4EXPX

Structure of mouse interleukin-34 in complex with mouse fms
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
283
structure length
283
Chain Sequence
ADPAPVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-34
publication title The mechanism of shared but distinct CSF-1R signaling by the non-homologous cytokines IL-34 and CSF-1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cytokine/transferase
total genus 36
structure length 283
sequence length 283
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00047 ig Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4expX02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4expX03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4expX01
3HZVB 4OZFH 3WHXA 4FFYL 3I6KB 3ZTJG 4NQXB 5AWNH 1QLFB 1NUNB 1P1ZA 2ZUUA 3P30H 3HUJF 4PYGA 1OAQL 1S7VB 5EULV 3BD3A 3CC5A 2HFGH 1G6VK 2BY1A 1X5FA 1HHKB 5JW4N 3ELAT 4JFDD 1UT9A 2VH5H 3L3DA 4ZAKA 2YEZA 1JE6A 2Z31C 3GSOA 3OPZH 2V17H 4FQ1L 4F7MB 1J1XL 3ARSA 2Y23A 5D1QB 5EBWB 3I6LD 4GMTL 3ZE0F 2OMNA 3VFRA 2G5RA 5TH2A 3QDJB 1LO2L 4P57B 4PJGB 3ALPA 3H7LA 5DQDL 2VDOH 3GJEA 4H1LA 1IAOA 3W2DL 4RGNE 4LSPH 4JFXB 1I1AB 5EUKA 5JPMA 1IGCL 1QACA 1J8HB 4I0CC 5DJ6A 3HE7D 3VXSD 2PCPA 1OAUL 1HKLL 3ULVD 3X3GL 4APQA 2P4AB 5KZCB 5SX5H 1IC4L 2IBZY 5IQ9A 3HAEG 3IS0X 4WFFE 5EBGA 2E8ZA 1R3KB 3UBXA 4DN3H 1V5JA 3E6HA 5ANMA 5HGBA 3ORJA 3ZKSD 5D1ZA 5ETUA 1T5WB 3LOWA 2NY3C 3D69B 4PY7B 2X7LA 2R2BA 1MLBA 3OXSB 5ALCH 1G7JB 2DDQL 3WLWC 4LRNH 2Z35B 5C09E 3C5JA 5ACZA 4HBCL 3TN0A 1IAMA 4LSSH 3L5IA 1RD6A 4QF1B 1ZA6B 5D7LD 1MJUL 3NFSH 4ZSOE 2A6DB 5C71A 4MD0B 3V4VL 4PREB 3KYAA 2H41A 1MPAH 1CLZL 4ORGA 4X6DA 4L9LA 3VFWA 5DK2A 2L4OA 4L3CB 4RFNB 3OX8A 4U1NA 5DJAA 5HDOA 3IDIB 4EN3D 3MJ6A 4OKVA 4WHYH 3QUZD 2IQ9L 1CIUA 5E2TL 2P5EE 4Z78B 4QXUL 4N0FA 3WEXB 1G7PA 1FVEB 4ODWA 1EGJA 3RGHA 5F9AC 2R4RH 5LJYH 5T5FL 2DIAA 3MGOB 3CDFA 4G7YH 3G6DL 5JMRA 4YZFE 2RJMA 1GYAA 3BI9X 4G3YL 4M1GH 3VFSA 4JQXA 