2P2HA 4FTJA 3GI3A 5BVFA 5IEYA 3II5A 5J5TA 2BHHA 2HENA 4CG8A 4QMZA 5EH0A 3EYHA 4HW7A 4CD0A 3FL5A 4Y73A 2AC5A 1H1WA 2UZVA 4RT7A 4YHTA 4EH9A 4HVDA 2QKRA 1NT2A 2QOLA 3BEAA 4O7WA 4U3YA 1CMKE 4MBIA 5JQ8A 4M67A 1H08A 5CSHA 1K3AA 5EI2A 4RZVA 4WD5A 4WG3A 4L44A 2Q0BA 4R7IA 2H8HA 2JC6A 4CKIA 4CZTA 4O81A 4JI9A 2DQ7X 3MH2A 1ZOHA 4AT4A 2QC6A 4BGQA 3BHYA 1LEWA 3RALA 3ZUUA 4BYIA 3E8DA 4TNBA 2XIZA 2WMVA 4OR5A 5FUTA 4FUYA 4G6NA 4FTLA 3FI4A 4J71A 4B4LA 4R7HA 3EN5A 3S0OA 3MIYA 1XBCA 3QYZA 5AIKA 2X7FA 3A7FA 4PL5A 4PV0A 3KRWA 4LG4A 5CTPA 3NW6A 3MIAA 2XNMA 3E7VA 4KBAA 5CWZA 3JY9A 1XR1A 2UW0A 3LFFA 3KF4A 5BVEA 4IFCA 4YLKA 1UU9A 1TVOA 4FKPA 4ORKA 2H96A 2RSVA 1J1BA 2W7XA 3C4XA 2XNEA 4QMOA 5CLPA 1Q41A 3PZEA 3EH9A 4U0IA 4AA5A 4UEUA 5ACBC 4GFOA 5AUZA 5FG8A 5LVNA 2IVUA 5TKDA 4BWXA 3DKGA 5DWRA 5FP6A 3W2SA 4CYJA 4F7LA 4P4CA 3DFCB 3FMDA 4I3ZA 4FICA 3L8PA 4QQ5A 3FMEA 4X21A 4FG7A 3BRBA 5HVYA 4TWOA 4JOAA 4XOZA 2IZTA 4C36A 2EB2A 2X4ZA 2VTIA 2IN6A 5L8KA 1XH4A 3NWWA 2QOCA 4RBLA 1H8FA 4KAOA 4OTDA 4RJ5A 4FV4A 4C02A 4DFUA 5EYCA 3FZRA 4IJ9A 3SXRA 3EN7A 2VGPA 3FXWA 2C6IA 5IA2A 4EUUA 3E93A 2V0DA 5C4KA 3KXHA 1PYEA 1YWNA 1M17A 3P7BA 3R73A 2WAJA 3JVRA 4L67A 3R8LA 2Z8CA 4A06A 5JMSA 5J87A 3HV6A 3O2MA 4TWCA 5IQHA 4NJDA 2BROA 1RQQA 3EYGA 3KULA 5HO7A 3I0QA 2C5YA 4UXQA 4AA4A 4Q2AA 2PPQA 5M09A 3F2NA 3DJ6A 1REJA 3K3IA 4O7SA 2BFYA 4FV5A 3ETAA 5EI6A 3UC4A 4F0GA 3ANQA 4RRVA 2XVDA 3OEZA 3DQWA 5ETAA 5CEQA 3I6WA 4FTRA 3OT8A 3AC4A 1JSVA 1OIQA 4WHZA 5HEZA 3BQCA 4GKIA 2FH9A 5A4CA 3ET7A 1Y6AA 3GC7A 3NR9A 4MXXA 1PMEA 4IVAA 2YABA 4KB8A 5JK3A 2HZ4A 3DKFA 3PA4A 5E8YA 5HG9A 1Q5KA 3LCTA 4O84A 4IX4A 4FTAA 4M14A 5BVKA 5IH4A 4YTFA 4ACDA 2VTTA 3SQQA 3G9LX 2BZHB 2W5HA 5KBQA 4RVKA 3GCUA 2VTRA 4I20A 4V04A 4DE4A 3GU8A 4IM2A 3FBVA 5K5NA 4ZJIA 3CIKA 2YIWA 4FT5A 4IAFA 3IGGA 1ZMVA 4Y5QA 4LRJA 4XH6A 3FQSA 3RAHA 4C61A 5DT4A 2VX1A 2OIDA 3H0YA 4MCVA 4APCA 4JL9A 2R3NA 3LXNA 4GT3A 3QZGA 3VWAA 4A4LA 5IF1A 5J7BA 2BRNA 3ELJA 1H1PA 3JPVA 3QHWA 3LFQA 3P79A 4CRLA 4OAUC 4ZLYA 3IW6A 3R8MA 2BAQA 4PMPA 3HLLA 2BRMA 2ZB1A 3DAKA 4R3RA 4YZDA 3DBDA 2GU8A 3KFAA 3A8XA 3I5ZA 3MJ2A 2QR8A 5KO1A 2WQMA 4NW6A 3QKKA 3W2QA 3ZFYA 3RK9A 5AUYA 3OBJA 5BNJA 3NEWA 3HDNA 