4EWLA

Crystal structure of mshb with glycerol and acetate bound in the active site
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
299
structure length
299
Chain Sequence
MSETPRLLFVHAHPDDESLSNGATIAHYTSRGAQVHVVTCTLGEEGEVIGDRWAQLTADHADQLGGYRIGELTAALRALGVSAPIYLGGAGRWRDSGMAGTDQRSQRRFVDADPRQTVGALVAIIRELRPHVVVTYDPNGGYGHPDHVHTHTVTTAAVAAAGVGSGTADHPGDPWTVPKFYWTVLGLSALISGARALVPDDLRPEWVLPRADEIAFGYSDDGIDAVVEADEQARAAKVAALAAHATQVVVGPTGRAAALSNNLALPILADEHYVLAGGSAGARDERGWETDLLAGLGFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new crystal form of MshB from Mycobacterium tuberculosis with glycerol and acetate in the active site suggests the catalytic mechanism.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside
total genus 101
structure length 299
sequence length 299
chains with identical sequence B
ec nomenclature ec 3.5.1.103: N-acetyl-1-D-myo-inositol-2-amino-2-deoxy-alpha-D-glucopyranoside
pdb deposition date 2012-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 4ewlA00
1Q7TA 3WL3A 1Q74A 5B2EA 5CGZA 4XM0A 3DFMA 3DFKA 5B2FA 4EWLA 2X9LA 4XLZA 4XM2A 3WL4A 2XADA 4XM1A 5BMOA 3WE7A 3DFIA 3DFFA 2IXDA 1UANA
chains in the Genus database with same CATH superfamily
1DBVO 4ATNA 1QIKA 1N8KA 3FG9A 3PHGA 1SC1A 3LP6A 3FSJX 2CMFA 1RRMA 4H1TA 4UM8B 5IAAA 1R16A 3GMDA 1XCMA 1O9BA 2SICE 1WG8A 2J30A 1I24A 4AG3A 3SJUA 1QHXA 4UARA 1M8GA 4IGEA 9ATCA 4HFMA 4GP7A 4KRGA 3FZGA 4IGFA 4E5NA 2VK8A 1MOZA 3H84A 2ZIXB 2ZSKA 1LRLA 2H48A 3FUWA 4AO7A 3PENA 2X2OA 1NOKA 3EF0A 1SCKA 1U02A 2GZAA 1G5RA 1SU8A 4RELA 3ZHSA 1SKQA 1R8SA 2FE1A 3EXIA 4JYCA 1TCAA 3CYFA 4Q0MA 4F84A 1FJHA 2C2HA 2FSVA 5DHQA 3OPNA 1IPEA 4H3VA 1C29B 1NBIA 2CVFA 3BF7A 3VV3A 4XWWA 1JB9A 4FYIA 4CR6A 1QTIA 3RYIA 5I01A 1E92A 4WK0B 2WAMA 4DMCA 2F62A 4LSZA 2WJAA 1MV8A 3WMFA 5AKJA 3DE7X 3MJ4A 1CDOA 2WZDA 3WBBA 3RARA 1TE2A 2CVZA 1E8NA 3E5HA 4I81A 1P1KA 1O6CA 2Q21A 1PNTA 2CNWD 1EA5A 3G2MA 2BGUA 4JBHA 4UEKA 4YNBA 3NBUA 1JNYA 3IOYA 3GFOA 2GZDA 3BJEA 3F7MA 1RRGA 2W42A 1KJZA 4NTZA 3ZQUA 4EB3A 1CR6A 2QM7A 1I9CA 4HRAA 1SZDA 3PQCA 3WKCA 3WQBA 4EL5A 2HBRA 3IIJA 1E1CB 2C3MA 1PR9A 3WXMA 4KRFA 3TFQA 3CWZA 1FFEA 2ZAIA 3LT1A 5H59A 3FW1A 2DQSA 2QV0A 4U2GA 3E18A 4KQEA 1PDOA 2ZE5A 4IXMA 2GSDA 1HE1C 1SB9A 3LK6A 4W1PA 3TVDA 4KLAA 2BFEB 1L6IA 2O7RA 2W2NA 3QKUA 2GHRA 3BXZA 1REQB 4B6EA 2QTWB 2Q6IA 3RH0A 4ENUA 2GJAA 5JRZA 1VKJA 1P1CA 1PR1A 2WTUA 1N92A 4O4LB 3C6KA 2Q3HA 3U39A 1JHVA 4L5BA 2Q2WA 4UDYX 2PV7A 1KA9H 2YYZA 1KMQA 2H11A 2AFVA 4R9UC 4RVSA 3ZJTA 2H08A 5CVCA 4HSEA 5KNCH 1ZWLA 4HAIA 3IOMA 4QFMA 1DBPA 4LF9B 3I2FA 2WLSA 3F4LA 4MUIA 4YQZA 4A7PA 1NLZA 2DX7A 1U8UA 1M74A 3UY4A 3INTA 4D44A 4DMKA 4H1HA 2OO3A 4TL9A 3T3OA 2J09A 4XCVA 2AEJA 3LP8A 2A3NA 1WVGA 2IBMA 4IDFA 1G20B 4E5UA 3E8MA 2BFOA 5LP6C 1GAXA 3ESAA 2P91A 3G79A 3UK0A 1T6NA 3LAWA 3HBMA 1VYHA 3TOCA 2IQ5A 3FYCA 2QIOA 3OM8A 4LX0A 5GWXA 2ZUEA 1DCFA 4QLBA 2IPMA 3CW2A 4DSZA 1DEXA 1PEYA 2XYGA 4BQIA 3SYMA 4HATA 1SCAA 3ZOZA 4BKRA 4LHSA 3BRSA 4RQTA 2MR5A 3WHPA 4U6SA 4X64B 3I73A 1E9CA 5LQNA 5TIIA 1UQUA 1ADCA 3GFBA 4F38A 3U56A 2DBRA 3F4BA 3NPAA 4LPKA 1PL6A 4E5KA 1XZQA 2JLRA 5DT9A 4RJ2A 2WD9A 2Q9BA 2ZP1A 2HX1A 4JC5A 3AOEA 4N40A 1KDVA 3VMFA 4CCYB 1C30B 2ZRCA 3W77A 5K0JA 1M8FA 3C7AA 1NDQA 1F6WA 1KS2A 2V65A 3SFZA 1DRKA 3B3GA 1DWUA 1L4LA 4RO0A 3T4XA 4LCEA 5BO5A 2WOOA 1DGQA 4HAXA 2CDNA 4B0OA 3NHYA 3B1KA 5HK8A 1O54A 4HEJA 2C9MA 5KTPA 1EVYA 1NVGA 1J24A 4P82A 4G1BA 4PWZA 1PKEA 3T7IA 4YRFA 1S89A 1SVSA 1QHHA 1QFMA 4EAQA 2ZB8A 4OLAA 1EU1A 1Q7BA 2H63A 1YI1A 2ILTA 3CONA 3DXYA 5ALSA 4F92B 1WOMA 3NBKA 4MARA 1S2GA 4CLHA 3ZIAD 2XIJA 4RVOA 2GTHA 1Z12A 4UUBA 3AV0B 5EJ7A 2AJTA 4NX2A 5ALTA 2EV9A 3SIXA 2HIGA 3VTKA 1D2CA 4LEIA 2PU5A 3P0IA 3PF9A 4ZVRA 2Z8ZA 1NVMB 1RI3A 2MJLA 4MICA 1H6AA 3T52A 3I6ZA 1MC5A 2WM2A 2WSMA 3CLTD 4MQEB 4RH1A 2HA0A 2QE7A 3UK2A 3N0TA 3OP4A 4WZBE 3DBLB 3ZVRA 1JFRA 1YOVA 2IF0A 4DM7A 1M2JA 2XBUA 2GN4A 4LJLA 4Z8XA 2B36A 2ZI3A 3UJ8A 2NYUA 3TOSA 3BFKA 1POWA 2XYPA 4OJQA 4C0KA 4URZR 3NMUF 4JB8A 1FNCA 3DT6A 1LTQA 4GZMA 3VI3B 4WJLA 5AW8A 4D4JA 5KMGB 5CT5A 5EA2A 1PNRA 4ITVA 4J0CA 1GPUA 4U2KA 1LZLA 2WAXA 3STHA 3DQPA 4DR7B 1GPDG 3KB8A 1QHNA 4D8WA 3ERCA 1WSDA 2EHDA 3HBLA 1SXJE 1GNQA 1H2ZA 4OU5A 4UFOA 3WNVA 1GTG1 4YAFA 4J1TA 1JILA 1KO1A 1N9GB 4XD2A 4UTNA 2P4HX 4FBGA 2QPAA 3PJDA 2WZCA 5KVCA 3MTBA 4E5YA 4JI3B 2ZTUA 3I34X 1EX6A 1C7RA 1TAQA 4RJLA 2PCJA 1A4UA 5H68A 5MFPA 3HCNA 2Y8EA 4XWYA 4WHMA 2QN6A 2QT9A 4KG7A 1RI1A 1KJIA 2IEYA 3BEOA 3KQTA 5IUKC 2NZYA 3CLTC 4DLUA 5EXXA 1NDHA 1ZS9A 1ZN7A 1SK9A 4EI8A 1OVMA 3GLTA 4BZWA 1A8QA 4HWOA 3UNXA 2ANCA 3UQYS 3SZMA 5JU6A 5AM3A 2VPIA 2WWXA 3GLKA 2B98A 4RMHA 3U5TA 1HSZA 3W6NA 4ADSG 2VHVA 2ILVA 3MMNA 3OLYA 1J9ZA 2O06A 2I9KA 3RU9A 4MKXA 1QDLB 3PC8C 4ARAA 3ZV5A 3ORSA 4HZIA 3DPSA 2FR8A 4JQSA 3H2HA 1WZ2A 4A8HA 1DRVA 3CUYA 3VZSA 4FB5A 5ALVA 2GASA 3RVKA 4LHXA 1Y6ZA 4BLWA 1H42A 2C4UA 1UKZA 1NG9A 1VRCA 1DJOA 2XADA 4R1SA 3SP1A 3M6UA 4TLEA 2RJ3A 3P2MA 3MILA 1KVRA 5IKMA 1IEXA 2PUBA 2IP4A 5CDGA 2DLDA 4MWCA 1GAQA 4LBYA 1CF4A 4C3ZA 5EHZA 2V54A 5GZ3A 3FSGA 2PH7A 1HT0A 3SQLA 4DY6A 3NTXA 4FCWA 4HGYA 4PHGA 4TTPA 4B8WA 1WU8A 1WZNA 7GPBA 