4JPKH 4Y19A 3S97C 5GS0H 2GFBB 2Q76B 3JVGC 1BAFL 4PRHA 2XZQH 4LP5A 4M7KH 5E5RB 3MXWH 3REVA 2FLRT 4YHPA 1RK0A 5HSFA 3EIFA 1U8MB 4YIQB 3TV3L 2BHZA 4ZTOL 1ROWA 2HVJA 3P9MA 4H26B 4K23H 4PJHB 4ODSH 4TNVK 1NMBH 1LK2A 3TJHC 3CDCA 2J8UB 5D5ME 3EFFA 4M61A 1R24B 4CL7A 4GAYB 1HZHL 2KQMA 3GI9H 3ZKMC 3QDJD 4PJBA 2A74B 4MXVE 3T3PF 4WEUD 1IBGL 4ODXA 2YUXA 3RWDA 3CFKB 4OUUB 1WFUA 4Q2ZA 5EFIA 1FBIH 4PGZA 1I1AD 1ZT7B 4JM2C 1J8HD 4PJCF 5I1CL 5A43C 4TSCL 3RHWF 5EWIH 1A7NL 1GZPB 4FMKA 1DLFH 2AXJA 5TDPA 2Z8VC 3MRRB 4G9FB 5I0ZA 3CXDH 1EHLL 2AXHA 4HS6B 3B2UC 4PRIE 4P4KD 2HKHH 5HHMB 2JJWA 4JB9L 1KNOA 4QYOA 1G7IA 1KXQE 1EMTH 2PR4H 5DJXB 1BD2E 5LGJB 1INEL 2XQYK 5T3XH 4ETQA 1TJGL 2OL3B 3W82A 4Y1AB 1A5FL 4MA3B 2VL4A 2LAGB 1TZHB 3L5WA 5D93C 3WFDL 2GHWB 1J1OL 2M26A 4JGUA 2WBJC 1XGRB 4XBPB 4LQ1A 1TPXC 1Q9LB 1MCDA 1PEZA 2VZVA 3DRTB 5I75C 2OL3L 2XKNA 2APWA 2DLGA 3U6RA 2ZG3A 1MRCL 1L0QA 1KB5B 2IALB 1MRFH 2VLKA 2AP2A 3KLHD 3MNVA 2F8VA 2HT3C 4N8CL 4L4TB 5L7XL 1IRAY 3FT3A 1HHIA 4S1RH 5GGSY 3N1MC 1FAIH 1WBYA 4QT5B 3U7YL 3KPPA 1I3UA 3MRIB 4LVOB 2ITDB 3CPLA 3HMXL 2Y5TA 4IRJB 1KB5L 5HD8D 1DVFA 1DSFL 2NY6C 5DRWA 1ES0B 2UWEB 4XAWL 1PG7H 3LEXB 4MA8H 2YUVA 2QQKH 2QEJA 3NCYP 4HPOH 4K8RC 3T0WA 5CJOL 4P5MA 2QJDA 1A7PH 3BEWA 3GMQB 4PJHF 5CZKA 1ZE3C 5T3ZH 3O81A 4KDWA 4H0HB 3DRQA 3WYRA 2R15A 5C6PB 5DTFB 2B2XL 1ZGLM 4KROB 1NL0H 2F74A 3GIVA 3OF6D 4H20H 4HGMA 1BZQK 5TF1H 2Y72A 2JE8A 1JWSA 3EW3B 3QDGA 4PLOB 3AAZB 2VXSL 5D9SB 5MENE 2H2PC 4AQOA 2VDLH 3EO0A 4JAMA 2K1MA 3HC0A 1BREA 2ZCKL 3IF1B 1J1PL 5GGRB 2YS4A 4BSWA 3BKYL 3OKMA 3QEUA 3RUGE 2RR3A 4KKAC 2JKXA 1AO7E 4HWZA 1Q94A 2H9GA 3MLWH 2EC8A 4HGWA 3B5TA 3MREA 3CXHJ 5GGRY 1GC1H 2YD1A 3OJMB 4YXLH 2HTKD 2YK1L 1T1XB 4G9FD 5CGYC 3ARFA 4F33A 4OCSL 5IMLA 4Z8FL 4MNQE 5DR5L 2PYFA 4O2FB 5HHMD 4Z7QE 4GAGL 5DA0B 1IGIH 4IJ3B 1EUTA 2R1WB 2GTZB 3STBA 1BBDL 4KV5F 5I73C 4HWEH 1H8NA 1SEQL 1ZANL 2IAMC 3FQXA 2BCKA 2VTFA 4ZFGL 5EU3B 1R3JB 3AM8C 4P5TB 5JLZA 1RIHL 1VKXB 