4IWPA 4X2FA 1KOAA 2W05A 3NSZA 4D0WA 5ICPA 1OB3A 2J0IA 2W5BA 2UZWE 3OUNB 4I4FA 5I9UA 3CEKA 1R39A 2PK9A 3KXMA 5BYLA 2JDRA 5JZNA 4X3FA 3VVHA 4WOVA 4BKJA 2F7EE 5KHWA 3CQWA 5LWNA 5F9EA 5BMMA 3E8NA 3WE8A 3BZ3A 3MESA 4DFBA 3AXWA 1Q4LA 3UNJA 4IZ7A 2W06A 4F64A 4ERWA 4AW5A 4JR3A 1OMWA 3MH1A 2PVHA 3GCQA 4J97A 2NP8A 4FTNA 4RZWA 3R0TA 4HGTA 4JXFA 4O0UA 2V7AA 1WVYA 2YM8A 3SD0A 4EK8A 4QP1A 3U4WA 5HE0A 4BI2A 4FT3A 2XKFA 3FSFA 2Y4IC 3GB2A 4YJRA 4ZS0A 4BI0A 2O2UA 2XP2A 4O6EA 5C01A 4B9DA 4IADA 5F1ZA 3VIDA 3WZUA 3EOCA 5G6VA 3MTLA 3DXPA 4HZSA 3TM0A 4RVLA 3TT0A 4ZZOA 3SVVA 1KE8A 3MFTA 4IAYA 1T46A 3VBTA 2YIYA 1A48A 5HX8A 1W82A 5DR2A 2CKQA 4IX5A 1Q8WA 4BR3A 4QMMA 5HCYA 1MQBA 4U8ZA 3RAWA 1U46A 3VBVA 4L3PA 2OFVA 2V55A 3F5XA 4M68A 3W32A 3A61A 5CAOA 5AP1A 5KUPA 4MNFA 1MUOA 3T8OA 4FEUA 4BTJA 1CDKA 4BIEA 2HWPA 3VUMA 4RIWB 3I7CA 4N6ZA 2F2CB 4DAWA 3O51A 4ITJA 4KIKA 4KKGA 2PVYA 5AR8A 4WO5A 4FKVA 4FZAB 4Y85A 5F94A 1M2PA 4J7BA 4LUEA 4QNAA 5J7HA 5HIBA 3C4CA 3NUXA 3H3CA 4BCJA 4HVSA 2CSNA 3BHHA 3CBLA 5A54A 2XB7A 3VRYA 2CDZA 2A2AA 2JBPA 5TR6A 1H07A 2XA4A 4F63A 3FDNA 5HU9A 2QD9A 4C0TA 2CNQA 4XX9A 2YISA 2NRYA 3BWFA 3BPRA 3VW6A 5IEXA 3R8PA 2YJRA 2CKEA 2CGUA 4M3QA 4WUNA 4WA9A 2J4ZA 4C4GA 2UW5A 1VYWA 3RM7A 3UO5A 4YHJA 4NKSA 2XJ1A 4F65A 3ID6C 3F6XA 2ZMCA 5FBOA 3O17A 4W4XA 3CXWA 5B7VA 3ORMA 1M2RA 5FM2A 4XBRA 1WBOA 3BBTB 4RWKA 3CY2A 4UMRA 2J0JA 2DS1A 5L2SA 5JFWA 4PDPA 3OWJA 4AN2A 2WTVA 1Q99A 2OGVA 3TTIA 2R3KA 3NNUA 2O63A 2PVFA 2W1ZA 2XK9A 1PF8A 3GENA 1J7IA 1KSWA 3FLYA 2O3PA 1STCE 1SNUA 2JIUA 3R63A 3RCJA 2BAJA 1V0BA 2IVVA 3EZVA 3IG7A 2GCDA 4KSPA 4U42A 4FZ6A 5EW8A 3UZTA 2B52A 3EQRA 3GXLA 4DEAA 1E1XA 3QTWA 4JQ7A 2ETMA 3U4UA
chains in the Genus database with same CATH superfamily
2G01A 5CF6A 2C3JA 4LRMA 3CKWA 1PMNA 1RW8A 4DG2E 4EC9A 4AF3A 2B4SB 3DK3A 5HBHA 3LKMA 1JKLA 3TMOA 2WNTA 4ZY6A 2PZ5A 2VWBA 3JR1A 5KHXA 3A2CA 4K9YA 4KWPA 4O82A 1W7HA 4R6VA 5A9UA 2EUFB 3G0EA 2WZJA 1PHKA 4IAKA 5E8VA 1G8AA 2WQOA 2VWWA 1X8BA 4HZRA 1QMZA 2W1GA 5HD7A 4AW2A 3DNEA 5IUIA 1MP8A 1TKIA 2ERZE 3OBGA 4YTCA 1F5QA 4EK5A 2QODA 3B2WA 4PDOA 2QURA 4OGRA 4QP7A 3VS0A 2PZIA 3UGCA 4AOIA 4UMPA 1MQ4A 5ETFA 3RK5A 4FSUA 5F4NA 3F5GA 4L6QA 