2I4RA 2RKBA 4P4UA 2I4IA 4LGMA 3RG2A 2QIPA 4MEBA 4RETA 3AX6A 4G2NA 3R76A 5CCBA 5JMPA 3SNKA 3OIGA 4WD3A 1HLPA 5C51B 3JSXA 3L1HA 3N76A 2NOAA 4GMFA 4I55A 4J4BA 5CNKA 2P0AA 2B4YA 2P78A 5IJ9B 4CUKA 1R27A 4MLPA 1UJCA 1KPHA 1ECCA 4Z9XA 4QUGA 4ZTUB 1Z3CA 4UXHA 4FMDB 3D31A 4Q1BA 4XQGA 2Z2ZA 3M6XA 4KFTA 2CV0A 5CLIA 2PUVA 1K5DA 4QRIA 3G2NA 2QI9F 2X6RA 3LQYA 3TN7A 4PAOA 4F1KA 5KHAA 3KQKA 4AKTA 4TQAA 1BD4A 5DYIA 3WLIA 2FB9A 4KX5A 3W6ZA 3VAAA 3PC6A 3EBPA 3LWZA 1C3JA 1Q1AA 2EKZA 3PK0A 4HS9A 4C4AA 2PLRA 1U0NA 2XNJA 1QCZA 1GCIA 4WFQA 3ML1A 1IEWA 2SKDA 4YJFA 3HK2A 5B58C 3PR3A 1FSPA 5JUWA 3QX9A 4IGIA 5ES4B 1LFAA 5FWNA 3PKJA 4LZJA 5G4KB 1GQRA 3ZXIA 4PWYA 4J0DA 4KXYA 4V1CB 4AY2A 5ELXA 4Q00A 5KTMA 1Y1KE 5KTYA 4JLJA 4UUPA 1KIFA 1D4FA 2B1RA 2XQKA 1X7HA 4I9GA 4L9RA 2NM0A 1OSNA 4QBHA 1ODKA 3KXKA 4MNTA 4RSHA 2I22A 3PDWA 5EUCA 2WU4A 4YR9A 2NUPB 3PT5A 3OPYB 5AUOB 2YQ5A 3GHHA 2E1RA 4QKQA 1X1QA 1HFWA 4G0YA 4PLCA 4C6TB 2NP6A 1AQJA 3V00A 4C0HA 3GT3A 3HXMA 1G8KA 5TQ0B 3UMVA 2OZKA 3RTBA 3C7TA 2ZCUA 2PS3A 1KBOA 2VHWA 3V46A 1G21B 4TOIA 4WNYA 3SQDA 1XAHA 5H4HA 1TA4A 1IUPA 2PKQP 2ZUSA 3B36A 1E1DA 3AKEA 2ACEA 2DERA 1T6YA 1P0QA 2C20A 1MQ8B 1X1TA 4K26A 2V7EA 3GT0A 4Q03A 4C4RA 5CUQA 4F06A 1IE3A 3RTEA 5BSGA 2CLLB 5CA0B 2HADA 4FNGA 4WBSA 2VDRB 3AZPA 3WP1B 3BDVA 2JRCA 3RSSA 2OBXA 2BKUA 2C5EA 1RC0A 2XV1A 3GJRA 4RV9A 4FE7A 4L0MA 3KHSA 2NU9A 1CY6A 4W9MC 2SCUA 1NXSA 1F2UA 5FH9A 2H7VA 2YC2C 5A2GA 3OQNA 4DIKA 2I99A 5DX1A 5HCNA 1L5KA 4YRAA 3W4JA 4PX3A 2PSEA 4DHWA 3EEOA 4I0WB 1CIJA 3HUTA 2B8JA 3K35A 5T4FA 3IP5A 3VC2A 4BEVA 2Q0QA 3DZHA 4MV9A 5KYWB 2WJJA 1SK8A 3A3OA 4X94A 1MJHA 2AZXA 2ZAGA 1Y9DA 4KHZA 4WSOA 1HFEL 4QOGA 3ASVA 4DV4B 3C98A 2BMVA 4CFZA 1GZ4A 4WOBA 1ML4A 1E94E 1Z6XA 4GI7A 4OYRA 3VTZA 3W2GA 2QTMA 1PZNA 2NT4A 2C0QA 3IIMA 4ALNA 4B6GA 5JH7B 5EJGA 1QVWA 2PVCA 1OAKA 2YWRA 3PTLA 3CBGA 1M2OB 4ZGBA 4R1TA 4M9QA 1M7GA 3WS7A 4M6WA 4O2BF 3ZQKA 3V4FA 4JJ4A 4KWCA 3L2OB 1ISFA 3PC7A 1U2RA 2INGX 3CPJB 3E6AA 4D9BA 2PRJA 3HKDB 5AM5A 4DNXA 4NENA 3VSCA 2ZI9A 2JIZD 1CP3A 3TTTA 1CUUA 5COBA 4ZCTA 2ZCVA 4L73A 3PXBA 1FC0A 2R44A 5DJ5A 3NGMA 9GPBA 2ZJFA 3PC2A 3TPZA 3RTAA 2EJWA 2GHIA 3QLUC 3ESQA 3O9VA 1JU3A 1CY8A 4NU5A 4B83A 1ANKA 3THOA 4PBSA 4B6SA 3IUMA 4JI7B 3STTA 5DXFA 1S1CA 5L9AA 5BP7A 4KB5A 4EDHA 1SCDA 3L4EA 4F3RA 3HO8A 4PN3A 4JOQA 3ZNQA 1THMA 1SXJA 3ZWPA 1BXGA 3FPFA 1U2GC 4Z9YA 3G13A 2AV6A 3WRWA 3K9FC 5F9HA 4HX5A 2G63A 1JQLB 3IERA 3E53A 4EDFA 5FL3A 4N1AA 3K0FB 2FN9A 5C18A 1K92A 2R00C 1JAIA 3FCOA 3H3JA 4OX9Y 4LWPA 2QPTA 2VQFB 4HYTA 1FFBA 1CFZA 1M8JA 3LLCA 3TI9A 1OLUA 1PWZA 1PFKA 1N75A 3ZY2A 3RUHA 4QD3A 4H3SA 2F00A 3E03A 1KEWA 1GPNA 3O6VA 2QYTA 3S44A 2ODPA 4MR8A 2UVPA 3H99A 4KTVE 5AHWA 1CYEA 3WGNA 3TQIA 1JH8A 2DBYA 4DAEA 2A1UB 2KWIA 1YUNA 2ZFUA 3LO5A 5TS2A 3KOYA 4J29A 4B44A 4Z54A 1ZI8A 3L8FA 3D2CA 3PX2A 1X13A 3QPVA 1D8TA 3PPXA 3BA6A 2DFLA 3O2QB 1RMYA 1ESMA 2R97A 3S5JA 2QF7A 4NPCA 3KVVA 1SIBE 2PRIA 1Y8QA 2ONKA 1GZ5A 2W0MA 3H75A 4WFKA 5LLSA 1ZSVA 2RCNA 3BBLA 4MWSA 3MJFA 5E9WA 3GJ8A 5F51A 4MB0A 1PYOA 1EHIA 2X0FA 5KTOA 1T0JB 2IYNA 4PU0A 4G1MB 5DWQA 2R11A 3RK4A 5BWMA 2EEPA 4KR2A 4YJDA 1U1DA 3P7MA 1ESCA 4HEHA 4KI7A 1XV5A 5AI9A 2GBLC 2VHCA 3GZNA 2VI5A 4KSBA 1IQRA 1E3EA 1WPGA 2RFLA 3VR5A 2SCUB 5BQXA 3X1WA 1Q0TA 1XYYA 2BEWA 2VPZA 4HDMA 3K8YA 1ZISA 1IOLA 1KP2A 1M76A 1U6JA 2NUTB 1M2FA 5DO9A 4S1NA 2ORVA 4Y6QA 4BNNA 5HFJA 4UHDA 4J0EA 4V0QA 4X61A 4DQVA 3NDIA 4KL8S 5IZCA 5J9FA 3Q85A 5JANA 2AR9A 5IVHA 1DQYA 2ENWA 4C2AA 1RYFA 1P1HA 5ENVA 3B1XA 5E6RA 1I4OA 2B4QA 2P79A 4FSXA 2VOEA 3UIEA 1ZHHA 3MNFA 4LJ6A 4V0ME 3UKOA 1G1MA 5BUZA 3IAEA 3HEBA 1UANA 1ZVJA 3FUXA 4LN1A 1N8NA 5LIPA 4D8UA 1GR1A 3OJEA 4XFDA 5JAPA 3BZWA 1C4XA 2YC4C 1JHOA 4OGLA 3FNIA 3ZHVA 1S1MA 2ZRPA 3HHPA 4XI9A 2C97A 1ATIA 1XTJA 3A2LA 3K16A 5EG5A 2PJRA 1M34A 1TB4A 3TSWA 1DC7A 3LW8A 3KJGA 4QLAA 4N39A 1P0CA 4X92A 4BQEA 3BWDD 1KYZA 4DGSA 5HGXA 1S2MA 3I9V1 2C4NA 2P77A 2Y76A 2Q07A 3KZKA 3U7GA 1W36B 4Y6SA 1R0XA 1Y8AA 3ZQ4A 3H5IA 4LRYA 4RAQA 2CMKA 1XVVA 4F85A 5HR5A 2E5LB 2H1OA 1FQOA 1J1ZA 4MKRA 3EEFA 1G20E 5I7RA 4PZ0A 2HV8A 2Z1MA 1T34A 1RWOA 4YR7A 2IZ5A 4HAYA 5FNZA 1N7HA 4GLLA 3RROA 1CB0A 1DKPA 1UJBA 3OFSA 1Z0IA 2G77B 4CMIA 3F2VA 1C2TA 4JEUA 1FTGA 4B31A 3A9WA 4DT1B 2EBHX 4KQGA 1XNJA 5BUCA 1PHPA 2VAMA 2ZI6A 1ZM3A 3EBOA 5HBGA 4B6FA 4ZIRA 3IV7A 4KPFC 3SI7A 3W0LB 5IVKA 3DJFA 3H2BA 3L93A 4KX3A 1LV8A 1YQDA 2NYRA 3B7PA 4M1WA 4ODIA 5KNBD 1K6JA 4FHZA 5DGCA 5J1TB 2QDKA 2NAPA 1D1QA 1DBRA 1EJBA 4ZI2A 2XMCA 2QUHA 1T9KA 2GPJA 3NIFB 3OLXA 4WY8A 3EZFA 2ZSDA 1OLUB 2ZPAA 4J3JA 2ZJBA 2WJ3A 5IC5A 2VK1A 4IXTA 4ZI5A 3UHOA 1ID8A 3AZOA 1L5NA 2I33A 3PQ8A 3QELA 1ONOA 5JZVA 2R68A 1CZUA 3OUZA 3MCTA 2OFXA 3BGVA 3O47A 4ZU6X 4KVAA 1R6TA 1L4MA 1B7GO 2YUTA 1XTSA 1L4UA 1W8IA 2ECFA 2IHYA 2BSAA 1W581 3LNTA 3Q3CA 4OBEA 3DP9A 4ZWNA 4NCIA 4KAAA 3M5PA 5CGZA 4W5HA 1IJEA 4PG4A 3WR5A 3CPSA 3JATB 4Z7QB 2Q6KA 2IZ6A 1SKYE 4CG3A 2PZJA 3QPUA 5JAIA 1USKA 1YVEI 3WRYC 3IBTA 3SG0A 1KGSA 2ASEA 2QMZA 4RQAA 2H16A 5FB3A 1GQSA 3X44A 3EX7C 2Q1YA 2ACKA 3VKWA 3ND7A 2NSDA 2ONJA 4RTJA 3DWEX 2Z5VA 2VOJA 4N3NA 2EOAA 5EZYF 2F1JA 1U98A 2IXFA 3HM2A 1H66A 1UMBB 4IUCS 4OXQA 4KHPB 2GKOA 