1D6EB 4LSRL 2I9LA 5AD0A 4JFPA 2F54B 5CJBA 4BA8A 5IHLB 4N0RA 1WVZA 5M95B 1ZLUK 1N4XH 4Z18A 5E5UB 3C8KB 4FP8L 4QTHA 4ZAKC 4JGJA 3VWJA 1VEOA 2UWEF 4L4TD 4JO1L 1QFWL 4NC1E 2CIKB 2P1YA 4LDEB 5IW3A 1IGJA 4YE4L 4G6JH 1BEYL 3GJFB 3TM6A 1D5BB 5HI5D 4GKNA 4IRJD 3NZHH 4R7NB 4S0TD 3VXUA 1FIEA 1HXMB 2W59A 3FQUB 5ICZB 1DQMH 1NGQL 2F53B 2V6HA 3RP1A 2EO1A 5HYJE 2EIZB 1NSNH 1FQ9C 2A0LD 2HN7A 1AD9B 2VERN 1G7HA 4K7FA 2V2XA 4DTGL 5KW9L 4YBLB 5H35B 3M1BB 4LEXL 5IESH 2HVKB 3FOLB 1DEDA 1EHXA 4APQC 1F58L 1IAKB 3VFUA 2P7TA 2D7NA 3UYPA 3P11L 4LARH 4XNXH 1XF3A 1AIFA 4KROD 3MX0A 5CJQH 3T0AA 2W9LA 2I9TB 1UXWA 4LCCA 2X4RA 5KJRL 4PG2A 4OF0A 4HAFA 3ARGB 4R2GB 4LLMA 5D1ZC 4DZ8B 3VXQB 1IEBA 1JZ7A 3K1KC 4U49A 4K3JL 1VFBB 1I3GH 1QSFA 4U1KA 1FNSL 3MBXH 4OLUH 3RVXD 4JZJA 4QKXB 1X6NA 4XH2A 5EZIL 1VHPA 2X4QB 5JDJA 3TN0C 3QCVL 2VDKL 3NZ8B 3OZ9L 1OM3L 3W9DB 4OZIE 3HNSL 1Z5LA 4G8FA 2P5WE 2X1PA 3VJ6A 2O5XH 4NO3A 3CUPB 4JFOB 4L9LC 5B39B 4JN2A 4PJ9A 1YC8A 3AREB 4JZNB 4JKPH 3N1GC 3KDMA 3CX5J 2OP4L 4HKJB 3L5XL 3KHQA 3CFCL 2C1OB 3EOTL 1WTGT 4Z7VE 4HFUH 3S37L 1SVCP 5DFWH 3U30B 5SV4A 1BZ9A 4YLQT 3WIIL 2R1YA 2OTPA 3LIZH 5EA0L 4ENEC 1AGFA 4LPCA 4EN3A 2XN9A 1R5WB 4WFGD 1DQJB 4D0CB 3U0WL 3QUZA 3DUSB 3ECBB 4ODUB 5EO0B 4YPJA 1UQSB 4U1LA 3LD8B 3SDDA 2EKSB 4P5TD 4PJXB 4GKSA 4JQXC 5DQJB 4D9RE 1Z6JT 2FJGB 1KELL 2PF6A 3HZVA 4OZGB 1LEKA 3I6KA 4NQXA 1ZHNA 1QLFA 1KJ2H 1S7VA 3LPFA 3HE6B 3T8XB 1HHKA 5C07E 4R9HA 2IQAB 1GPOH 4OT1L 4NO5A 1LO0L 4KZDH 2BNRB 5IMMA 3V79C 3OAUH 1WAAF 5F9JA 5D1QA 5C0IB 5GRWA 4JY5L 3JV4B 4LDLB 4NO0B 5EBWA 1RQ5A 2PW1A 2W9EL 2F53D 1UJTA 4M6ML 4P57A 4PJGA 2H1PL 3WUWB 2YXFA 2XZCH 5F1NA 3O4LE 1YDPB 4JFXA 3IJSB 1G1CA 1I1AA 3VCLB 3WJJA 5LAXA 1ZTXL 1J8HA 5J11C 5EOCH 1JPTL 3DWTA 4EI5B 1X5XA 3VXOB 2ERJC 1S7XA 3O9WA 1CD0A 5F3BB 2P24B 3KYKL 1RZKL 3NBNA 4PJAE 1IFHL 1R3KA 3S34L 3UTPE 1RULL 2YC1B 4EDXB 3FRPG 4YDVB 4XBGB 5I9QB 5FDWB 1CLYL 1MCJA 1T5WA 4KQ4H 1C7TA 4HCRL 4RWYL 3D69A 1MAKA 4PY7A 4MAYD 