1R1WA 4P90A 5IISA 3LM5A 3QGYA 3UYSA 4EEVA 1B6CB 2OBJA 4TY1A 3A7HA 2PVRA 3KL8A 4XRJA 3BGZA 3PJ1A 3OMVA 3M42A 3D94A 4FYNA 3MPAA 4DLIA 3S4QA 4BKYA 4PTGA 3GP0A 4QO9A 4RFYA 4F9CA 4O0RA 5I9YA 1WBTA 2PE2A 4ASDA 3F3WA 1IA9A 5GZ9A 3OW3A 4RPVA 1P4OA 3GNIB 3CTQA 2EVAA 3QQGA 5EFQA 5EM5A 3TKHA 5IH5A 5L2IA 1OKZA 3UBDA 1G5SA 3LQ8A 4S31A 4W4WA 4R78A 2OFUA 4RX9A 4CYIA 4ACMA 4ZP5A 5K3YA 3MWUA 2H9VA 2HZIA 4FF8A 4QP4A 3LAUA 3EIDA 4FVPA 2I6LA 3BE2A 4C33A 5D12A 4YR8A 3VONA 2PULA 1FINA 3ACKA 4G3DA 3CR0A 4O1PA 4L3LA 3BLQA 4EYMA 3E3PA 3N51A 5M53A 4QOXA 5CF5A 4YO6A 4EC8A 4B6LA 3DTCA 4R3CA 5AV1A 2E9PA 3VF8A 1Q8TA 2FGIA 3V01A 4ASZA 3H9RA 3KA0A 4HVGA 1XBBA 4FIIA 4D1ZA 4M8TA 4QRCA 3DU8A 2OJFE 2XM9A 4KRDA 1GAGA 1RJBA 4FSMA 4MD9E 3RHKA 2XEZA 3RNIA 2C30A 1GZOA 4AGCA 4FIFA 5FQDC 1MRUA 4YTIA 4U41A 5CZHA 3D2IA 3O0GA 4DFLA 5AJQA 3OUKA 4WBBB 3HRFA 4LGDA 3BV3A 4DLJA 4JBPA 4GL9A 3ZH8A 4FKSA 3UE4A 4EOPA 4FIGA 2HWOA 4I5MA 4JG7A 4D4RA 5E4HA 4WRSA 2E9UA 3PIYA 4EH4A 2ZB0A 3W10A 5FEDA 3TZ7A 4UX9A 3F7ZA 3FLQA 1O6KA 4ANMA 4CFWA 4U3ZA 4BCKA 2WMAA 3TV6A 1KV2A 4PMMA 4BCGA 2QI8A 2VO7A 3O96A 4LRKA 4GEOA 3G5DA 5EHOA 3RI1A 2XK4A 3VUIA 3OCGA 5CASA 3FKNA 5HE3A 4ZLOA 3FMHA 4O0VA 4IWOA 4CFUA 2OO8X 3F3VA 4F0FA 4YJOA 5DOSA 4UXLA 2PMIA 4FRFA 4AQKA 4UMQA 4M12A 3OCTA 4BDCA 3R1QA 4D2RA 3F66A 3PVUA 4BYJA 3DLSA 4DCEA 4YSMA 4QNYA 3P4KA 4USEA 4BGHA 2F7ZE 2VNWA 4YZBA 4ZTQA 4GK4A 4F99A 1YW2A 3EHAA 4I94A 3V8SA 1M14A 5IEVA 3UOLA 4AU8A 4TPTA 5KZ0A 4BCMA 3Q4CA 2QOQA 4H05A 3FSKA 3Q2MA 4G5PA 2JKMA 2P2IA 5AV2A 2GNGA 4NTSA 4M66A 2DWBA 5J9ZA 3ANRA 1JSTA 2VX0A 4XOYA 1APME 2YLEA 3H9OA 5C8MA 3SDJA 3HAVA 3AT4A 1QPDA 3ZDIA 3HYHA 3D4QA 4NM7A 1OKWA 3PA3A 3R00A 4IFGA 4Y8DA 4KIPA 4XS2A 3KREA 2EWAA 3JY0A 1YXUA 2ETKA 4K6ZA 4YUQA 3GC8A 5LCKA 5DA3A 5K9IA 2YZLA 4ID7A 4L52A 4AUAA 2HW7A 2HK5A 3BE9A 3QU0A 4RSSA 5HO8A 2R3JA 4GT5A 3DPKA 4TYHA 5AA8A 2XIYA 3IW8A 4EOMA 1P4FA 2G2HA 2PE0A 3ALNA 3C13A 4HNIA 4QP8A 4FZFB 5HTCA 1NVQA 4AZVA 4EZ7A 2RFDA 2BR1A 2XJ2A 4GJ3A 3NYNA 3NRMA 4IZAA 4QMXA 3OTUA 5TO8A 3R8ZA 4JQEA 2XUUA 4GS6A 2WU6A 4YP8A 5AP2A 5TT7A 3WYYA 4EOIA 5AR2A 3FLSA 4E1ZA 5HICA 4O38A 2X0PA 4TTHB 5M44A 4II5A 4ITIA 4QYYA 5CAUA 4D4YA 2YA9A 4GT4A 4O86A 