4EWIA

Crystal structure of the nlrp4 pyrin domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
91
structure length
91
Chain Sequence
FFSDFGLMWYLEELKKEEFRKFKEHLKQMTLQLELKQIPWTEVKKASREELANLLIKHYEEQQAWNITLRIFQKMDRKDLCMKVMRERTGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analysis of the NLRP4 Pyrin Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, protein binding
molecule keywords NACHT, LRR and PYD domains-containing protein 4
total genus 35
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02758 PYRIN PAAD/DAPIN/Pyrin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 4ewiA00
4M9XA 1CWWA 2M5VA 2A5YB 2N80A 2LWEA 2D96A 4IZ5E 1ICHA 2VGQA 3J6JA 2YVIA 4NQKA 4EWIA 3YGSP 1WMGA 2BBRA 2N7ZA 3J63A 1PN5A 3LQRA 4F42A 4UZ0A 4F44A 3CRDA 4JQWA 2MB9A 2YQFA 2BBZA 2GF5A 3MOPA 2F1SA 4LWDA 2O71A 2OF5H 1UCPA 3KATA 1Z6TA 4ZBWA 4RHWE 4JUPA 2N83A 2DBGA 2P1HA 2MS8A 1N3KA 4O9LA 1FADA 2MS7A 1C15A 3EZQA 4DWNA 1D2ZB 2OF5A 1CY5A 4E9MA 2HM2Q 3T6PA 2IB1A 1A1ZA 4FH0A 1A1WA 3EZQB 3YGSC 4O9FA 2N97A 2B1WA 2KM6A 1NGRA 2YGSA 4A2QA 4N1KA 4I16A 3CL3A 2YU0A 4P4HI 4M9ZA 4P4HA 2L9MA 2LS7A 1D2ZA 1DGNA 2LWDA 2DO9A 2MN4A 4N1LA 2NSNA 3MOPG 2N1FA 2DBHA 4RHWA 1YGOA 2DBDA 4IZ7B 1WH4A 1E3YA 1DDFA 4QOBA 2N00A 3QF2A 4O7QA 1E41A 3MOPK 2NAQA 3LQQA 4M9SA 4O6XA 2DBFA 4A2WA 2NZ7A 2L6AA 2G7RA 2MPCA 2KN6A 4IZAB 4N1JA 2A9IA 1WXPA 4D8OA
chains in the Genus database with same CATH superfamily
4M9XA 1CWWA 2M5VA 2A5YB 2N80A 2LWEA 2D96A 4IZ5E 1ICHA 2VGQA 3J6JA 2YVIA 4NQKA 4EWIA 3YGSP 1WMGA 2BBRA 2N7ZA 3J63A 1PN5A 3LQRA 4F42A 4UZ0A 4F44A 3CRDA 4JQWA 2MB9A 2YQFA 2BBZA 2GF5A 3MOPA 2F1SA 4LWDA 2O71A 2OF5H 1UCPA 3KATA 1Z6TA 4ZBWA 4RHWE 4JUPA 2N83A 2DBGA 2P1HA 2MS8A 1N3KA 4O9LA 1FADA 2MS7A 1C15A 3EZQA 4DWNA 1D2ZB 2OF5A 1CY5A 4E9MA 2HM2Q 3T6PA 2IB1A 1A1ZA 4FH0A 1A1WA 3EZQB 3YGSC 4O9FA 2N97A 2B1WA 2KM6A 2XV9A 1NGRA 2YGSA 4A2QA 4N1KA 4I16A 3CL3A 2YU0A 4P4HI 4M9ZA 4P4HA 2L9MA 2LS7A 1D2ZA 1DGNA 2LWDA 2DO9A 2MN4A 4N1LA 2MJMA 2NSNA 3MOPG 2N1FA 2DBHA 4RHWA 1YGOA 2DBDA 4IZ7B 1WH4A 1E3YA 1DDFA 4QOBA 2N00A 3QF2A 4O7QA 1E41A 3MOPK 2NAQA 3LQQA 4M9SA 4O6XA 2DBFA 4A2WA 2NZ7A 2L6AA 2G7RA 2MPCA 2KN6A 4IZAB 4N1JA 2A9IA 1WXPA 4D8OA