2IPUK 2DMCA 2EIEA 3OXSA 5L2JB 1G7JA 1D5ZB 4TOYL 4EQ3A 1TQBB 3HFMH 1TVDA 2Z35A 4XCFH 5HY9B 2BDNH 1X4XA 4W68A 3BP4B 2OR7A 4AEEA 5FECB 2O61B 3GO1H 4QF1A 2A6DA 4MD0A 1OSPL 4PREA 3WFBL 5BO1L 4FFVD 5EC1A 1QP1A 3SE4A 2EDDA 4FQCL 5FYKE 1DN0A 2ICCA 5IT2L 4L3CA 4PJXF 4WFHE 2DN7A 3SY0A 4PG9B 1CLOH 5A2LH 4J8RA 5ADOH 3IDIA 3C08L 4OD2B 4Y5VB 1U2CA 1DVFC 4GG6F 15C8L 4FFZL 2CJUH 4U3XA 5CGTA 3O3DB 4FQHA 4UDTB 3T09A 4JDTH 4KK5C 4M5YH 4P49A 3WEXA 1FVEA 4MQXD 3F7RA 3SGKA 2ZUQB 5GGUB 3MGOA 3B8SA 1WZ1H 3MV8E 1VGEH 3GK8H 3M8OH 1K3IA 3I2CH 1SHMA 5CZVH 5HHNB 3BYYA 2VLRE 2XG5A 5FHBL 3VD9A 5GGTL 5HYEA 2GFBA 1ZKAA 2Q76A 1N3NB 3HE6D 2EDTA 2XA8L 3VFGL 4UAOC 1K6QH 3WO4C 1JI2A 3V0WH 1U8MA 2EXWC 4WW1A 4YIQA 3VXTB 5CILH 3G08B 2F8OA 1QSVA 1KCVL 5KS9F 2DB8A 3F6IA 4H26A 3FO2B 2BNRD 1FYHB 5E99H 2J8UA 1ZAGA 1R24A 1KCUH 4NO0D 4GAYA 3IFLH 4IOIB 4JQVA 3GSRB 1RZJC 3PWNB 4GS7B 4Z7WE 3T4AB 2ZZUT 3G6JB 4HXBH 2DMBA 4M8VA 4HSQA 4EDWL 3CFKA 4OUUA 2VXUL 4H1LG 1ZT7A 3RL1B 1I9IH 3ARFC 5I8KL 5IFHL 3SDCB 1A2YB 5E7FA 1GZPA 4EI5D 5JDSB 5IOPB 4G9FA 2NR6C 1K9TA 5I66B 3FFDB 4HS6A 2X2YA 4JPWL 4YAQB 4POUB 1G7LB 2AEIT 3DX7A 1FZMB 3OXRB 2C7UB 1NKRA 3UBXG 4M7ZB 3BXNB 4ELMB 4XZUB 5SWSB 3KPOB 2OQJB 5DJXA 4OUOA 1YY9D 3S88L 4NN6B 1FH5H 3JWOH 2OL3A 5DT1H 1P7HL 4Y1AA 2DKUA 4HXAH 4MA3A 1A3LH 1TZHA 3CMOL 2NYYC 1XGRA 4MB3A 1CFNB 1ZOXA 1RVFH 2HMID 1Q9LA 1NBYA 3VWJC 1ZHBB 3DRTA 3MCKA 4D8PB 4F8QA 1NANH 3FFCB 4ODHH 3C8DA 1H3UA 3HMXA 2QBWA 3O0RL 2WUBH 1KB5A 5D2LA 2IALA 4KJYA 2X9XA 1U8PA 4X5XB 4L4TA 2NTFB 3VA6A 5FGCB 4JG1H 4QT5A 3MRIA 4OCRH 2ITDA 1GSMA 3L1OH 3L3KB 3H8NA 1A8JH 1JWMB 5EN2A 1G0YR 1ES0A 4XP5H 5IB4B 4R4ND 2YKLL 1MCHA 1WEJH 5I1JH 1X7QB 4IM8A 1N6UA 1UJ3B 2NW3B 4YX2L 2OTUB 4XCNA 1OY3B 4X9BA 3GMQA 4P2OB 4XAKD 3ZKQD 5FHAH 4LCCC 3S4SB 5C0FB 3EDJA 4PG2C 1FFOA 4KGLA 3ULVC 2NY4B 1A6VL 4HJ0D 5EZOH 3X12B 2DQTL 4OM0H 4M43L 3Q3GB 4RCAA 1CCZA 4I77L 5FB8B 1NAMH 3TLRA 2I27N 12E8H 2WWMC 3AAZA 1LO4H 3RPKA 4JZJC 2XTLA 1N2RA 