4TYIA 5EG3A 3NYXA 4ALUA 4X3FC 3M2WA 3WOWA 3LIJA 2Q0NA 1PXNA 2QU6A 3UC3A 2XM8A 3QALE 5EQYA 1JWHA 4E6AA 5BQ0A 3QTXA 1CKJA 4CZYB 4I5CA 3VS4A 1OGUA 5CEIA 3AMBA 1Q3DA 1JSUA 2O8YA 3EFKA 5EM8A 3RPOA 3RPYA 1YOMA 2W1CA 3CJFA 4KRCA 1Z5MA 4IZ5A 4EONA 2WKMA 5AA9A 2GPHA 2YCQA 3F5UA 4C35A 4RX7A 3GUBA 3FV8A 1OM1A 4K2RA 4XG2A 4U97A 5DI1A 4ZXTA 4Q9ZA 4PRJA 1OPJA 2C6DA 3IECA 2IZUA 5LARA 4O7RA 2B7AA 2OJIA 5DG5A 1PXMA 5J9YA 5KZIA 3IQ7A 3DDQA 3O23A 3ZRLA 3FI2A 2QO9A 5IDPA 2VO0A 5B2MA 1W84A 3MH3A 3BQRA 4GSBA 3VW8A 1IA8A 4G3EA 2IVTA 3T3VA 4KS7A 3KXXA 4ZZMA 5HNIX 3G6GA 1VR2A 1PYXA 3VUTA 4HCUA 4DBXA 3BYOA 5GNKA 1YWVA 3A4PA 4ZZNA 4FTUA 2VO6A 4I0RA 3UOJA 2XF0A 3DTWA 3R1YA 3ZTXA 3ORNA 4F08A 5IU2A 3H0ZA 3NUPA 4TL0A 2OLCA 3UZRA 4LOPA 2UZBA 5AM7A 4ZS4A 4L9IA 3KK9A 3ZO3A 3JVSA 4FKRA 3RPSA 3O8PA 4CEGA 5H8GA 3ZLYA 2YIXA 3GC0A 5HIDA 4D58A 4EZ5A 5F95A 2EXCX 3ZLWA 3MS9A 5L2WA 2W4JA 4XEYA 5DRDA 3D14A 3VQHA 3LLTA 4HVHA 1WCCA 3MVLA 3PSBA 4M69B 4NKAA 5HU3A 2ZDUA 5AP0A 5JGDA 4X0MA 3VUDA 3JYAA 1HCLA 4XV1A 3IKAA 5A3XA 3R8UA 2BUJA 1LPUA 4WT6A 3HAMA 5M51A 2X0GA 4FKQA 4HYSA 2OSCA 1XQZA 3PTGA 2E9OA 4FG9A 2QOHA 1NXKA 5CS6A 3R2YA 5HGIA 3ZEPA 4ACHA 2B9FA 4QTEA 3R30A 3BL9A 1PMVA 4E6CA 3MVHA 4W4VA 3QXOA 4FSZA 4I41A 4QTBA 4D2TA 3OEFX 1YXXA 4IC7A 4CRSA 2WTWA 4XUFA 5AADA 4G34A 3AKLA 3TDVA 5E91A 1CM8A 1M7NA 3OVVA 4YC6A 2GFCA 2ZM3A 3RWQA 1BKXA 4EYJA 2J5EA 4XG6A 4O0TA 4IJPA 3L8SA 3UIUA 4YC3A 3W2CA 3Q53A 2YWVA 2GMXA 2ZFYA 3FQHA 1ZOEA 4GMYA 3VS5A 5LWMA 4XHKB 4BICA 2GS2A 4HJOA 4BHNA 5C4LA 1SNXA 5IQGA 2V22A 3E7OA 3EQFA 4PMSA 2IWIA 5GZAA 2XJ0A 5JGBA 4EBWA 2P3GX 4FL3A 3KVWA 4PPBA 3ZO1A 1ZYJA 5AUVA 4RLKA 4D9TA 3QZFA 3BX5A 3KEXA 3AD4A 1OZ1A 5KCVA 4USDA 3F9NA 4FL2A 4DC2A 5BUIA 2RG6A 3PJ2A 2WMTA 2EXEA 3FXXA 2FYSA 5M06A 2Y4PA 3FY0A 3D7TA 3GQLA 3PG1A 4MD8E 5AP5A 4IWQA 2R3FA 4Y72A 3PLAE 3U9CA 1MRVA 3ZCLA 4FSQA 4FZDB 3HX4A 5CAVA 3UIXA 1DI8A 4FV7A 4O6LA 4BDEA 4BDIA 4LV5A 3PXZA 4AA0A 2BKZA 2XMYA 3FZPA 2UW8A 5TOZA 2IZSA 4H39A 4UYAA 2B1PA 2VAGA 4IVBA 2W4OA 3BYUA 3LXPA 4AOTA 4XV2A 5H2UA 3RPRA 4EOOA 1L3RE 5KMMA 3I1AA 4S33A 3QL8A 3C50A 5EYMA 4CCBA 5EK7A 4FNYA 4IB1A 3NNXA 3NMUF 4FMQA 1FMKA 3UOKA 4LM5A 4FV1A 2Z7LA 2ITUA 3MYGA 