chains in the Genus database with same CATH topology
4M9XA 1CWWA 2M5VA 2A5YB 2N80A 2LWEA 2D96A 4IZ5E 1ICHA 2VGQA 3J6JA 2YVIA 4NQKA 4EWIA 3YGSP 1WMGA 2BBRA 2N7ZA 3J63A 1PN5A 3LQRA 4F42A 4UZ0A 4F44A 3CRDA 4JQWA 2MB9A 2YQFA 2BBZA 2GF5A 3MOPA 2F1SA 4LWDA 2O71A 2OF5H 1UCPA 3KATA 1Z6TA 4ZBWA 4RHWE 4JUPA 2N83A 2DBGA 2P1HA 2MS8A 1N3KA 4O9LA 1FADA 2MS7A 1C15A 3EZQA 4DWNA 1D2ZB 2OF5A 1CY5A 4E9MA 2HM2Q 3T6PA 2IB1A 1A1ZA 4FH0A 1A1WA 3EZQB 3YGSC 4O9FA 2N97A 2B1WA 2KM6A 2XV9A 1NGRA 2YGSA 4A2QA 4N1KA 4I16A 3CL3A 2YU0A 4P4HI 4M9ZA 4P4HA 2L9MA 2LS7A 1D2ZA 1DGNA 2LWDA 2DO9A 2MN4A 4N1LA 2MJMA 2NSNA 3MOPG 2N1FA 2DBHA 4RHWA 1YGOA 2DBDA 4IZ7B 1WH4A 1E3YA 1DDFA 4QOBA 2N00A 3QF2A 4O7QA 1E41A 3MOPK 2NAQA 3LQQA 4M9SA 4O6XA 2DBFA 4A2WA 2NZ7A 2L6AA 2G7RA 2MPCA 2KN6A 4IZAB 4N1JA 2A9IA 1WXPA 4D8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M9X A;  1CWW A;  2M5V A;  2A5Y B;  2N80 A;  2LWE A;  2D96 A;  4IZ5 E;  1ICH A;  2VGQ A;  3J6J A;  2YVI A;  4NQK A;  4EWI A;  3YGS P;  1WMG A;  2BBR A;  2N7Z A;  3J63 A;  1PN5 A;  3LQR A;  4F42 A;  4UZ0 A;  4F44 A;  3CRD A;  4JQW A;  2MB9 A;  2YQF A;  2BBZ A;  2GF5 A;  3MOP A;  2F1S A;  4LWD A;  2O71 A;  2OF5 H;  1UCP A;  3KAT A;  1Z6T A;  4ZBW A;  4RHW E;  4JUP A;  2N83 A;  2DBG A;  2P1H A;  2MS8 A;  1N3K A;  4O9L A;  1FAD A;  2MS7 A;  1C15 A;  3EZQ A;  4DWN A;  1D2Z B;  2OF5 A;  1CY5 A;  4E9M A;  2HM2 Q;  3T6P A;  2IB1 A;  1A1Z A;  4FH0 A;  1A1W A;  3EZQ B;  3YGS C;  4O9F A;  2N97 A;  2B1W A;  2KM6 A;  1NGR A;  2YGS A;  4A2Q A;  4N1K A;  4I16 A;  3CL3 A;  2YU0 A;  4P4H I;  4M9Z A;  4P4H A;  2L9M A;  2LS7 A;  1D2Z A;  1DGN A;  2LWD A;  2DO9 A;  2MN4 A;  4N1L A;  2NSN A;  3MOP G;  2N1F A;  2DBH A;  4RHW A;  1YGO A;  2DBD A;  4IZ7 B;  1WH4 A;  1E3Y A;  1DDF A;  4QOB A;  2N00 A;  3QF2 A;  4O7Q A;  1E41 A;  3MOP K;  2NAQ A;  3LQQ A;  4M9S A;  4O6X A;  2DBF A;  4A2W A;  2NZ7 A;  2L6A A;  2G7R A;  2MPC A;  2KN6 A;  4IZA B;  4N1J A;  2A9I A;  1WXP A;  4D8O A; 
#chains in the Genus database with same CATH topology