4NGHL 2WQRA 4R97C 2XZZA 3EYSH 2FX8H 4I18A 4YH6A 5E08H 1BHGA 5BQ7B 4PLKD 3WS3B 3SKOB 2J5LB 3MLZH 4LSQL 4DKEH 2R2EB 5B3JE 5IB2B 3V8OA 2OXGA 1QSEB 4H25B 1HYRC 4PJ9C 5T5NG 3UROR 2W0KA 1EZVY 5LVEA 1T2QL 1Z9OA 4OF8A 3U82B 3O6LH 5FA4B 2JB5H 5EBMB 3SDCD 4S11A 3O2DH 2XNAA 1AXTH 3BW9B 1T1XA 4KRPB 1UB6B 2WNGA 2EH7H 4EN3C 4O2FA 1N6QL 3SE3A 4K3EL 1RURH 3QUZC 1YJDL 1HHGB 4DGIH 1Z9LA 3SDDC 3A6CH 4HPYH 1BQLH 1HINL 1T04B 1KPRB 2FX9H 2CDFB 5EU3A 1R3JA 3BKCH 1MCEA 4P5TA 1ACYL 4WIQA 3G6AB 1D6EA 3MLVL 4X99B 2C3VB 4E5XA 2H3NA 2F54A 2I60H 5A2IH 4PIRF 4EJ1C 4I1NB 1KLUA 3F7QA 4DZBA 1CBVL 3C8KA 4IMKA 4AK1A 3CCHB 1FAKT 1UCBL 2KZWA 4LCIL 2A6IA 3DYOA 4AIZB 5DRNA 3VDCA 3MLTB 5D1QC 4RIRA 3HHRB 2AEPH 3GJFA 3WL9B 2DD8L 1VDGA 3BP5B 3UZQA 1JHLH 3W0WD 4JCLA 4R7NA 1AKJB 3FQUA 2Q6WB 1FG9C 5ICZA 2F53A 3H42H 4YHOL 2AXGB 2ADIB 1I1AC 3N9GL 4FQQB 3WJJC 1YNKH 2EIZA 3MV9B 3HRPA 4K2UL 1AD9A 4YHKL 5MHSE 3I75B 4P2OD 1I85C 1R5VA 3MRQB 5DQ9B 4N8VG 5H35A 3M1BA 3FOLA 1VB9A 2D7MA 2NY4D 1IAKA 1NEUA 2G5BB 3WFEH 4NZDA 1MCOH 1YEHL 2I9TA 3O9WC 3OB8A 3IXAB 2ZPKH 4RISH 4N90E 3ARGA 2BVQB 1F3DH 2OCFD 3L95A 2CRZA 4NC0B 4OLYL 3VXQA 4I0PB 5GGVL 5SWZA 1PLGH 2GUOB 3QPXL 4LMQE 3QQ9C 5IVXE 1X4ZA 5T1KA 3BX7C 4BK5A 4MB4A 5DHVH 3DGGB 3D3VE 5DLML 2X4QA 4O58L 4OFYD 1AP2A 3D6GA 3NH7L 3NZ8A 3FQRB 5FYLD 4G80B 3W9DA 3E1F1 5FKAB 5C7XH 3MFGB 4MHHG 3CUPA 3NPZB 4NKIH 5IFJB 4JFOA 3SE4C 4JN1L 5B39A 3BQUB 1HWHB 3FOMB 3AREA 4KRPD 4JZNA 4RFNC 1T3FB 4XC1H 3WUZA 1S9KC 3QNYA 4HKJA 3WD5H 5DMGD 3TWCH 2C1OA 5C0CD 3RU8L 4GAFB 3CH1A 1L9NA 4BSVB 3O2VL 3MFFA 5D71L 4BUGA 4K9EL 5HD8C 2P46B 5D7KE 1DQJA 4D0CA 3BOVA 4P48A 3C6SB 3GBNL 3SGKC 5C2BH 3DUSA 1NBQA 2DICA 1PKQB 2EKSA 5DD6B 4EXPX 5IFAH 5E6IB 3RVTC 2BERA 4MMZC 2A38A 4CJ0A 5DQJA 5F89A 4DVRL 3D18B 3MV7B 5EO1A 4Q7DA 3U0PB 1JZ4A 1GAFL 1DANT 1MQ8A 4MXQD 1I9RL 4WDIB 4MQ7B 4OZGA 1JUFA 2DIJA 2B5IB 3BMVA 5J89A 4YUEL 5DK0B 3GSNB 5GS1B 3DO7B 2QQQA 3HE6A 1TJIL 5HYQB 2BSRA 3WDIA 5ANME 4ZXBD 1FLTX 