2BILB 3LQ5A 4AW1A 2YDIA 4BWKA 3P23A 2VWXA 3ZS5A 4IW0A 4PL3A 1JOWB 3QQKA 2OJGA 4C3PA 4EK6A 4Q5HA 4B8MA 1OPKA 1UVRA 3MFSA 4E6DA 3E8CA 2WU7A 3DAEA 3ZRKA 4ANQA 3R22A 3RBWA 4PWNA 4RJ7A 3VUGA 2E9NA 1G3NA 4H3QA 5HE1A 3D5WA 4AAAA 3D15A 3QA8A 3ZHPC 4CXAA 3EQDA 1NA7A 3U55A 1YDRE 3DFAA 5IG1A 4YPSA 5EM6A 2W1EA 3EQPA 5FBNC 4DFYA 3C51A 4AACA 2UZUE 1ZLTA 3C9WA 5BVWA 3QCSA 3ZU7A 3QGWA 3ZEWA 2G15A 1IEPA 4MNEB 4CVAA 2P0CA 2UVYA 2YM6A 3ZO4A 3OZ6A 4EHGA 2CN5A 2GNFA 5CXZA 5J1WA 1DAWA 5K5XA 2BPMA 2B9HA 4AX8A 4AAYA 3QAME 2QVSE 1SZMA 3NPCA 3Q9YA 4OUCA 3MA3A 4D5KA 4DGNA 1H4LA 2XARA 4DEEA 4F0IA 4O21A 1PMUA 2PVJA 3LJ0A 4FYOA 4MQ2A 3CGFA 4GG7A 4QT1A 4EHZA 4K1BA 3LXKA 2BRGA 5FXSA 3UTOA 3CD8A 3TTJA 4BCQA 3DCVA 1KE5A 4WSQA 3O50A 3U6IA 4L3JA 2QQ7A 4JRVA 4ACGA 2HXQA 2WMWA 1U5RA 4ZOGA 4U43A 5HNBA 2JDTA 4DFZE 3TDWA 2RFEA 1G8SA 3HVCA 1W8CA 3NFFB 3TG1A 3UO6A 4EQCA 4LL5A 4O4EA 2J50A 4FKGA 3D2KA 3QRIA 4QD6A 3DBQA 4IQ6A 3NX8A 1OL2A 3FLWA 3QZHA 3EB0A 4XJ0A 2X81A 5E1SA 5HZNA 2HCKA 3ERKA 4GW8A 1QPEA 4DG3E 1GNGA 5FTQA 4DH8A 3T3UA 1SVHA 3IGOA 3MY1A 4MKCA 3DS6A 4O7LA 3BELA 3MFRA 3WBLA 3SW4A 3WARA 1H0WA 4QMVA 3R7GA 2CGVA 2OU7A 4FKIA 2OXYA 5GIPE 4OBPA 3R7EA 1I44A 4IMYA 4BCNA 4BTKA 2R3MA 4FA2A 2PVLA 3ZO2A 1UU7A 5KE0A 3ZMMA 4EK3A 3N4TA 2UZTA 5C1QB 1JAMA 4AN3A 4OTRA 1ZWSA 2W17A 4I6QA 5CQUA 1UWJA 3BGQA 3EFWA 3RP9A 2CNUA 2W0JA 3CSVA 3ORTA 3QQUA 3FL4A 2ZAZA 3LW0A 3NAYA 4XP3A 1FVVA 2GHGA 3COHA 3FLNC 3R9HA 4E73A 4DBNA 3OW4A 4E5WA 5LMKA 3LFSA 3PRFA 4U44A 1YXTA 4QMLA 3V3VA 2R0IA 3QBNA 5AMNA 4FK6A 4QQCA 2PVKA 2UV2A 5CXHA 3PFQA 4MXAA 3QQHA 2HELA 2VZ6A 2P33A 1V0PA 2LGCA 2WPAA 1VZOA 5KKRB 3D0EA 3UP7A 5AWMA 3TIZA 2YERA 4AXDA 2JFLA 4B99A 2ERKA 4LL0A 5AP6A 3LJ1A 3LE6A 4A7CA 5HORA 4ZTSA 1NY3A 5C8NA 1IRKA 4V0GB 2ITXA 4ACCA 2BHEA 5HO6A 3KXGA 2BCJA 4GU6A 4WUAA 2KULA 5C8KA 3NW7A 3G51A 4E7WA 1ZZ2A 4FV9A 4K77A 3MW1A 2ITVA 4C4EA 4C2VA 3E87A 4BN1A 4Z16A 3QC4A 4KA3A 4G16A 4R3PA 3VJNA 4ZLZA 2X1NA 5M4IA 2ONLA 3A4OX 2X8DA 2XCHA 3PPZA 5E8ZA 3B8QA 4HCTA 4Z9LA 2OH4A 4E8AA 5IKWA 2B54A 4B8LA 3Q2JA 4BY9E 2BRHA 3R28A 3NUYA 2CCIA 3ZLSA 3ACJA 3CY3A 4WNPA 2PTKA 4C37A 1L8TA 4F78A 3HL7A 2JKOA 3QLGA 3FXZA 4ZJVA 1UU3A 4JJRA 4IDTA 3GEQA 3C4WA 