4D8VA 1LWNA 2FN4A 2IPOA 1ZD8A 2JCXA 1TPYA 3Q7SA 1OI3A 2I7XA 1QUFA 4OHFA 3FTCA 4BCCA 3T1HB 1SVIA 3B70A 4RPLA 1MQ9A 2WSSD 2AIRA 4ECAA 4D4HA 3LA8A 3VPGA 1YA8A 4S1TA 4XB1A 3B6KA 4I5IA 4LMPA 1HRDA 4C06A 1UEIA 1QMGA 1SQFA 2ARKA 2V5VA 2V0GA 4EJ2A 1EGAA 3SIWA 4KYUA 1H5UA 1QHGA 3P5BA 3HVRA 5A5VA 3F6PA 3GGOA 2EW2A 4B6RA 1ACLA 2F1IA 4E22A 4ZYUA 4TMYA 1KYVA 1FS6A 3K32A 3NW9A 4DEVA 2I3AA 4EUEA 2DPLA 4C3VA 5J43A 2FGJA 3WQQA 5FL7D 2I0FA 2XNSA 3PWZA 1C80A 3KSRA 3QU7A 3L7KA 3QOFA 4FGUA 4BNUA 2N3ZA 2FUEA 3PS9A 2CLHB 4R3NA 3PU6A 4DNFA 1ISIA 1WP4A 1ZKDA 2C8VA 2JD2A 4HB4A 4Q21A 3WA7A 5F9FA 2QXTA 4MA0A 1OX6A 3C7KA 1FUIA 3VPAA 1E5DA 1U0TA 2JBWA 3FWYA 4JX8A 3EIQA 2PLNA 3GJ6A 4LJ9A 1Z4PX 4WEQA 2YY6A 4LXUA 3O8QA 5TEWA 3RF7A 4BLOA 1XZMA 2SECE 2CEKA 2GPWA 4WY5A 3LPMA 2R6R1 5EIHA 5CEEA 3A7EA 1Z5OA 4Z4FA 1TEVA 4GBED 1N2IA 1BHSA 4H35A 5BYBA 5KNBH 1CUYA 4EM6A 2XMQA 3OJXA 1SG9A 3GGPA 3K09C 2B69A 2D13A 3T99A 1B0UA 2GDJA 4UFPA 3NTOA 1GCGA 4Q93A 5COQA 4Y2UA 3TUIC 1XLWA 2DFVA 1JHRA 1FRQA 2B0CA 4B4UA 2BGNA 4CMIB 2JFWA 3IEKA 3X1JA 2HSWA 4R1MA 3UA4A 4P7KA 3WBJA 1ZU5A 1Y6GA 3I9FA 2F1KA 4JNKA 1MAUA 2GGSA 1XJ5A 1ULBA 2IEDA 3D7NA 2HBYA 2OWDA 1KMHA 4QGFA 2ZYVX 3IBSA 4O6VA 1I36A 2P6OA 2RB5A 3K9WA 1DELA 3AFNA 3JD1A 4PLFA 4TSKA 1WDWB 4GLBA 5H5JA 3LUAA 1YWGO 4CMAA 4TKZA 3VR4H 4DA8A 5LYJB 4MP8A 3MINA 1C7JA 4ZEWA 1Z6YA 2CNOA 4C2BA 3WFZA 4BNYA 1C9NA 1JF8A 2QRNA 4E1AA 1Y5MA 3TXYA 2PWZA 2IF2A 3QELB 4Z4EA 1AB6A 3ILXA 3QNMA 3FCYA 3S2EA 5M2QA 1G8AA 2XZPA 3R6WA 2P5SA 1Z4KA 2OTCA 2V7GA 4DUGA 4N76A 5JBQA 1T6XA 2XTNA 3BDIA 2O2ZA 4EYQA 1UBUS 1KQOA 3LTEA 2XT9A 2QX8A 4CL3A 4JAVC 4JP2A 2FWRA 2VT6A 4L57A 5BV7A 4ZU1X 2IE0A 2QRVB 2C2OA 1J21A 2V0CA 4KE6A 4NOJA 5TT1A 4RFLA 1N0UA 5BY2A 2YY7A 3HY3A 5DASA 3WQSB 4EA6A 3KUKA 2R6GA 2CCKA 1EFUA 1FYWA 5FTWA 3VX3A 4YDQA 1JEQB 3LBAA 5GM2A 1VLLA 2YBDA 3FHCB 4IHAA 1FU4A 3QXGA 4IIJB 2W9XA 4QQKA 4RF2A 2YOHA 5FOTA 1KO7A 1KY3A 4F2PA 1CEXA 2B5OA 2AC4A 3L43A 4OL0A 4QDUA 1OYYA 3VVMA 4BFXA 2JEYA 2JASA 5I6DA 1IN5A 5FPYA 1E9FA 3V3KA 5K8LA 2KM1A 3ZZ1A 1VHDA 1N2ZA 1AQUA 5EMMA 2XEXA 3P45A 3QPBA 1ETUA 1QO7A 1W0JD 1ZHFA 3CIOA 2WP8J 3M8KA 4I19A 4HVLA 2A3RA 4HUQB 5BN3A 1E5LA 3ID6C 5J2UA 1P1IA 1T29A 1Y9JA 3KAQA 2FFJA 2YOFA 2XH8A 4ZCMA 2REBA 1P6XA 2PXXA 4JLBA 2ZTLA 1P2FA 1QPBA 5LQJA 4AJLA 4INAA 4ZHSA 1EUZA 1NXVA 5FTLA 4MUXA 1Z74A 1ZK0A 3HADA 4YONB 4R1UA 5IABA 1NQWA 1P4GA 4FYMA 3PRJA 5FPTA 3VJRA 3ZXUB 5D01A 4H2DA 3HNPA 4KQIA 4I3HA 4H0NA 1SAYA 1NUQA 3CX6A 2KI5A 3DO6A 3K92A 4WVLA 4UU1A 1NKTA 1XSEA 2AF3C 1ZNYA 1X0XA 4LNAA 2W6ZA 3T9FA 2H3EA 3LY9A 1R1DA 4QBIA 1CF9A 1FVFA 1WXQA 3IAM6 2X0NA 3NAQA 2Q7DA 4CKEB 3ZDCA 5CP8A 3A0UA 4M37A 1AUPA 1G6Q1 1HYBA 1NSFA 4HLNA 5DK4A 3NOVA 3RJ9A 2GCEA 5CVJA 5HZHA 4AWAA 5FOSA 1MOSA 4NDNE 5LUAA 4UD2A 2A5DA 4Y6GB 4PGHA 1GKUB 2GXQA 2VLBA 1SVOA 4ZAWA 3VJMA 4DR6B 2WE7A 1J2EA 1P80A 4TX1A 3S40A 1XELA 3C3JA 4DXAA 3HY4A 2AWNA 1SOAA 4CV3A 2BEUB 1GUBA 2WM9B 2A8YA 4QHTA 2ACVA 4G8DA 2ZBEA 1PKXA 4L2IA 1THGA 1XCOA 3X2SA 1ZOLA 4INJA 3SN6A 5KNCA 1G5TA 3M4XA 1ORIA 1OBOA 3ONWA 3WVNA 4EPWA 5JZBA 5G0TA 3T7AA 2BFCA 1DV1A 1X6VA 2BBOA 2QU7A 2R8EA 2VFAA 3ZCQA 1O2DA 3LKDA 2PZEA 3E5NA 2DCMA 3EVCA 3LX6A 5AYVA 5J2TF 9LDBA 2FZWA 2H06A 5THQA 2D5IA 4QARA 4NJMA 1JBQA 4JP5A 4NI5A 1YB4A 1IXYA 3OD1A 2GO1A 5AXCA 4W1QA 2NX2A 1J06A 3WIBA 2AKAB 2BW0A 3DMTA 1E3SA 4JXJA 3ITDA 4I8XA 2FW1A 1TM7E 4XDZA 4EEKA 1G9SA 1YJQA 2RGUA 2PZFA 3AHDA 4N7MA 3LQ1A 2KB0A 4ZO8A 2WUVA 5FEUA 1TI7A 4CJXA 2GZ2A 1XEXB 1SIUA 1TU3A 3V8NA 3HEAA 3P0RA 4M46A 5JVDF 4YCSA 2EYUA 4BGUA 1H1TA 3QUQA 2PSFA 3C3BA 4KNYA 4HL6A 1YZGA 1U0FA 2BHLA 3DEAA 2D7DA 4TM8A 6AT1A 5D8DA 4B32A 2XCTB 3WGQA 4OLFA 1GITA 3I32A 3B3JA 1LX7A 4B3BA 1MKYA 3DMDA 5AVJA 5LA6A 2QA5A 3W3ZB 1G64A 2GTPA 4EW1A 3WNDA 2JHCA 5LMCA 3RS5A 1MRZA 1VB5A 4JLUA 4HHEA 2ZYSA 3A37A 1JR4A 3T15A 2WYIA 3WGLA 3G0HA 4D9CA 1SHZA 3N8GA 3DHNA 3G5UA 4PBTA 3KOXA 4WNAB 3HBJA 2M98A 5SY6A 5BORA 2X8JA 2ZIAA 3NC4A 2YVUA 3QBDA 3VAZA 3ZDBA 1VJRA 3NEJA 2EGUA 3DS8A 3HZRA 2VYFA 3N6RA 3OFKA 4ALLA 2ZW9A 5K51A 3EXHC 2XW6A 2QQFA 2QN9A 1BXZA 4CNBA 2P0EA 2Z9BA 4BHTA 4B48A 2XMDA 3RD5A 3K9GA 3WK8A 4OMFG 5DHUA 1S0UA 3ZDXB 3W04A 4F3CA 4Y98A 3R9XB 2NU7B 3D2BA 3CLUD 1TKAA 3FMFA 2Z08A 4PGGA 1NY6A 3D6UA 1NI5A 4RDIA 4D02A 5GZ1A 4B9AA 2NVUB 4D9FA 1D1PA 4UPVA 5IT0A 2V4MA 4J90A 1HR0B 3W5AA 4NVRA 3KSUA 3PQDA 4X54A 1MV5A 4KGDA 1F2DA 2HMAA 5T57A 3U3JA 5LXTF 3F6EX 1OC2A 4RD2A 1JLHA 3KG2A 1HZJA 1NF9A 2WJVA 4OFZA 4B8YA 421PA 4X95A 3IC5A 1R74A 3ZGVA 3GLHA 4DYHA 5KX5A 2ZWAA 1JEYA 1TEHA 1KEUA 1PX2A 5BRJA 2ZI7A 3WTCA 2VHEA 1ML3A 3OCJA 4C0BA 1FEZA 1AS3A 3AOGA 3HU5A 5DN9A 4X63A 1EFRA 1W6UA 4FYXA 4AMVA 3GMIA 1U0OC 3HDGA 4M0UA 1T3LA 2X0IA 3OTGA 2ZWPA 4LXYA 4D41A 5C5DA 3FDFA 2LCQA 1C5KA 3DKKA 4CE6A 4HZUB 3KR0A 3QKSB 1DJNA 3GLRA 1GJRA 3P9CA 4N3CA 1KYWA 2Q4DA 1AE1A 5E9QA 2DTEA 1ND6A 2OZVA 4PW0A 5C31A 1XJQA 3A6LA 1XF9A 4I6GA 3FTPA 3L8EA 2H9YA 3RYFB 2Q1TA 3LRPA 2Q50A 3NALA 4FT4A 3I05A 4LTNA 1OFTA 2AFIE 2HA2A 3V32A 3IQDB 2G3YA 1ZD4A 1EIWA 4MK4A 5JCPA 3AY6A 4I36A 3UB4A 3PE3A 4TLBA 4Z9AA 2QK4A 3RRYA 1NXTA 3HJTA 4BLUA 2BEVA 2VP6A 4F5ZA 2AOTB 1U9IA 1ZWKA 2E4AA 2VZ8A 4M7PA 2JG3A 2CXUA 3EEYA 