4Q9BA 4R4FL 2KL6A 3QISA 2B8OT 4J2XA 5KVFH 4LIQH 4JQVC 5F7DB 1IL1A 2CXKA 4S0SD 2X9WA 5C0AB 3GSNL 3GMNB 4MXWL 4WCYL 2X4OB 3JV4A 1T6VN 4NO0A 4U1GB 5GSRB 3DYMA 2VE6A 2FNBA 4TSAL 2PUQT 5I18L 3G9AB 1SJHB 3WUWA 3ZHDA 4Y7MA 1YDPA 2DKMA 1S7QA 3FQNB 4X9IA 3IJSA 3S98A 3VCLA 4GRLD 2CRIA 4OZFB 4Z76B 4CDHA 1BJ8A 4O5LL 4AM0A 1RJYB 4ZMAT 5JW3H 4EI5A 4GO6B 3OJVC 4HCRA 1LO3H 3VXOA 2HLAB 2ZJSL 1CTOA 4PJFF 2NY5L 1HSBB 5F3BA 4I0PD 2CKNA 1OT2A 5IWLA 4HK3N 5AWNL 2YC1A 4KGJA 4EDXA 2YD6A 4YDVA 3P30L 1FL3A 4XBGA 5FDWA 4IS6B 1F42A 3OKDA 4QLRA 4HLZG 5D96B 1QRKA 5DJYB 5FK9B 4PRPA 4N1CA 4I0KA 1KBGH 4MDIB 4JLRB 5DSCA 3F12B 4GBXB 2VH5L 4NNPH 3PNWB 1JGEB 4OD1L 5L2JA 4Y19E 1KIRA 3OPZL 3QDAA 1J0ZA 2V17L 4PRHE 5HY9A 5JO5B 2RCSH 3BP4A 3DV6B 3LKQB 3MLYH 2NZIA 5FECA 2O61A 1QPPA 1BLNA 4WENB 2VDOL 5KSUA 2FSEB 2QLVB 4G43B 4LLVB 4LVOC 4XI5C 5HI5C 1YEGH 4IRJC 4XP4H 4PJBE 4Y5VA 5L0QC 2DL9A 1XGQB 4KTEH 5ALBH 2X70B 4TNWK 5AYQA 4UDTA 5E6ID 3E3QC 2A0LC 3GJFK 5GGTA 4ZUWA 4Z7UA 2FWOB 4OI7A 3RIFK 3MV7D 4N68A 5GGUA 4LNRB 1CD8A 4DN3L 2IADB 3E6FB 1LNUB 3O4OB 4KROC 2ZNXA 2VZUA 5GZND 5DC0A 1N3NA 4P2QD 3NCYS 3QQ4B 3K46A 5IKCB 3C5ZB 5ALCL 3U9UB 2ESVA 4OFKA 3DX9A 4ZOAA 3CAFA 4LRNL 3OSKA 3VXTA 3G08A 1DJSA 3IDMB 1D6VH 3V4UH 1QHPA 1FC2D 2PYEA 5HGGS 3V7MA 3FO2A 5C0AD 2DQUH 2K3TA 4I18C 4LSSL 5TQ2H 1ED3B 4WEMB 3NFSL 4Z95H 2MQCA 1H15A 3RVXC 4CAGA 1MPAL 4M02A 4KHTH 3T4AA 3G6JA 4G6AD 2F8XC 4IDJH 1AY1H 1HHJA 3SE8H 4NCC1 2EEBA 4NIKB 5E00B 3RL1A 4EXKA 4LK4A 2VLKE 3OGOE 4L3EE 5MEQB 3VH8B 1IE5A 4I3RH 1UYWH 3JTSB 1LEIA 1W72H 5JDSA 3SE3C 1DL7H 2R4RL 4IJ3C 2HA1A 5IOPA 3QP3A 5I66A 3V52H 1FRGH 1MCIA 3CMGA 3D0VA 4UQ3A 1L7TH 4J1UA 4KUCF 4YAQA 4M1GL 1G7LA 5DJ2A 4JPKL 1FZMA 3OXRA 2C7UA 1K3ZA 3QEHA 2WAHA 5GS0L 3BXNA 5HHQB 3B9KB 4XZUA 2HRPH 5SWSA 3KPOA 2XZQL 3CX2A 4P5TC 2P8LB 4M7KL 4UBDD 2ZSWB 3C9NB 3MXWL 5C0GA 5K9OB 4U0RB 4GG8B 2B7DT 2WMPA 2X1XR 4GBXD 1RFDH 1CFTB 5AZEH 4K7PX 5EG6C 1MFNA 3RKDD 3LMJH 4ODSL 1NMBL 4EBQH 2ICWA 2V5TA 