4KKHA 1OIRA 3WI6A 5HTBA 3Q52A 1M2QA 1FBNA 3S2PA 1R0PA 4BBEA 4BCFA 1F0QA 2CMWA 3NVMB 3UVQA 3E62A 2HY81 4UZDA 1BMKA 4NIFB 1ZARA 3EJ1A 4PDSA 5BUJA 3POZA 1KE7A 4BIBA 5AIRA 5G1XA 2JAVA 2WB8A 4F9AA 3ORKA 1Q62A 2Z7QA 2QLQA 3ALOA 4M7IA 3COIA 3BLRA 3OHTA 4I1ZA 3W2RA 3EL8A 3MN3A 4AXAA 4YNOA 4QQJA 4DT9A 3TZMA 3W8LA 2PZRA 3SAYA 1JVPP 3COMA 4JDJA 4FKLA 5AP4A 3THBA 4CKRA 5L8JA 4IANA 3BL7A 2JITA 2X9FA 5LVMA 5FXQA 2G2IA 4J8NA 4E4LA 3I79A 2OJ9A 1WFCA 4MWHA 3V04A 3SA0A 2C1AA 1U54A 1ZYLA 4J98A 5D41A 3BYMA 5AX9A 1URWA 2ITTA 4PTEA 3QTSA 3B2TA 3QCXA 4P5QA 4YHFA 4TYEA 2OIQA 4ZTNA 2QU5A 3EL7A 4C3RA 3FAAA 4YGAA 4MHAA 5DEYA 1AQ1A 3MBLA 4QYHA 3DQXA 5HG7A 5BYYA 2VX3A 4D2WA 1H1QA 3LCOA 3CS9A 4OT6A 5CNNA 3LFNA 3E8EA 4U45A 2BAKA 4TZRA 1SVEA 2WQBA 3TNIA 3C5UA 3TZ8A 3KCKA 5BPYA 4QMSA 4FC0A 3R8VA 4D4SA 4EKKA 4FVRA 4KBCA 4RIXB 4YZCA 1Q97A 4BJJB 4AT3A 3CPCA 2YM7A 3NNWA 3R2BA 4PX6A 3ZFXA 3ZM9A 3M11A 2VNYA 1RDQE 4YURA 1AGWA 4O91A 4S30A 3P5JC 3LFBA 5J8IA 2FSLX 1XH5A 3QWJA 3TI1A 4Q5EA 2OF2A 2VTAA 4FV2A 2CLXA 4JBOA 1PXLA 4PQNA 4QTAA 2R9SA 2XK7A 2GS7A 3EQCA 3CC6A 3MH0A 5EYDA 3TN8A 3VQUA 4CCUA 2ZM4A 3HMNA 3QUEA 4A4OA 1PRYA 4APPA 1Y91A 2JGZA 4RQVA 4CSVA 1YI3A 2BTRA 1UNLA 3EWHA 4IWDA 1PXOA 4NM0A 3FC1X 3QRJA 2PY3A 4X6QC 4C62A 2NO3A 4YJQA 4QMTA 4DFXE 5HQ0A 1SVGA 4QP9A 4NYEA 2UW3A 3ODYX 3TNPC 4CKJA 3F7WA 4RA5A 4CMUA 4G3GA 3QFVA 2QCSA 5B0XA 2QG5A 2XK3A 5E8SA 3PJ8A 4G1WA 4L45A 4DEBA 4G6OA 1Y8GA 3HP2A 4DFNA 3EFJA 3KKVA 5FLFA 3BCEA 4O22A 3BU3A 3PXQA 3QQJA 3QD0A 4IZYA 3ZUTA 4D4VA 3NUSA 4KS8A 2W1HA 4QMYA 3PFYA 3SRVB 3L9NA 4HNFA 4QPAA 3ZZEA 2PWLA 4D2PA 3D83A 3IOKA 4EH5A 5A4LA 3NUAA 5I0BA 3E3BX 1V0OA 3I6UA 3UDTA 2QOKA 2YCFA 3F61A 4KNBA 3P1AA 3A8WA 4QP2A 1O6YA 3ZZWA 3SLSA 1U5QA 3RZFA 1NW1A 5T68A 2XNNA 4XG7A 4I6HA 5J9LA 3E88A 2Z60A 2RGPA 4K18A 4HGSA 3KRXA 4C4FA 2BIKB 3SGCA 2PUPA 3JUHA 4C58A 2R3RA 4YZ9A 3VBQA 1JLUE 4OT5A 5KMNA 5IQAA 5AP7A 2FO0A 3TCPA 2HXLA 5M56A 2RG5A 3ZM4A 2VTMA 4FGBA 2RKUA 4FR4A 3QTRA 5AV0A 5K0KA 4IE9A 3R1SA 3REPA 4M69A 2CCHA 2J6MA 4I22A 4ZTHA 2IEWA 3F2RA 5L2QA 4R7BA 5KMKA 4RJ4A 4M0ZA 4ENXA 4AXCA 3S3IA 2GHLA 3BWJA 3SW7A 5FDPA 5JT2A 2X7OA 4EOQA 2AEGA 2UZNA 5KBRA 3K5UA 5FP5A 4G6LA 5ANDA 5AR4A 