 4M9X A;  1CWW A;  2M5V A;  2A5Y B;  2N80 A;  2LWE A;  2D96 A;  4IZ5 E;  1ICH A;  2VGQ A;  3J6J A;  2YVI A;  4NQK A;  4EWI A;  3YGS P;  1WMG A;  2BBR A;  2N7Z A;  3J63 A;  1PN5 A;  3LQR A;  4F42 A;  4UZ0 A;  4F44 A;  3CRD A;  4JQW A;  2MB9 A;  2YQF A;  2BBZ A;  2GF5 A;  3MOP A;  2F1S A;  4LWD A;  2O71 A;  2OF5 H;  1UCP A;  3KAT A;  1Z6T A;  4ZBW A;  4RHW E;  4JUP A;  2N83 A;  2DBG A;  2P1H A;  2MS8 A;  1N3K A;  4O9L A;  1FAD A;  2MS7 A;  1C15 A;  3EZQ A;  4DWN A;  1D2Z B;  2OF5 A;  1CY5 A;  4E9M A;  2HM2 Q;  3T6P A;  2IB1 A;  1A1Z A;  4FH0 A;  1A1W A;  3EZQ B;  3YGS C;  4O9F A;  2N97 A;  2B1W A;  2KM6 A;  2XV9 A;  1NGR A;  2YGS A;  4A2Q A;  4N1K A;  4I16 A;  3CL3 A;  2YU0 A;  4P4H I;  4M9Z A;  4P4H A;  2L9M A;  2LS7 A;  1D2Z A;  1DGN A;  2LWD A;  2DO9 A;  2MN4 A;  4N1L A;  2MJM A;  2NSN A;  3MOP G;  2N1F A;  2DBH A;  4RHW A;  1YGO A;  2DBD A;  4IZ7 B;  1WH4 A;  1E3Y A;  1DDF A;  4QOB A;  2N00 A;  3QF2 A;  4O7Q A;  1E41 A;  3MOP K;  2NAQ A;  3LQQ A;  4M9S A;  4O6X A;  2DBF A;  4A2W A;  2NZ7 A;  2L6A A;  2G7R A;  2MPC A;  2KN6 A;  4IZA B;  4N1J A;  2A9I A;  1WXP A;  4D8O A; 
#chains in the Genus database with same CATH homology
 4M9X A;  1CWW A;  2M5V A;  2A5Y B;  2N80 A;  2LWE A;  2D96 A;  4IZ5 E;  1ICH A;  2VGQ A;  3J6J A;  2YVI A;  4NQK A;  4EWI A;  3YGS P;  1WMG A;  2BBR A;  2N7Z A;  3J63 A;  1PN5 A;  3LQR A;  4F42 A;  4UZ0 A;  4F44 A;  3CRD A;  4JQW A;  2MB9 A;  2YQF A;  2BBZ A;  2GF5 A;  3MOP A;  2F1S A;  4LWD A;  2O71 A;  2OF5 H;  1UCP A;  3KAT A;  1Z6T A;  4ZBW A;  4RHW E;  4JUP A;  2N83 A;  2DBG A;  2P1H A;  2MS8 A;  1N3K A;  4O9L A;  1FAD A;  2MS7 A;  1C15 A;  3EZQ A;  4DWN A;  1D2Z B;  2OF5 A;  1CY5 A;  4E9M A;  2HM2 Q;  3T6P A;  2IB1 A;  1A1Z A;  4FH0 A;  1A1W A;  3EZQ B;  3YGS C;  4O9F A;  2N97 A;  2B1W A;  2KM6 A;  2XV9 A;  1NGR A;  2YGS A;  4A2Q A;  4N1K A;  4I16 A;  3CL3 A;  2YU0 A;  4P4H I;  4M9Z A;  4P4H A;  2L9M A;  2LS7 A;  1D2Z A;  1DGN A;  2LWD A;  2DO9 A;  2MN4 A;  4N1L A;  2MJM A;  2NSN A;  3MOP G;  2N1F A;  2DBH A;  4RHW A;  1YGO A;  2DBD A;  4IZ7 B;  1WH4 A;  1E3Y A;  1DDF A;  4QOB A;  2N00 A;  3QF2 A;  4O7Q A;  1E41 A;  3MOP K;  2NAQ A;  3LQQ A;  4M9S A;  4O6X A;  2DBF A;  4A2W A;  2NZ7 A;  2L6A A;  2G7R A;  2MPC A;  2KN6 A;  4IZA B;  4N1J A;  2A9I A;  1WXP A;  4D8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...