3UQZA 2XUQA 3PD7A 3UAYA 3T3GA 4DLLA 2ZJ7A 3MJRA 3CLSD 4X71A 1VCOA 3ZDFA 4C4SA 5KWVA 4D26A 1K5HA 2EBUA 3H8VA 1W30A 2K7ZA 4RXMA 4AUKA 2WDZA 1W1IA 3B1FA 2PSDA 3DEIA 2DP4E 1Y8QB 2X14A 2AEEA 3C3CA 3GZJA 4KGVA 5JYCA 1GSHA 3GNSA 3ER8A 1WPRA 3UAGA 1R4AA 2Q28A 4AJ4A 5C8YF 4CKXA 8ATCA 1AKUA 4ER3A 4CF7A 3LOQA 4BV2A 2O7VA 4PLWA 3BIWA 2LE0A 4NATA 4PZLA 3CZRA 3I0NA 3OMXA 1IY9A 3VFDA 5A3RA 4MZXA 1QHYA 1RW4A 1XXHE 2G71A 2VN8A 1PT9A 4MW4A 4MGHA 3V7FA 4EUKA 5A02A 2AEMA 2NZVG 5ER9A 1NBMA 2PZAA 4X3CA 1PFVA 2GEUA 4HEQA 4HXGA 3W8FA 1ADYA 4IVNA 2G5PA 5U1PA 1RMTA 3K5IA 2FPWA 2QRQA 1BWRA 1QBKC 3FKSA 3AM3A 5ALNA 3ZU4A 1ADGA 3EC2A 2JIZA 4EELA 1GEGA 3NBZC 3ZHYA 5F2KA 3MJCA 3DMFA 3DD5A 1X1RA 2QAGC 2A0KA 2YZKA 5CLGA 5JCXA 2G67A 5E1MA 1KGDA 1CX9B 5HS6A 4DDMA 3TE6A 5ARDA 3H83A 4QPZA 2BFFB 2IE8A 3C5WP 3KDSE 2GWHA 4JELA 5I9SA 5DM60 1AKTA 1DOZA 1VKOA 3AR4A 1IC6A 3AYXB 3ZD8A 1L8AA 2ZYTX 3D8NA 4LYFA 1E2HA 4AJ2A 1KI8A 1Q11A 3AUUA 4MUGA 2PMCA 3GIWA 3VC3A 3TG8A 2HW8A 4ZVLA 1T1SA 1KH1A 2VQSA 2XA2A 5HGJA 1B43A 3VSEA 4WBNF 5EAIA 1M2KA 3O38A 1SVWA 1WW2A 2W37A 3HNOA 4GPAA 2R1VA 1KI9A 3PI7A 4YT5A 5DHTA 4CMKA 1AF7A 1YDWA 1DB3A 1KVSA 2YV1A 3CY6A 2GPAA 3KB1A 3KB2A 3KJHA 1OXBB 1C3VA 1Y7LA 3QLVC 2H1FA 4MW1A 4B0PA 5GJWC 4XD7A 4I14A 3AONB 4R81A 2F8LA 2GHTA 5EZYA 3ZCUA 1Q57A 3EZ7A 3N2EA 4XKJA 4D98A 4ZV7A 3OZEA 3IUPA 4I4TF 4X7BA 3DV0B 4HXFB 1MO2A 4ZYWA 2ZU6A 2MSWA 2H7CA 2JGJA 3OTHA 3PGA1 1V37A 2CLIB 4K81B 3HQ4O 1Z0UA 1I8TA 2ZR9A 4PPQA 4B87A 4C4OA 5AT1A 1SXJC 1RRFA 1LB1B 1GZSA 3UXEA 1G8PA 1SHUX 2DHQA 2W6CX 4MIKA 3RUDA 2FX2A 3N6VA 2FFBA 1JVNA 4MV6A 4RJKA 4RK6A 3QXSA 2YNMA 2PS0A 4IKOA 3WGIA 4FIZA 4YRKA 1J8DA 3D6FA 4MR7B 4LDPA 1LDBA 2NO0A 3SM9A 5BUSA 2J59A 3D4OA 3VKUA 2I1QA 1OXVA 1XZGA 5IWAB 3JQEA 1USUA 1PJCA 1VI6A 2QQ0A 2Y93A 2WTNA 3JV7A 4KN8A 1B73A 1DRUA 4J0JA 3X2EA 3VNUA 2OC4A 3ZKAA 3IP8A 2ZLBA 3Q9NA 1XWIA 5JCOA 3SXJA 3A6DA 5J1SB 4CQNA 3A05A 1YKGA 1Y4AE 2ZYDA 3D6HA 2X2PA 5BV2P 3KFLA 3B78A 2HIAA 3MSCA 5LUBA 3UOGA 5CXUA 3KQLA 2XVYA 1UBJS 1CQXA 1F1BA 4CEJA 3N0XA 4K6OA 1BJKA 4XQ0A 5L3RA 1J00A 1JZTA 4ZZIA 4D45A 2HDWA 3NAZA 3ND8A 2IGBA 3SJAA 1XZ8A 3NBQA 4M2LA 3TX6A 3GLUA 4WWHA 1EDDA 1HQCA 1E0SA 4NCNA 1HZZC 3GGDA 5EESA 4TV9F 3LMKA 1QH1B 3K4QA 4LI0A 5BSTA 3SM3A 3KZVA 1A5BB 4PV7A 1ZNXA 1FQJA 4DV3B 2V3CC 1CJBA 4NH4A 3OLVA 4BASA 2OBYA 3RV4A 2CWDA 1IY1A 1JMKC 4FXOA 1U5CA 4G1UC 3RVSA 5BW5A 2LW7A 1R0KA 5BYJA 2N46A 4OA5A 3LIIA 1MC8A 5CTAA 3QUBA 4GI1A 4JXXA 4O3MA 4INZA 3UMFA 1Z5WA 2ZYWX 2G4CA 4YXWD 1TQ4A 2DQZA 1U9ZA 2OG2A 3SX2A 3JRWA 4BQNA 4I4NA 3GF4A 5ALWA 1ZVQA 2JIQA 3GH3A 3INRA 3ZTYA 1AHNA 1BRTA 1O9GA 1VKZA 1SCNE 2QE6A 2EWMA 4ZZ0A 1ZI6A 4O4LA 2FLKA 5TY0A 2C54A 1MB0A 1WDMA 3AIIA 1CY0A 2UVQA 4P36A 2AQHA 4CKWB 2R00A 3DFKA 4ZMRA 3DAHA 4US2R 2HJHA 1BA2A 5MHTA 4D3DA 1F4LA 5GV7A 4G8JA 1LF5A 3U62A 4LPSA 1AKWA 1ENZA 1XPJA 1P31A 4R31A 1WZIA 3R7WA 4L5IA 4WN9B 5AIAA 3T3EA 3F7TA 4YTEA 1CUBA 1E9DA 3I3SR 1FYFA 1VXOA 2MMGA 2E82A 4LE1A 1NHWA 3VC1A 3DG9A 2IYOA 3CFYA 4JUFA 5HIAA 1QQ7A 1UBTS 1G4HA 3COYA 3D4NA 1GGFA 4GPIB 4IDDA 4TL7A 4OSEA 4L9WA 3BL8A 4YJ2A 1IPHA 3T3PB 4DMUB 4KOEC 4HQFA 1KBQA 3WADA 3SAJA 3R24A 1CXZA 4QYIA 4DRYA 1AMOA 1DUIA 5DHRA 2BKVA 1E6UA 3DLTA 5FV7A 5JAUA 1T36A 4ZYLA 3DTNA 1XEWY 1NHGA 4TYWA 2F48A 1JVSA 1SD1A 1T5IA 2VCHA 4GSLA 2IDKA 1QHIA 3ROXA 5HJ7A 1Q92A 3JQAB 5FNVA 1U7TA 1B0AA 3DEYX 3VYWA 3U16A 1KYIA 3R0XA 4ARBA 4P81A 8GPBA 4AT1A 5IYZA 4YC7A 3PFBA 1JLLB 3B7GA 2JLAA 4CKCA 3V1KA 1E64A 4QJ5A 3CNHA 3REOA 3V9PA 4YT8A 1BMQA 3V7WA 4C1BA 4G0VA 5C5IA 1R9MA 2X7XA 1YZVA 1K7CA 3HDQA 4QDXA 2HPHA 3TTWA 1JT9A 3KXLA 3B6JA 3MINB 3OOSA 1X7ZA 3K72B 2KJQA 5D6OA 2X0EA 1GR0A 2W7TA 4CUJA 1UM9A 3HHEA 1E7RA 2P65A 2EZ4A 1SQ5A 3ANTA 3IV6A 3K0EA 4Q4LA 4R5MA 1B1AA 1UP7A 4DYVA 3V4ZA 3ZKWA 1S02A 5JQGB 2V74B 3TSAA 4FBMA 1KAEA 1CF2O 3CLKA 2JDIA 1Z35A 3BE5A 4RHXA 1YUMA 1XQXA 1RAIA 4YUVA 1SA0A 3P2IA 1FMTA 1Z8HA 1H3EA 3ASUA 1TD9A 4RPCA 7AT1A 1C2YA 1UPXA 3ESCA 3K09A 4TT8A 3GHYA 4UD6A 3HXOA 4CEJB 2V0NA 1ZJJA 2I34A 2G0TA 3VHQA 7REQB 2PJZA 1KEEB 4WXMA 4MMXB 1UDXA 3USCS 3U1VA 1BW9B 2GBPA 4LOHA 4N82A 4NDZA 5LZ4A 3TLMA 3HGQA 2FF5A 4M1YA 1NX9A 4PO1A 3ZR4B 2WJHA 4HGOA 4Q4CA 4Y1RB 1T0PA 1U1EA 4E6PA 3A1UA 2D5LA 2PD4A 3G0GA 5K3CA 4DLXA 1K8YB 4NE9A 1JEDA 3RWMB 3B60A 3RANA 4JKYA 4DVJA 2YS6A 1BEUB 4TS3A 3W3AD 4JBLA 4IEFB 3RKRA 1JIQA 2RGNC 3GDGA 3O91A 4GQIA 5IW8A 1HETA 2YWEA 3UGTA 2PG3A 1F0KA 5LR6A 5SY9A 4BB6A 2PPVA 3MMXA 1KMCA 1BVYF 2EKLA 2ZJOA 3VHLB 5BSUA 3HCPA 2CVPA 3W3AA 2ORWA 1QTNA 2ANBA 2XBLA 2Y27A 4YFVA 4MVWA 4DC0A 4YRIA 2WIKA 5CFPA 1TZJA 3HKCB 4WLUA 4FFWA 2GETA 4F72A 4TTJA 5DSZA 3UHAA 1JXAA 4BKUA 1P8JA 1G19A 2QLNA 4I5DA 2Z95A 2HHJA 1QCDA 5JFGA 2FUG1 2AG5A 2CNKA 3GBPA 1WF3A 6REQB 1GXSB 3D6AA 3RUEA 1EQAA 4LE2A 4P33A 4GP6A 3EQ8A 4RHTA 2QV7A 3H86A 2F3QA 2A6PA 3LFTA 1GHTA 1I6MA 4MQFB 2ADFA 3FZQA 1YK0A 4BE4A 4BUCA 3KYCB 2BFBA 1IY8A 1PJLA 2F43A 2FMFA 3VNVA 1SG0A 3EDRA 1ZNZA 3R3HA 2XQFA 4QRHA 4CIXA 2RKOA 1QLJA 3NBYC 3I9LA 4MQLA 3ZCSA 2PMEA 4EYOA 4YV0A 4MCAA 1FDOA 4KLNA 1Q1NA 4CDNA 3WLMA 2ZXUA 3TZQA 1INLA 1XROA 2UYHA 1J0DA 4RADA 4C0SA 2FXVA 1RLIA 4FU0A 1GTMA 2FJUA 2JZOA 3KWJA 4O4LF 1EMDA 1N2XA 2QTVB 