3V5PA 3WIKA 4RQKA 4AE9A 3C4EA 3K54A 2OF4A 4CTCA 5J1VA 3NIZA 3HA8A 2WOUA 1FVTA 3I4BA 3FZSA 3IOPA 4I5PA 2JLDA 4IM0A 5JGAA 3PSCA 3KIOC 4FNXA 2A98A 5CEMA 2CKOA 4TW9A 4MYGA 4C38A 1H25A 3OROA 2W96B 4RIYA 1KE9A 5CY3A 2XYUA 5EW9A 4N6YA 4EKLA 1Y8YA 3L9LA 2XIXA 2IO6A 3PRIA 4NL0A 2HIWA 1W98A 4AXFA 4DHZA 2YN8A 4BCIA 4CLIA 3FMKA 5IA1A 2B53A 4FT9A 3TZ9A 4GK3A 3L1SA 4O0YA 4F7JA 1FGKA 3NDMA 2VWIA 4A9RA 4FIHA 2WTDA 4EI4A 4EZ3A 4DHFA 3VF9A 1JBPE 3IDCA 4K0YA 3KK8A 4NU1A 4QYGA 4DINA 2R3LA 2XCKA 4N0SA 2OJJA 3DZQA 4S34A 2ITQA 3QQFA 3KULB 4EH7A 1UNHA 4DA5A 1QL6A 3FYJX 3OC1A 4EHVA 2PSQA 4U7ZA 2KTYA 4OTPA 2ZV9A 3AKJA 1H01A 5CF4A 1B39A 2VWVA 3PXFA 4AWIA 4WRGA 2F4JA 5IA3A 5FEEA 5IZFA 4X3JA 2HAKA 3WZJA 4F4PA 4V05A 3E64A 3MTFA 5ANKA 1WAKA 3L9MA 3PG3A 3CP9A 1MRYA 1PW2A 4IB0A 3V5LA 1ZY5A 4TKSA 2W5AA 2F49A 1KUTA 2OKRA 3OTVA 4FG8A 3KN6A 4FKTA 1BUHA 4WSYA 2J0LA 2PZYA 5HLWA 3R7VA 3C0HA 1LR4A 5DGZA 3OXTA 4FEVA 4TYJA 1U59A 5ETCA 2C4GA 4AZFA 3HDMA 4YLJA 4D1XA 3NAXA 3BYSA 4EH8A 5LQFA 3IW4A 4GU9A 3G9NA 3UIBA 1IR3A 3R83A 2IVSA 4ERKA 1OBDA 4YJUA 4GUEA 5DEWA 3AC1A 3UMWA 5A46A 4FIEA 5EDPA 2AUHA 4K8AA 4M13A 4PNIA 4WNOA 4C59A 4CT1A 5HI2A 1ND4A 3MGYA 2VUWA 2JBOA 4IXPA 3RTPA 3WF7A 3PP1A 5B2LA 5T6KA 5HKMA 2X0QA 3SHEA 4YMJA 1UNGA 4X2KA 3ZONA 4Z7GA 3F88A 3NLBA 5DBXA 4FTTA 3GU4A 4GJ2A 2RIOA 5LMKC 3UQFA 2XYNA 4C7TA 3QCYA 4RVTA 3O71A 2V62A 2G1TA 3QXPA 3OXZA 4IH8A 4XG3A 4YNEA 3TKIA 3QWKA 3ZC5A 4W8EA 2BZKB 4ASXA 4DGGA 2Z02A 3Q32A 3QZIA 1K2PA 3KN5A 2H6DA 3WF9A 4FEQA 4D5HA 5GHVA 5JSMA 3MI9A 1AD5A 4UB7A 4QQTA 3MDYA 2VTQA 2QLUA 4YC8A 5L6WL 2UZLA 1KWPA 2R2PA 4HYUA 4OTIA 4UMTA 4DEGA 2SRCA 2W9FB 4O4CA 4EL9A 2CPKE 3GC9A 5AAEA 1OVEA 2Y6MA 4C4IA 3QA0A 5JZJA 4X3FB 2WTCA 4F9YA 1DAYA 4A4XA 3QUPA 4L42A 1HCKA 4J96A 4H58A 4RJ3A 4JNWA 4OTFA 4IIRA 3W0SA 5AEPA 2VN9A 2ONLC 3ZXTA 4NJ3A 3PY1A 4AP7A 3PIZA 2UVXA 2FSTX 3DXNA 4UALA 4XCUA 4O2PA 4D28A 2XAOA 4BB4A 2XRWA 4EOKA 5J95A 3K3JA 2UW4A 1XH6A 4MD7E 5HESA 3MY5A 4X2GA 4FGRA 1YXSA 4CFXA 2QR7A 2J2IB 3V5JA 3ZYAA 3SG9A 2A19B 4UYNA 2YDJA 4X2NA 4Y46A 4CG9A 1YOJA 3PXYA 3LCDA 3P7AA 3U6JA 4R5SA 2HOGA 3F82A 3TWJA 4F7SA 3Q6WA 3MVMA 3A7IA 3O8TA 4EWHA 4DG0E 4AZEA 4XV9A 3O5AA 1ZOGA 4ZY4A 