5DUPH 3B9AA 4D0BB 4IMKC 2BHUA 4MSWB 3MCG1 3GI9L 1ZHBA 3HR5A 1I7ZB 4D8PA 1HQ4B 4X7EC 3FFCA 4PRNB 1J5OH 1IAIM 1FBIL 2P44B 4X5XA 1ITCA 3MODH 4WW2B 7FABH 3EZ8A 2NTFA 3X11B 3C5SB 3EAKA 4X0KB 2YBRB 5EWIL 1EX0A 1O5DT 4WV1A 1I7RA 2X4NB 3L3IB 1DLFL 3L3KA 2ED9A 4XTRD 3CXDL 3NA4A 1JWMA 3MROB 5CP3A 5IB4A 2FIKA 4YBLC 1WUNT 5B3NA 2HKHL 3U79A 1X7QA 2NW3A 2OTUA 4R96B 1EEQA 1ZGLB 1BQHB 1EMTL 2PR4L 3AS0A 1KXVC 3VXRA 3K81A 4Q58C 1A6AB 3S4SA 4NDMA 1NDMA 5C0FA 5T3XL 1EFXB 1GL4B 3ARGC 3C5ZD 3HC4H 4R2GC 3HG1D 1U0QA 4J3XA 1PEWA 2DBJA 4JHWH 2FRGP 3SO3C 3Q3GA 1A9EB 2VABB 3T0EB 3ZDXE 4QRTA 1IARB 2KPNA 4XNMB 3MJ7A 1CDUA 2Z9TA 5HVGB 3NN8A 3AXLB 4JGMA 2PTUA 1ZLWH 1V7MH 1MRFL 5BQ7A 5DI8B 5JORB 2W0FB 4HX1B 5DMYA 5I15H 4S1RL 3QAZB 5IV2A 1FAIL 3BYTA 1QSEA 3Q5TA 4H25A 1WZMA 3AREC 3D85A 2D7QA 1GGTA 1XCTB 5EBMA 4NOBA 2F19H 1KV3A 1PG7L 3RI5F 2SEBB 3BW9A 4MA8L 3HNVH 2QQKL 3ZHKA 4HPOL 5FOBB 4PY8J 5J0BA 1YUHB 3QCTH 3UCRA 3EO9H 1A7PL 4LLQB 4DW2H 3O6MH 3QEGH 4HS3A 4XVUC 4WJ5B 3QPQD 3DI2B 5T3ZL 3UTQA 3VXUE 3ZDYE 4LASH 3B9KD 5I2IB 5GXBB 3LD8C 1I9JH 2Z93A 32C2A 3LS4H 4ODVH 1T04A 1KPRA 1NL0L 3DMMB 4NJAH 1LILA 4MQXC 4N8PA 4X80H 4UT6H 4H20L 1FC1A 3DGCR 1BOYA 2CDFA 5FUZL 1JVKA 1CDGA 2Z8RA 4X99A 3NTCH 1IGTA 4BQBA 2VDLL 3HE6C 4ORZC 3ULVE 5D7IF 5ILTH 3GEWB 3BPCB 3H9SB 4XPHH 5DZNA 4JFYA 1S9WB 3CCHA 5LCVH 3MLWL 2ZG2A 4AIZA 1QKZH 1QSFE 4RGNB 2UY7A 1U6AH 1GC1L 3BGMB 1K2DB 4YXLL 4FZ8H 4DWHA 4YGVB 2OJEB 5EPMB 3C2AH 2C5DC 4EOWH 1AGBB 4RAVB 1AKJA 1KTLB 2ADIA 1IGIL 4FQQA 1T83A 1RJZB 4NKMB 3MV9A 3ZO0A 5DK3A 1RZKC 1OQOA 1WGOA 3I75A 1BBJB 4XPFH 3MRQA 5DQ9A 3X17A 3VXNA 1LP9F 1EFXD 4JDVB 4EI5C 1RHFA 2G5BA 3TT1H 5DVOA 2CGRL 5IWLC 3IXAA 4Y88A 2XN9E 3T0ED 4O02H 1JRHI 5I9QC 5CKAA 1Q9KB 3UJJH 5F6HI 2YN5A 4I0PA 2RAMA 5FAAA 4IBLT 3BUYB 4ZSOB 2OSLB 5JHLH 1OWWA 1IM9B 1TQBC 2AJYL 3W5MA 3MLPA 3S96B 3TFKD 3HI1A 5ERWB 1WIPA 4G6JL 4B7LA 1MCRA 3FQRA 2HMIC 4G80A 5T3ZD 5HGDB 1A02N 3MOBH 1GZQB 3NZHL 5L8LB 3CFJA 3BQUA 1DQML 