3PWTA 4PVCA 2FPLA 4HGPA 1YJCA 1VKNA 4IEEA 4KACA 3RC8A 3P20A 3ONEA 3IAUA 3IT2A 1BS2A 3CX7A 4HPXB 2X5JO 5I7HA 4CQLA 3S55A 3PF8A 2PA3A 4YUAA 2V3VA 2OSBA 1R18A 4LGYA 2O1SA 2DPGA 3HEMA 3C7CB 1Z0SA 1QF7A 1ZR2A 3QU5A 3HR7A 3MQFA 3PUYA 5JS8A 1AHHA 2WWGA 3OCXA 3BBPA 2WI8A 2SBTA 3DB1A 1C3OB 4ZCSA 4TMTA 2JJMA 1XPOA 1YQQA 3W2EA 5MN6A 3ZEAA 2GN2A 2QRLA 1C9KA 1XTIA 3FR7A 2YFYA 4MS1B 4Q05A 4UPDA 4Q4JB 3IT3A 1NE2A 4RD4A 5FYDA 3SF8A 2IDMA 2PYDA 3QU2A 2C5FA 4LYDA 3U61B 4IWXA 2CHUA 2GF2A 2AG6A 3VUEA 3GPLA 3I58A 4S04A 1L5GB 4EY4A 4PPFA 1WF6A 3B89A 1NDUA 4H08A 3WYNA 5IDWA 4ON9A 4JVNA 3RS7A 1SOMA 3HSKA 3ACBA 1Z6GA 2BWJA 5THXA 3SHQA 3VR1A 3A4MA 3STYA 2GN0A 4MKIA 4PQEA 1RJ9A 2LXNA 2O2DA 3PQ7A 2QUBA 2FUG6 3WK5A 1XTTA 2C61A 4Z6KA 3JVEA 2CNWA 1AZTA 4A10A 2JFGA 2GFHA 5HIJA 4B2PA 1RI4A 5F7ZA 3GAZA 2D7CA 5CYGA 2Y66A 4MSUA 3RRZA 1GNTA 1TF5A 5JMTA 4RAOA 3B1ZA 1UAYA 2QPLA 3GFVA 5BT9A 2ZRKA 5NLLA 4I50B 4OTZA 2E4YA 4RCZA 1QPZA 4BJ1A 4MV0A 4ND2A 3ZS8A 2ASVA 4I46A 4AO6A 1ICIA 1U7DA 2WSIA 4GD3Q 1PW7A 2ZS8A 1RTKA 4S1VA 5TXGA 3FBWA 1PG2A 3SZ3A 1W93A 3MYRA 1DWQA 1QE0A 4LWOA 2Y9MB 2PRSA 2RK4A 4OQLA 4JVMA 1U28C 3G1WA 3EPHA 1XTZA 1KS9A 3IPXA 4NWIA 4GXNA 4ARZA 4BMPB 2F7SA 1G21A 5B58T 4UCWA 5TF4A 3WGOA 4C03A 3K1ZA 1P2TA 1UXGA 2WU1A 3L6OO 4OQYA 4CIVA 1M66A 3PA6A 5DYTA 2EC5A 4JJ7A 4AROA 1C0KA 1SKMA 3JALB 2G1KA 4FMCB 3L07A 2C7OA 5AK3A 2PNFA 2UYGA 1NI3A 3MPUA 4KQ6A 2W2XA 5JNLA 3E9YA 4JITA 2D2XA 1E5TA 1Z8NA 3ORHA 5KNCD 1F20A 2L82A 4XRRA 3UVEA 3C85A 1YQUA 3F9IA 4DNQA 3IMGA 3VR5D 4F6CA 4NOKA 4TN1A 1EK2A 2QNRA 4G1FA 3K2BA 2PX6A 3DMNA 2A5YB 3F3SA 1Z7YA 3EGXA 3JY6A 2Z6QA 1LBSA 5DISB 2QUIA 1T5OA 4D42A 3PT9A 4OBWA 1HTTA 4PC6A 2P7HA 3K5WA 4UM7A 2IU4A 1WTCA 4WZ6A 4BBPA 2FMTA 3SBOA 4BO6A 3RCBA 4X60A 2R6AA 3PDIA 3QKSA 1P72A 2QZZA 1DBWA 4YT2A 2JAHA 2FNAA 4AQYB 2HXSA 3D3NA 1D3AA 4HDSA 2BFFA 1VL2A 1JQEA 1NN3A 2ZOSA 4XX0A 4UHFA 2F6RA 2W2LA 3OIDA 3AOEC 4NYJR 4PRKA 5KVQA 1KU6A 3BCSA 3H5WA 1GGEA 1CW2B 3QHPA 4C6HA 2QYSA 3KAJA 5JXHA 3I2KA 1Z28A 4MV5A 1MVLA 4QBKA 4QT0A 4WASA 3V7UA 3PQ4A 3D0RA 1FBTA 4ITUA 1U04A 1EXVA 3WYCA 2PT5A 4F9GA 4LXXA 5D51S 4GYYA 1UKCA 5FAKA 3L05A 3V9AA 1M72A 1VSUA 1EP3B 4K9NA 4EB0A 4HNVA 1FMLA 1RWNA 5FWDA 4DIEA 4B7XA 1A69A 4C78A 1U7WA 4JLWA 1HDGO 4KXLA 3BB4A 2MINA 1JPUA 1V9LA 5DWDA 4A92A 1V1MB 1U2SA 1PQWA 4NYMQ 4Z51A 3NXKA 1G59A 1TM1E 3KKMA 4WERA 2DWOA 2LCFA 1ZLXA 3MAGA 4QU0A 1U2DA 4LGVA 4EVRA 3AQ4A 4QBGB 3U6KA 1ZK4A 3EVDA 4NJOA 3I2IA 3GRFA 2OWEA 5TC4A 3LVQE 4RZHA 2JLBA 4CCYA 2KS6A 4J6FA 4U0JA 3LQ2A 5F35A 2X0DA 1AURA 1ODTC 3H6GA 4YV2A 5IUJC 3AR7A 5DNUA 5H16A 3GLGE 5FUYA 5EWMA 4F5WA 4MTLA 3TYXA 3KU1A 3HYSA 1ZFNA 2AN1A 1LI7A 1MPTA 2JFXA 3SJBA 4MKZA 3THWB 1IYZA 1GADO 4IAOA 4GEGA 1UODA 3O2JA 3E9CA 1JXMA 3IPCA 2FVXA 3Q7RA 4H4EA 3JYHA 1QKKA 2X2FA 2C5HA 1ZL0A 3CLSC 3WWZA 5EY5B 2XT6A 1CK4A 3E7FA 4G56A 3RRFA 3ZVLA 2DY1A 2OAEA 4BMNA 2FJPA 1VJDA 2VT2A 3QLEA 4EENA 3GPDG 1I33A 3WLPA 3GFPA 4BECA 3CJRA 5ALJA 1GOTA 1NR5A 3EZYA 4HY3A 1ZRHA 2VA9A 4MX8A 4K3UA 1JBEA 5KC8A 5JSZB 3DEHA 5JTUA 3OCUA 5JJ5A 4YRPA 1HTWA 3PR2B 1LA2A 3TL6A 4PANA 4F8JA 3R8CA 4M0CA 2VTVA 2OCAA 4HDNB 4OH7A 3HWSA 3ANXA 4WKCA 3PQFA 2CWWA 3ZJYA 5JWHA 3K31A 4NYIQ 1DKUA 2IZOA 1L9KA 4HWTA 6NULA 3V80A 4A5OA 1Y3HA 5INTA 4ESOA 3S2SA 4QSMA 2R1VB 4P3OA 5EGNA 1NN5A 3DKRA 4MJLA 3JU3A 1WM1A 5A1TA 2QB5A 3UYLA 2BMAA 2HHCA 3Q11A 4KE7A 4M8LA 1O57A 3TIIA 4X66B 4L5JA 2GFQA 3NHAA 2Q3FA 4BO2A 4DIUA 1M10A 2QQEA 1F7VA 3VO1A 4YV7A 1AGNA 3E27A 2X1VA 4FOLA 2Q6OA 4BZXA 4QJBA 2ZZNA 2QG4A 2V1XA 2VG8A 4BBAA 4DCTA 3AVTA 4DBLE 1WB6A 1YS2X 2AYZA 3L02A 4FM9A 3FTDA 4ZEVA 3WG9A 1ZCJA 2IS6A 3GG2A 4U7PB 3DAOA 2RI1A 1CB7A 3BWVA 2P3QA 1RPZA 2VS1A 3QXJA 3PNYA 2ZB7A 2C2ZA 3O93A 2HLNA 4JOCA 4O5AA 2H4FA 2OKCA 2QAGA 1CKEA 4G41A 3CNOA 3ZQJA 1XZFA 2E55A 4B8ZA 1X1AA 3TKLA 1TNDA 2WSYB 3C3WA 2R6JA 3FLMA 1IBCA 3QFHA 1T1JA 1BE8A 1KY5A 4LK3A 5FBHA 5TEVA 3WYBA 5TS3A 5KJCA 3C87A 4Z3OA 2PKXA 2WWRA 5AQEA 1QG0A 1CEYA 3LIPA 3GIDA 2BMWA 2NU7A 3GDWA 1WWKA 4J0QA 3VX4A 5C1PA 1C1DA 3KLOA 3QFCA 3RS4A 4D74A 4ETIA 3OZFA 2GNPA 4DEYA 2OHVA 3EZ2A 4B2IA 1YB2A 2W11A 2RAVA 4GS5A 5T5QA 4EY6A 5K9ZA 3RRXA 3U4GA 5DNCA 4OFBA 4XASA 4IH1A 1GGNA 2H3HA 3DDOA 4HB3A 4OXNA 1K75A 1GUDA 1VRWA 4QVGA 4C5CA 3ED1A 3FOBA 3DVRX 2Y67A 5CR9A 4GMXA 4S1PA 2WT4A 2P62A 4POAA 1Y3AA 3LBIA 4KPUB 5FTMA 1FLAA 5P21A 3SMQA 3U09A 5IM4F 3L7DA 3LHDA 3JZIA 3JAWB 3HB5X 4UBOA 1QVRA 1FFSA 1JEOA 8MHTA 1PJAA 1HDOA 4EGJA 1T26A 4PIPA 3EGIA 4F8EA 1ABEA 4UULA 2HWXA 1NJ1A 4FK8A 5DYYA 3D3WB 2AXQA 4IW3B 1Q50A 2HRCA 5B1HA 3TNFA 3KQQA 1S2LA 4QXPA 4RIEA 5DRYA 2IV3A 3CWQA 5FBLB 4R1OA 4D92A 1EVLA 5CFOA 5KU7A 1AGYA 3GRZA 2YV4A 1RYZA 4CM9D 3P9QA 1RCTE 3IA7A 4EI9A 1SD5A 5G4KA 3URKA 3I09A 5KTSA 1YV9A 1SUFA 1Z68A 3FDZA 4B3DA 3WLHA 1JAZA 3B8HA 3RAFC 5K0NA 4Y30A 4JJIA 1MABB 2QRPA 5D1NA 2ETVA 5ECYA 4XWAA 2VHYA 1JA0A 1HBJA 4WECA 5TMDA 4X6YA 2Y0BA 3UENA 3LO8A 4ERXA 3LKVA 4GZ6A 3G5LA 1USVA 2VSQA 3WRXA 3KSMA 4HP8A 5EIBD 1FVHA 5BSMA 4ALKA 3ZWAA 1BGXT 3HXLA 2BFPA 2BRUC 3DQQA 4U2EA 2HT1A 4FOOA 3ICWA 3NVMB 4FOTA 5KUTA 4FS8A 1BKSB 3ONNA 2WB4A 2FY8A 4RNDB 3I1YA 3IR7A 1VBFA 3JQDA 1Q6YA 4FNAA 5FWYB 5IAGA 2C8LA 1KSJA 3A2NA 