5DPVA 4RFMA 3PDTA 2VTHA 5J79A 2XZSA 3ML1A 3NGAA 3SX9A 4TWPA 3TV7A 2QOBA 5M57A 2VWUA 4NEUA 3W2OA 3IK3A 1O9UA 3BHVA 3OFMA 3QTZA 3TUDA 3ORIA 4W9WA 3WYXA 2YZAA 3K2LA 2BDFA 4KIKB 1SYKA 2C6TA 3TEIA 4CFVA 3ZRMA 5AUUA 1ZXEA 3AT3A 2WTKB 3Q4ZA 5E8UA 3MV5A 5AUXA 2VO3A 3O8UA 1UKIA 1BYGA 5IUHA 4BCHA 4I6BA 2Z2WA 3FEGA 4HYIA 3W2PA 4DTKA 3RAKA 3U51A 4MWIA 4XLIA 2X9EA 3CTHA 4ARKA 2GHMA 4X2JA 4BWPA 3G2FA 5AAFA 4B7TA 2WQNA 4I5HA 4KKEA 5JFVA 4KSQA 4BDHA 4ZIMA 4U9AA 4L43A 4CV8A 3DY7A 4LGHA 3NUNA 3VC4A 5BMSA 1FPUA 3FMJA 3V6SA 3GFEA 3KMWA 2XBAA 1UU8A 3QF9A 4UWYA 3QC9A 1YI4A 1I09A 4ZTRA 4U79A 5CU6A 2OK1A 1XJDA 4ZSAA 4FTOA 1ZRZA 3S1HA 3NS9A 5DRBA 4IDVA 1GZKA 5FD2A 3OWLA 4LV8A 4D1SA 4JR7A 4EJ7A 1FQ1B 4RGJA 1Z57A 4OTHA 3OY1A 2ZV2A 2A1AB 2WHBA 4JAIA 1Y57A 4KBKA 2C68A 3RCDA 2QHMA 3LFEA 4MBJA 2AYPA 5IQDA 3SXFA 2R0UA 5BX0A 3EN6A 3QTIA 4K33A 3PYYA 3R02A 3SOCA 5CYIA 3SV0A 3AD5A 3IDBA 1GJOA 4Z7HA 3P9JA 2C6OA 3Q9XA 3R7YA 2OWBA 3AQVA 1XHAA 4O4DA 3UODA 5H8EA 3VAPA 4E4NA 4DF3A 1PY5A 2C3KA 4IVCA 5M4FA 3OF0A 4IAZA 3QLFA 4E93A 5CZIA 5A4EA 2P4IA 5JFXA 3EKNA 4RMZA 1OL1A 5EW3A 4EQUA 3L8VA 4XBUA 3HV7A 3ZDUA 3GFWA 4AZSA 2O0UA 4TNDA 4Y5HA 3DJ5A 5CENA 3L8XA 4QP6A 2ZMDA 2VTJA 4MTAA 1F3MC 3MB6A 3OD6X 4TYGA 3VS1A 4LGGA 3KF7A 3VBYA 4LV7A 4JDIA 4BDJA 1JKKA 5AR5A 2R3GA 2YIRA 3DNDA 3MSSA 3DBFA 2GQRA 4JLCA 4RG0A 3L9PA 3FPQA 5E8WA 2ZV7A 4ANNA 5AR7A 4EOLA 5LMBA 3BLAA 5D1JA 3DXQA 4F09A 5L4QA 4DTBA 2ITWA 4S32A 1S9JA 4C3FA 3CD3A 5CVGA 4ZSJA 4G9RA 2V5QA 4TT7A 2ZVAA 1OBGA 3U8WA 5HVJA 4QYEA 2GTNA 3D5VA 3GU6A 3GT8A 5AP3A 4LOQA 2WEVA 3FHIA 3HMIA 5D11A 3V5WA 4AZTA 4DGOA 3HMOA 1H26A 3VRZA 4ALWA 2BMCA 3C1XA 4O1OA 3VUHA 4YO4A 1XH8A 4GIHA 4RX8A 3W0OA 4R1VA 3OWKA 4QEBA 5FTGA 3WZEA 3ORLA 2CHLA 2HZ0A 1WBSA 3K5VA 2JEDA 3NZ0A 4RIWA 3PE2A 5HVKA 4YJVA 5AV4A 4QPMA 4FKWA 1P5EA 5K4IA 3AC2A 3HUBA 4W4YA 2BFXA 4RIXA 4TXCA 3HP5A 3NCGA 1TQMA 3H4JA 3OP5A 2WELA 3ZSGA 4YLLA 3Q96A 4ANOA 3QQLA 4H3BA 3OS3A 4IACA 2WIPA 5IUGA 1O6LA 2E2BA 1WMKA 4G3CA 4CZUA 4EH6A 4FTIA 4RA4A 2A4LA 2B0QA 1KOBA 5HCZA 3HZTA 1YKRA 3TUCA 3GU7A 2OG8A 4HOKA 3CGOA 5EQEA 3UP2A 5HNGA 4J99A 5D7VA 3TIYA 2DUVA 4LUDA 3PXRA 5H8BA 3R01A 4I0SA 2WMSA 1WVWA 1GIHA 5I9XA 4WIHA 4OTWA