4R51A 2GK6A 3B9QA 2CBZA 8ADHA 5GVSA 3ZNPA 2JGEA 2Z8XA 1GAWA 5CH5A 3IKVA 4JY7A 1TQ2A 3S1AA 5I7VA 2YHBA 1JE1A 4A3SA 1Z5PA 1XNHA 4O2BA 5DEOA 3GAAA 4PAMA 3AG6A 5FUVA 1DO8A 2G9NA 3A4NA 1QYXA 1RWKA 1V9CA 3GJ5A 3KZXA 3OZIA 3PLRA 3MZ0A 4KI0A 2FZ4A 1DAMA 3C7DB 1F5NA 1NKSA 3HUEA 2SNIE 3LD9A 1RVDA 5IMSA 1VL6A 3MFYA 2NU9B 4HFNA 4GLFA 1OY1A 2GNAA 3ITEA 3JVVA 3R3ZA 4ZVTA 1R0SA 1YE5A 3WV5A 5LOVA 1NVXQ 1NP6A 2BM9A 2M9MA 3EY9A 1ULTA 3BL5A 4R6WA 5CT6A 5EMNA 5IAEA 2GHQA 4M7RA 2QGZA 4DQLA 1AGXA 2VDWA 4LY6A 3K9CA 4TLCA 1KMMA 4BKPA 2JJ2D 2F3UA 3G7UA 5KKNB 1FVXA 2QAGB 2W6QA 4FJ1A 4DQUA 4QFCA 4HDQB 5K0FA 4KK3A 3O84A 4Q3DA 2I3BA 2RJOA 3PXGA 3WO1A 3VC7A 3WLNA 1Z38A 5A3JA 4OATA 5EMJA 4JUBA 4CDGA 2QS9A 1XD2B 4AZVA 1L4HA 2HREA 3OE1A 1D2HA 2H5IA 3KTOA 4PLTA 3D4LA 4ZT5A 3X43A 3ZE1B 1Y3IA 5DX8A 4GPZA 4KXNA 2ZJ4A 4NBVA 1IXSB 4LHZA 3ZE2B 4WXEA 2WRZA 5EL0A 2R85A 2OFFA 3T35A 5IDXA 1XE3A 1TO6A 4U02A 3G0BA 2P75A 3E7PA 3JQBA 1T3ZA 3AHHA 4IO0A 3HB7A 5DLDA 5BXQC 5AI4A 3H1FA 3TECE 4O63O 1K4KA 1LFDB 1YVDA 1H2YA 2AN4A 3EXFB 3FN4A 4U63A 1S8NA 2XAAA 4CCAA 3PEWA 1B26A 1UIRA 1MZPA 3H5AA 2QMUA 3VSAA 3DR3A 4P86A 3IKTA 4LYYA 5J63A 3ZLBA 5HQTA 1C0PA 1IM8A 2WSBA 4OA8A 4GFDA 4XVUA 1YBAA 2PZMA 1NVBA 4CG1A 3AXTA 5BOVA 1W76A 3TZ6A 5A9SB 4L08A 1QG4A 3COVA 5CDSA 1J09A 2BGTA 2WWFA 4ZCLA 3W5JA 1N4AA 3R3XA 1OUMA 2Q29A 1VCIA 4R6XA 3UC9A 3CN7A 5IAOA 2ECOA 3AR9A 5ER6A 2OMKA 4EG3A 3RFCA 1JDBC 1KYXA 3CGWA 1EA7A 3V7NA 6ADHA 3O9ZA 3HMKA 2GBCA 2QVGA 3LGAA 3RI3A 3OF2A 1YRWA 2OCXA 1YRYE 2HMSA 1VPLA 4RLSA 7YASA 3OPQA 1U4NA 1UFRA 3G8AA 2O0HA 3ZW7A 1ZBDA 4EFMA 1IUNA 2EAUA 5D5QA 4KUHA 4M1SA 3KWFA 3R7FA 2A2ZA 4C4PA 3FFTA 4PQYA 1WO8A 1VL5A 3MERA 4WN3A 5BQPA 4JJFA 1JN0A 3YASA 4IMRA 2B78A 1Z7BA 5EXEA 1ZMOA 4LX8A 2JLWA 2PGDA 2JAOA 3N5KA 2J87A 2YCLA 4TSFA 3KT0A 5MF6A 3BFJA 2Z0MA 4KLCA 1CUFA 3AERA 3KTAB 1Z73A 2A59A 3WSVA 3QF7A 4UVEA 2H9AA 2FE4A 5FPKA 2ZIZA 2C1ZA 1GSAA 1K5GA 2CJWA 3DOFA 4PZZA 4QNNA 3T7SA 5F7OA 3L3BA 1P33A 1T5SA 2IH4A 1K8XB 1OGJA 2P2NA 1Y42X 3MCWA 1YVUA 4YYEA 2JJ1A 3QEAZ 1KZ9A 3FYUC 3K71B 3ICEA 1P45A 4IVRA 2J0UB 1LI5A 3QMMA 4GSKA 3M70A 1U7PA 1E77A 1A7AA 1PG0A 1U94A 3WGHA 2WHXA 2LPMA 1QG6A 4JC0A 3ZXXA 2YFQA 3BWXA 1ESEA 1OHHD 3RIYA 3OIFA 5C2JB 1B74A 1E1QD 3HFRA 2JJ2A 1Z0AA 1ZCFA 1V5IA 2ZTMA 2QTNA 3G1UA 2DQKA 2X1HA 4YJ2F 3HJBA 1II0A 3KSDO 1TLTA 2CL0X 1CJKC 1NU6A 2Y0EA 1CUGA 1TM3E 3OQ6A 4ERNA 4BGIA 3N0WA 4EF5A 5IEJA 4MRSA 1QNLA 3WB9A 1XAIA 1T9BA 4LZLA 2VT7A 3GFGA 2W71A 1TUGA 2AGVA 1N5MA 3DBRB 1JWBB 1NPTO 1RE0A 3OC6A 1GWNA 1PUIA 3I4FA 4NF2A 2ODAA 1GKIA 1T4CA 3BRWD 4Y67A 2JFHA 3BCRA 4BN5A 1AD2A 4EFNA 2I71A 5G02A 4JI1B 1XZEA 3DOEA 1KC3A 3WDSA 3D8UA 2Z5FA 4GR4A 1U7ZA 3V1UA 4RPGA 3V97A 2HGZA 4BFSA 4HOYA 3AETA 5CGQB 4MEJA 5JMWA 1GA4A 4RVHA 4WOKA 1SOUA 4D0LB 1OC4A 4WN9A 1VFNA 2H4XA 2ZQZA 3EHDA 4IRMA 1DE0A 5EWLA 3E0QA 4WCFC 4CM5A 2J4DA 1J2JA 3EASA 2GRAA 4RDHA 4LVOA 3EODA 1M2NA 3EIOA 4PCLA 2OPHA 3ASZA 4RV5A 4JR1A 3AF5A 1TCBA 4HYYA 4E5VA 1PGQA 3LFUA 2ATEA 2Q45A 2E6UX 3C1UA 4Q82A 4ZCIA 4WUVA 1JECA 3LX5A 5A03A 4BXOA 4JJKA 3Q87B 4IOLA 3MJSA 3GMTA 1MB2A 3A9VA 3ZW8A 3ABSB 1O4WA 1IRXA 5H3HA 5AKIA 1P2SA 5K3DA 3X1YA 2G88A 2CUZA 5FFMA 1YONA 1Q6ZA 4M22A 2BKLA 4UU0A 3GRYA 4F1WA 1Q0QA 2RHMA 5KYVA 2BTQA 5IMBA 1CC1S 3V2IA 3GA7A 1Z4JA 5FDFA 3GI1A 1WQ3A 2R65A 3K0HA 1KOJA 4Q19A 1NNEA 2YIJA 2Y05A 4ALMA 4ZIRB 4PC2A 1QNFA 4WVFA 3DR5A 3W1EA 1F4PA 2ZK7A 1GRNA 2W6ID 2HRZA 4B6OA 3K0SA 2DT5A 3D4BA 5JPDA 4NJMB 3PDHA 2PWAA 3N2KB 1C9JA 1NC3A 3L6DA 2E37A 2WR8A 2CD9A 3H0KA 1DEOA 3O2SB 2ZT5A 2H4JA 3V6LA 3VDQA 4CEHB 2RHDA 1NFQA 2MWMA 3ABQB 3IMEA 1BAPA 4QPNA 2O2SA 3C8MA 1K8RA 1ZP6A 3KUDA 3TLJA 4GBMA 1FRNA 1XZJA 3OSUA 4K9PA 3OUUA 4RVUA 4XYGA 5ALOA 3WAGA 5C52B 5ARCA 5HP4A 4OAPA 1IHOA 3GCWA 4ND5A 4ZP1A 5K03A 1GZVA 2EF1A 2WTMA 1G3RA 3O3NB 3K0KA 1JFFB 4RHUA 3V2UA 4C76A 1CQIA 4PF1A 5B5SA 4RTNA 3LECA 2PHZA 2GDZA 3KQPA 1P44A 3LUFA 1BD3A 3PGKA 4Q37A 3LUCA 2E89A 1T8RA 4KKXB 4Q7MB 4YDSA 1R8XA 2FJ0A 4IDQA 4M0FA 5JBIA 3MM4A 4H6PA 4I4TA 4NYIR 1X8LA 1PJQA 1DMRA 4IPTA 1X2BA 2C4VA 4RPJA 1S8AA 3B5JA 3G8YA 4EG6A 3E3OA 3N8KA 3WOHA 4AMBA 2I65A 2J9XB 3C1TA 2BJWA 1YS6A 2WMDA 2XUJA 3AUJB 3ENQA 3WKAA 3P2YA 3Q2OA 3HJNA 3EQZA 1AKRA 3QSGA 2XE7A 2X8JB 1JU4A 1GG2A 1NI4B 1X8XA 3WBKA 1EB8A 2CNNA 3ME5A 1Q7GA 4QQFA 4X1KB 3K70C 1UOOA 3CRRA 4IR7A 1VYTA 1JV2B 2LV8A 3M83A 4G5SA 5BVGA 1U8CB 3BWMA 4DTCA 5CLLA 1N5OX 3B8EA 1G98A 3BE4A 4FFNA 1J39A 4GKAA 1GU7A 1RWQA 1FTYA 1ZIPA 1GRVA 2W6MA 4UHCA 5HF8A 3WAJA 3C48A 3UTCA 3PEFA 4YRMA 3AF6A 5DM4A 2O8DA 4GI2A 1G66A 1RFGE 3OJCA 1ENYA 4RTLA 1XN4A 4Q9JA 4BNFA 4N5DA 5C1DA 3ULKA 1GNSA 2ONZA 3WQHA 4OMDA 3L1IA 2YJTD 3DBVO 4ZCRA 4V0SA 1NF2A 1PSWA 1NGSA 1ZM4A 3NWJA 4DQDA 5FBVB 7REQA 3T6KA 3FSGD 1OZ0A 4MWOA 4ZXFA 1VHTA 3G2PA 4QODA 4ZAGA 3B6MA 2B2NA 3H2GA 1B8NA 1NOJA 3H11A 1GXSA 2P7IA 2HCTA 1XVIA 2YDYA 4NBSA 4ONEA 1GA1A 4LJSA 4ZOEA 3QA3E 1KI6B 4PAGA 4P08A 3HE3A 3HU1A 1QHSA 2AE1A 3SICE 1BRMA 3CUEF 3MIIA 4OP2A 4U2FA 1WXGA 4NEGA 1PZHA 2WYUA 3AVXA 2G6BA 1GL7A 2NO6A 2K6GA 3JQ7B 1T2CA 4QT4A 2JGFA 1E58A 1HEUA 3G9UA 1VMDA 3IO5A 2I1LA 3JRNA 3EW9A 4LF7B 3I30X 2G1AA 3W3AH 2HJGA 3WE7A 3AB3A 3EHEA 2X5NA 2ZSFA 4WH0A 2ERYA 4MOWA 3SEAA 3JQ8B 2QBYA 1Y9EA 2LIPA 1F4VA 2ZT8A 4FDUA 3DOIA 2C3YA 5ALQA 1ZN9A 4MI9A 4O5OA 3W7VA 3HWWA 3KZCA 2G82A 4DWWA 1F6DA 1W34A 4PBRA 4IJVA 2KYRA 2QN2A 3VU8A 1KQFA 3PGXA 1CUEA 4KO8A 3RT9A 1W2HA 4K6KA 4YAUA 3IEXA 5J2UF 1QZTA 2PFSA 3FGOA 2Q9CA 3ZDYB 3PYLA 4UPEA 1XDWA 2AOTA 4XLZA 1S5PA 4RPKA 5DI3A 4N5HX 3A8TA 2O0JA 3S70A 4UAJA 2F9FA 3L8DA 4J0FA 3QW2A 4I6JA 5CNJA 4KFUA 5L51A 2H18A 1ZI9A 2WKQA 1KZ4A 3OJOA 4V0KA 5TGDA 4PR3A 4BFTA 1VA5A 1CZNA 3QSYA 3DWGA 3E7XA 3PQ6A 1Q0HA 3NX4A 1DKNA 2QX7A 3GA5A 5ALLA 3WWDA 2Q2VA 1DIHA 4Q16A 3DCYA 4J1NA 4DLRA 5LU9A 3BXEA 2H1LA 1E3QA 3P0HA 4QU8A 4L6AA 3UGJA 1AKEA 3SJCA 4DRZA 4E33A 4KR7A 3IPRA 3S8YA 3QPDA 1O03A 5TNXA 4IIJA 2W0SA 4A23A 5K8CA 2ODNA 2YXDA 3EIWA 2B1GA 4X8HA 5JZMA 4DUPA 4IF4A 3A1FA 2G06A 2WIJA 3AVYA 4JYBA 4N03A 1V41E 4TVKA 3JR7A 5IK2A 3C6ZA 1Q0UA 1N0HA 3AJAA 3IOBA 3LNCA 3O26A 5HJ2A 2VF4X 3T3HA 4CODB 1P3JA 1YA4A 1I2DA 3UT5A 2FWJA 2NXCA 5B37A 3NFYA 2PJDA 2WJGA 2IWHA 2R4QA 4PONA 4HPJB 2LP4Y 4DC9A 3SX0A 3ZS9A 2DH5A 1V8DA 3ROMA 3E8XA 5B36A 4F7DA 5F7XA 1NQUA 5REQA 2GYYA 4LV5B 3OPVA 2BI4A 1Y7IA 2QRMA 5FI0B 3WP0A 1QB8A 4BNWA 4LDRA 2F4NA 2O1XA 2QORA 1YSCA 2VBIA 1PS8A 1GZ3A 3PWSA 1Y48E 3BHMA 2WQ6A 2HQOA 5A9RA 4EHBA 4QGGA 2IC5A 3CRQA 1Z88A 4AX8A 1B15A 3NRBA 4NV3A 1CY4A 4CDRA 1V0JA 5LBIA 1KXZA 2GBGA 2VPQA 3I72A 4YJHB 4CBVA 1CIVA 1TM2A 2CL5A 2CMGA 3WL3A 2TMKA 2V9ZA 3DZJA 3GZNB 5IDVA 2FP3A 3FUUA 4LDJA 3AUYA 2VDQB 3ZHBA 4QGAA 4DIDA 5JNVA 2WIFA 1VE7A 5F2NA 2QSZA 3EVZA 4RK0A 3VDXA 5LOVB 2QSUA 2WWWA 1UR5A 4YLGA 1ZC4A 4EJMA 3SU8A 5JRDS 3T38A 3QOXA 2XYRA 1DJLA 1X38A 2N1BA 3D6JA 4RJTA 2Q5CA 5CJJA 1U0GA 5EIOA 3ZXSA 1KDYA 1RAHA 3RVMA 4UNRA 2A9JA 2VYVA 3G9ZA 2B8NA 5F1YA 2J9ZB 3MBIA 1MX5A 4JB0A 3VZDA 4EO9A 2X9GA 5LQMA 1FF9A 3RQIA 4OHOA 4JOSA 4F7WA 1GYQA 2JFOA 4JLMA 2IVFA 3OPXA 1FLNA 4BFYA 3Q7TA 4FFRA 2XA9A 3ONDA 3QKRB 3ZHOA 2C98A 4L3OA 2DSNA 4N54A 2X9NA 4I9HA 5EP2A 3SQNA 4N7JA 4A6DA 4URVR 1DQPA 3ZTTA 2Q3DA 1UKYA 1PG5A 3OA0A 1MEEA 1JXOA 1ZD5A 2JVKA 2ORED 4HAVA 4E2FA 4ENWA 4U8HA 3C8HA 2IT1A 4EW3A 1QR6A 4PHHA 2NYVA 2GOYA 4TLAA 4EGSA 1UP6A 4L6IA 4QTYA 2AVDA 5SYAA 4OKIA 2X76A 4Y3UA 3KQHA 4FKZA 1R15A 1U0RA 3RYHA 4ER5A 3ELUA 2A88A 2XCQA 2FMXA 1NSTA 5T4EA 5HWSA 4QULA 2NGRA 2VDJA 3LCUA 5L8VA 1B2LA 2CVOA 2IY7A 1JI3A 4LISA 2CFRA 3T5GA 5EERA 2XY4A 2VAVA 1J20A 2Q2NA 4YB8A 3MC1A 1E3LA 1LH0A 3V7YA 1SC9A 2Q0SA 1U0EA 2TRSB 5M29A 1TJ3A 3W2TA 5A6VA 1LBIA 5A9SA 4CIBA 2ZRHA 4WFJA 4ZQIA 4AKIA 3B82A 4O2AA 2RK3A 4M87A 5AUPB 2JANA 1V3TA 1KDTA 5D00A 1V7ZA 5ABPA 4HLDA 1X80B 3X1KA 1KQPA 2GLXA 4LBVA 5TMEA 5K4HA 3A36A 1I30A 1ZOOA 2HWWA 5E1BA 1NRXA 2OSVA 4WXYB 4G4SO 4YJFB 2Q9UA 3DYBA 3PTZA 1ZW1A 5AKXA 2ZRMA 3V1YA 4RVDA 4X7PA 1UJMA 4P4SB 4PS0A 1A98A 4ZTBA 4CMBA 4ZO9A 2WHYA 4F2WA 2NXEA 3L8YA 4KBGA 3OJ0A 1A9XA 4QHYA 3M6MD 5AICA 4D6YA 2QT1A 1DXOA 3OFNA 4BIMA 2FMIA 4MUKA 4PGAA 4J0IA 1ISGA 4YUWA 5EFZA 3UCXA 1EVQA 1LQ2A 2AJBA 2OZLB 4YRGA 2AFIA 1II8A 5ICFA 4MR9B 4A8JC 2HA3A 1F8XA 2O2IA 4IXWA 1YASA 1JKJA 3RJZA 2GNOA 2BI8A 1VLJA 4B7UA 1XF1A 1C9YA 1BH2A 2P6PA 4CLDA 3W34A 4HMOA 4MYCA 1A71A 2BGIA 5LVAA 3TGPA 1JDPA 1JA9A 2JH3A 3SC2A 2BLLA 3TVYA 1AK2A 5LPNA 2QOEA 2ZUUA 4MDHA 4OXXA 1VI2A 2QVXX 2I8LA 2P8SA 1U9CA 3H9BA 3ROKA 3GLHE 3RNOA 4LF8B 1K97A 1MH1A 1WXIA 1WUTA 3AHEA 3PIIA 4MGKR 5EJ6A 4B76A 2HZ7A 1MIOB 4MV4A 5I4IA 2FN8A 3G5AA 3R09A 5CU7A 5FR1A 1L1RA 3Q8LA 3A6FA 5B1SA 1HQYE 2D1TA 4URHA 1QYDA 4E2WA 5AD1A 3OMWA 3F8SA 2ENUA 3N75A 3G2OA 3W6OA 5FOQA 1T5BA 3H17A 1G3QA 3Q3JB 1GPMA 1PS0A 4JDPA 2H51A 4LOAA 3QVWA 4F4FA 4IEIA 5AOBA 3UMYA 3IQEA 1KSFX 3O4FA 4AX4A 2ES4A 1S3GA 1SC3A 2RHTA 2W2TA 1R0CA 1P7WA 2NO1A 3BMNA 1G6OA 4I5FA 1NNI1 2JFPA 2KPOA 4N0DA 3UFBA 3ADCA 1GQQA 2J9GA 1O6GA 1UBGA 3B1WA 5IYZB 4DR3B 5BVHB 1XG5A 1L4EA 2DECA 1FNMA 4MVJH 4R2KA 1NLUA 1ECPA 2CBXA 3R7AA 2FEXA 4F3NA 1OA1A 4WT7A 1E9SA 2LGJA 3SC2B 2DG2A 1CT9A 2OGSA 4BNDA 2GAOA 2XOKA 4RK7A 2OYCA 5KI6A 4Y2VA 4AKGA 3P9IA 4ARCA 1IQ0A 1KQGA 3NVKI 3A6EA 1CD5A 2NSLA 3K5PA 3RVLA 3BXGA 1N5LA 1ZJ4A 4GZLA 4BYGA 1RP7A 3F97A 4IJMA 3HXQA 2XUIA 3LPNA 4JYAB 5ILQA 2WVGA 4EHHA 2QKYA 2I8AA 5BMVB 4R0NA 3PJRA 5BN4B 4X41A 1T2EA 1QCYA 5FBRB 2C7QA 1U1CA 1P4JA 3L41A 4HEA1 5SICE 5I9MA 3FIJA 5IAJA 3T7TA 4EAAA 2HPVA 4EGAA 3OWHA 5AP9A 1HEYA 1P9WA 3I6YA 1LWOA 5DW3A 5CTJA 2VHQA 3NNSA 5ITVA 4Q3AA 1H5NA 3S4YA 4EA8A 1ZESA 3HR4A 4ZFNA 4CLOA 4W7HA 4QTUB 2P9YA 1IG3A 4B1FA 4M0PA 4RGYA 1YAJA 3ORYA 521PA 1E96A 4JFAA 1N4DA 3GOQA 4YWJA 3WL7A 5C7IO 3HZOA 3MJTA 1G7CA 1P6UA 1U0LA 3EQ9A 3LT4A 3R3JA 1AHPA 1UL1X 2FEAA 2PU7A 3VR0A 1D5WA 4PZCA 5HF5A 5IM5A 4CYMA 1UJ4A 2H92A 3CE6A 2VJMB 1O5TA 1USWA 5K3OA 1H23A 3PITA 4IIDA 3CEJA 2YWDA 3VPDA 1R3DA 3R0QA 3H5OA 2XZDA 3AF2A 1OBFO 5JCJA 3H13A 1GZUA 4FEAA 4D9IA 4UMEA 4XA8A 4FS3A 5HTKA 5AM2A 5KQGA 1K7SN 4B3CA 3W5CA 2GVNA 1BHQ1 5E3JA 1CHNA 2OXTA 1P9LA 5T41A 3QWFA 4X7RA 2EQAA 2QNBA 4JOBA 3AR2A 3NU1A 4KEAA 4QELA 1V5GA 1RJGA 3KKQA 4MUAA 1XQ9A 3L04A 3K20A 1SCUB 4FYYA 1CQJB 5JZ9A 3KZOA 1HPLA 1AVTA 2VKTA 1EDOA 2BC9A 3LFHA 4RTQA 2PZKA 2EP8A 5EP1A 4R7TA 1URPA 3TWOA 2DFPA 2P9TA 4NK4A 1L3IA 3VNSA 2DR2A 3X1MA 5UKDA 2JBAB 2QZPA 2G0AA 2XXBA 1J0XO 4I4TB 3WLEA 6REQA 2ZZMA 1I5EA 1ES9A 1THTA 3HRHA 2HNBA 1PZGA 3A0RB 4MWBA 4EHIA 5AKEA 4IYJA 4PHTA 4OK3A 1ZVMA 1O4VA 1XCJA 3U6BA 4C30A 4BCBA 4Q9KA 3N1UA 1N1EA 2P2DA 1NRIA 4ISBA 2A0XA 1QYRA 4IKPA 4AULA 1CZHA 2PXCA 5HOQA 2FPUA 2O8FB 5BVHA 2P2GA 3JWHA 1M2HA 2OQ2A 2FOXA 4TM7A 1N3IA 5KVVA 4LY0A 1F60A 2Z2KA 1XZHA 3AW9A 3PP8A 4HUQA 3E1SA 1FS4A 3UK1A 5JCZA 1P9NA 1PS9A 1Z18A 2O1WA 3V4OA 2GM9A 1UPBA 1W4BA 4ZA2A 5TV2A 3E2MA 4G01B 5ALZA 4QFDA 4F2GA 1ZJYA 2WG2A 4RIGA 3ZHZA 2BIFA 1K2WA 5FHQA 5E6RB 3BD8A 4JR2A 3T5MA 2ABWA 2H1VA 2CHGA 3R6GA 2ZBUA 1WV0A 3H4MA 4DA6A 1T4DA 3QVMA 5EXSA 1XWFA 2PEYA 1XTUA 5BSRA 3NG1A 4B4DA 2X7JA 3VA7A 4JLAA 4FDLA 4XDGA 5FQOA 1TYBE 1ZINA 2IZ7A 4ZOLA 3EPJA 1CVIA 3TG2A 4P5DA 4ZVNA 5EGSA 1X39A 2VJPA 4GUAA 4Y0NA 1EE2A 5KU1A 5JJLA 4R0VA 4OLHA 2WWVD 3R9WA 4AMYA 1YS9A 2C5GA 1K27A 1WX1A 3G7SA 2DUWA 2BT4A 2WAYA 5ALPA 3CQ9A 1RXWA 2OPBA 4KXMA 5HM6A 1ZZGA 3GAMA 2Q6LA 3EZNA 5D3KA 3SZLA 1JHAA 4Q02A 5D1HA 4DANA 1JGTA 1MGOA 1PJ8A 1T9ZA 3GD5A 4GOXA 3RKSA 2F3TA 3HUUA 1PGNA 3M3PA 4ZHQB 1IEQA 2VHTA 4HJXA 4NBRA 4NAUA 4JUIA 4YRBA 1NR1A 2QAIA 3ESDA 2F3PA 1X3LA 4MXDA 1E6EA 5CH8A 2UUOA 4EVQA 1KEKA 4PNZA 5IXSA 2QVLA 3N8HA 1OILA 3JQBC 3U3MA 4ZD6A 5A1JA 3H8WA 2YQZA 3W6PA 4AB1A 1P0MA 1A5SB 1NUSA 1T4GA 2HTEA 3JPWA 4X8MA 2GZ3A 1DCKA 3BJMA 4US0R 4X7MA 4ZRNA 1O8CA 3VPCA 3WHIA 3UXYA 3ZK8A 1JAXA 2P9JA 4O02B 1VECA 1K86A 2WF9A 1TOAA 1TVKB 3R0VA 2P6NA 2IELA 2XB2A 4BAUA 2CT8A 1N6IA 2VWGA 3H7IA 5AJVB 4JR0A 2R4UA 2Y0CA 3CZQA 4PYKA 5HE8A 3CRNA 2GA8A 4NCXA 3LDHA 1VYUA 4U8GA 1MVOA 3B1VA 4U7WA 2XR1A 8OHMA 1VIVA 1FL9A 2PTGA 4IJUA 4CT5A 2XTZA 1VLHA 1QHEA 1YJ8A 2GUGA 1WCWA 2O05A 3CR8A 3H0CA 3VYSB 2BSQA 4YASA 2QROA 2DBVO 1J42A 1YTLA 2QZJA 1N36B 3D0OA 1L7BA 2QLTA 4J1TC 4UXJA 4MDYA 4CL8A 4EUSA 2VNKA 4G26A 4PC3A 5JH7F 2IOFA 1G8HA 3VOSA 1RKQA 1TDJA 2AW5A 1T13A 2B6NA 3DDSA 1AS2A 4BWVA 5BSEA 1SM4A 2C95A 4TTVA 3A1VA 3KTFA 1GILA 2MSKA 4MINA 4OHPA 3OO0A 3M6IA 3P94A 4P93A 5DKFA 5EE3A 4ZOQI 5K3AA 4DLYA 2R1ZA 1MC1A 5LDHA 4GGOA 4JCOA 4LYHA 3KHUA 1L5FA 4CIWA 1A8SA 1OPRA 3QRWA 5C35A 3VHXB 3CNBA 16PKA 1GUZA 4MB6A 1K7EB 3V34A 1QJCA 2FSFA 4QG7A 3OWXA 4OGWA 1SQ0A 2PVSA 3ENKA 4ZI7A 1TD1A 1MX3A 2B21A 5TPZD 1RSZA 2FG5A 4ZOBA 1WY7A 3JTMA 3NP9A 4NICA 4FUQA 1I3MA 9ABPA 2JC3A 2CXHA 2C99A 1ZAYA 4HRVA 4BMSA 1RAAA 3LF1A 4NKRA 4WXRA 5L3QA 3TQCA 3D9QX 1A4RA 1XC7A 2L18A 1MT3A 3L6BA 4P98A 5B1DA 3V33A 3JQAA 5FNVB 4RK4A 4CM3A 1H1DA 4L3WA 4Y2QA 3P9YA 1EWKA 4B82A 2OHIA 3GLGA 2VTEA 3WJ7A 4QBTA 2EIHA 3BTUA 5J4VA 3KE8A 1UPFA 4RHYA 5C3MA 4K3VA 1ID1A 5JDIC 3CF2A 1NRJB 3SLGA 1T15A 3TEJA 2AOVA 2IOQA 5B7NA 4L50A 2PLWA 3KT8A 3R74A 3F3YA 3HDYA 4MVJI 3WWEA 1DARA 4QZVA 3TK1A 2VJYA 2X86A 4K9LA 2ZBFA 3V55A 3ET4A 2HPZA 1UH5A 2C3OA 3F5MA 5DI3B 4KWIA 2GD1O 4C89A 4LQDA 5FBWB 1WVIA 4ZT7A 2B30A 1VSQA 1NVFA 4BQRA 4AJHA 1X7YB 1FNDA 2AD5A 2X7HA 2ATCA 2WFAA 3EXIB 1XCPA 1QC5A 2HMVA 1G3UA 4QHSA 4WBXC 1LJUA 4A0HA 4Z49A 1I2AA 1ECFA 1K63A 3NONA 3LWNA 1JEEA 2CD7A 2GZSA 2YJNA 1I0ZA 3NM4A 3OZCA 1NV9A 5GJVC 5CURA 4QJ3A 1IM2A 4S12A 5JT1A 4D4GA 4OHVA 3JVDA 2DFDA 4M4SA 2FPGA 4QXAA 4PO9A 3SZGA 4OXRA 4D99A 2VP5A 4OQQA 5DF1A 3I5XA 4RD6A 2OA0A 3TAUA 4OX9B 4WLVA 3BK2A 3AHFA 1Q1QA 1QH8A 3N8DA 1KZ6A 4FHEA 3PNQA 5L6LB 2BY4A 1BJTA 1VFPA 3I9KA 3TR5A 1P73A 4AFNA 1AZLA 4ER6A 4EZIA 1KIMA 4IRXA 1S2OA 1VGRA 2W90A 4TXJA 1YR6A 1EFRD 1A1VA 2O52A 2FR1A 3KFVA 4D46A 4BGEA 1Y6JA 1XK7A 4NOLA 3O03A 4L6CA 3FCXA 4WL0A 5AW5A 2CNLA 1I5OA 1Y1QA 4IOJA 2FW6A 2DPYA 3EVFA 5E3IA 4U5QA 1W75A 2OB1A 2BN4A 5BUQA 3D59A 2FSGA 2XXAA 2FZGA 1XU4A 4CM8A 4PRYA 3ETLA 5I9BA 1Q2UA 2FPMA 1U1IA 4A9AA 3GFFA 1SXQA 4LF5B 5KDOA 3PDJA 4ISCA 2O19A 1DAKA 1DXQA 1GG5A 2VP9A 2XDWA 3LYLA 4LW8A 5M5BA 3LTNC 2W58A 2YV3A 1ORTA 3HI6A 1KR5A 3TS1A 1SD2A 3AI2A 1HNWB 3TKAA 1RKXA 1ORVA 3EZ6A 4N3GA 2IHUA 1MB4A 3EGCA 5CA0A 3NCHA 1N3YA 2BP7A 4WV3A 4KMRA 4KYVA 4QJIA 1XQWA 1W49A 3WHLA 2Q4BA 4MQFA 3E9QA 1T6ZA 4LV8B 2IH2A 1H6CA 3NORA 2X3FA 3E2PA 4W7SA 5I4BA 4IZ6A 4EY5A 1QAOA 1EVJA 4FMDF 1XXHA 1WQ1R 2WTEA 2ZBDA 3ZGOA 1U0BB 4GL2A 4RGQA 3BK7A 3DW1X 2VCYA 1WHTA 4RIHA 2V6FA 4DF3A 4EITA 1COWD 2AC7A 1KKLA 3RJMA 1YR9A 4GM4A 5LDGA 3WLJA 5BNTA 4WI1A 5BQ3A 2CDRA 2FMKA 2TMYA 1Q95A 3ZN2A 3CKMA 2GPSA 1MHTA 1USGA 2Q0XA 4BQPA 3HRIA 5KYYB 4D0RA 4REQA 3CKLA 2JCBA 1MAVA 1BDBA 1DOHA 1E89A 1R5OA 1ZY2A 2HWYA 2WD8A 2ZQYA 5CK5A 4FYHA 3VR4A 2HJWA 3HG7A 2DQYA 2GJ8A 3ODPA 3RVRA 4FINA 2DFNA 1JALA 1N78A 4DDHA 4OD0A 4GPD1 1Y9ZA 3C2QA 2YXPX 1MO4A 1QE5A 5CJ2A 1ZIYA 3RU7A 4TYPA 4FFBA 2MMCA 5ERGB 3M6LA 3EIEA 3QX7A 5BQ5A 4A6EA 2IBSA 2DH6A 3ZCPA 4H77A 2Y3IA 4JC4A 2WTBA 2AYXA 3FI9A 1NYTA 1AGPA 1X87A 4KDFA 4LJ8A 4YAEA 4LFCB 2BGLA 3ZY6A 5E4YA 2RGGA 3ST7A 4X3OA 5C7LO 2QTAA 4WAUA 2E3JA 3UUEA 3CMMA 1E9AA 3QNUA 3KYBA 4MUYA 4KV7A 2IDZA 5CPFA 1JQAA 3LLMA 2V96A 1LSSA 2Q8NA 4M36A 3TCKA 5KTTA 1Y5RA 5TX7A 3W5UA 1S3FA 3ZGZA 3FGPA 2FPPB 3EGVA 1U8TA 4YXFA 3ZVNA 3VU9A 4YDRA 4EBBA 1LSUA 2O0LA 1SEVA 3CZAA 1F9EA 5ADHA 3O4IA 4D9EA 1ZOPA 2NTEA 4XUEA 2EKPA 2R9VA 5GM1A 3N9IA 1JTEA 3IAXA 3KKZA 4GBJA 4IUDS 3ADDA 2VJQA 3P0EA 1EFPB 4R9VA 4N8DA 4RFVA 2YIDA 3DEJA 3H3FA 4QXRA 1L8OA 5A06A 1KHHA 3O31A 4NV1A 4CG0A 2EXXA 1EUQA 2FEOA 4OQZA 5GOTA 2NO4A 3FDXA 3MRXA 1FNSA