3FOMA 3B6SB 1T3FA 3BDBA 4Q97A 3UZEA 2ZSVB 1F6FB 3O6FA 4POZD 1NSNL 1MFEH 2NMSA 4Y5VC 3E2HB 2XG4A 3T0XA 5I76B 1MQKH 3DURA 5IESL 4HULB 4KK9C 3QDJE 3FRUA 4PJGE 4LARL 4XNXL 1VFUA 5CJQL 5DO2D 3DMMD 5JXEA 1CD9B 2HFFB 4PD4J 4RA3A 1Y18B 3PHQB 1ZLVK 4XNQB 3HUJA 1BF8A 1UH4A 5DD6A 2NLJA 4A6YH 3HZYA 1PY4A 4LCWB 1U8HB 1J8HE 4FQXA 1D3CA 3D18A 3MV7A 4DFIA 3QA3A 5IF0B 4BQCA 2FB4H 5FF6B 2AJVH 3EJYC 2DQJH 1I3GL 5D5MB 4WDIA 4MQ7A 4IMLB 2PN5A 3H9SD 3MBXL 2IBGA 3S3PA 4OLUL 5TQ0H 1YEJH 3GSNA 5GS1A 3DO7A 3TCXA 1P9MA 2VDMH 3OAYK 1SQ2N 4NFBA 2FR4B 4RGND 2ATPB 2O5XL 1OTSD 2HH0H 3ISWA 5KSBB 4GS7C 4KPHH 5JZ7D 4R3SB 5C0AA 3GMNA 2W60B 3ZT5A 4CJ1A 2X4OA 2XKUA 4HFUL 4MDJA 4KU1A 1U58B 4X8JA 1KJVB 4R7DA 3IU4H 4Y2DB 3LPGA 3TVMA 4TVPH 1SJHA 3LIZL 1OW0A 5DS8B 4WFFD 3FQNA 1CZ8H 1NLBH 3REWB 3SDCC 4LHJB 2GJZA 2D7PA 4OZFA 4NBYB 4Z76A 3QNZA 1RJYA 3TT3L 1KJ2B 2DLTA 1E4WH 5L6YH 4D9QD 2UZIH 1NMCB 4URTB 4M7ZC 4BZ2H 3K4DA 1ZEAH 2A9MH 1U8IB 2VLME 1MFBH 1FVDB 3GHBH 2GYSA 1KJ2L 2AQ1A 2APTA 4NN6C 5HHOA 4K7PY 4IS6A 5ENWA 2CUIA 1IM9D 1Q1JH 2GQHA 3LKNA 4HHAA 3FN0H 5DJYA 2QHLA 5FK9A 3F12A 4GBXA 4XXDA 3PNWA 1JGEA 1G9EA 1GPOL 2OI9B 4KZDL 4DUVA 4HKBB 3OAUL 3UYRH 1UH2A 3OKEA 4YZFF 1TXKA 5ABDE 3DV6A 3WKNA 1D5MB 2FHCA 5B39G 5BS0B 3QZWG 3BHBB 4OJFH 2XZCL 3QUXA 3V6ZB 4OF5A 2J8UE 3T0VA 1UEYA 4G43A 4LLVA 3STZB 5IB3B 2EYRB 3ILPB 4WV1C 3ZLQC 1J8KA 1JNLH 2VIRB 4HUXA 2ICWJ 5D5MF 1RZFH 2YA0A 1XGQA 5EOCL 1UA6H 2X70A 1OT1A 5FXCH 4OV6F 1C5CH 1AE6H 1JI1A 4MXVF 4LCWD 4U2ZA 4JO4H 4KQ3H 3U4BH 2ADGB 3D9AH 4RMTA 4LNRA 3L7FB 4RBPH 3T3ME 5CLWA 5EOQH 2IADA 4QNPE 5BMFH 3UPRB 3WE6B 3E6FA 3MLUH 4G9FE 1LEGB 4KQ4L 1ZLSH 2OTWB 4IEFB 2AVGA 5HHME 3VD7A 1LE9B 5IKCA 3C5ZA 1HI6A 1MCWM 3U9UA 3TGXA 4AYFA 3JTTB 3HFML 4XCFL 3KJ4B 2BDNL 3IDMA 1F11B 1W0WB 3SO5A 4C59B 3GO1L 3CU1A 4Y1AE 4KZEH 2E7BA 2ZUXA 1X5LA 5GPRA 2BK8A 4PJCA 2J5LC 2DQGH 1ONQA 4Y2DD 4F9LA 4F8TA 3TCLA 3RJQB 4GW4B 3WUWG 1CLOL 5E2VH 1T89A 5ADOL 4F9PA 1YJDC 2FEEL 2R4SH 2R8SH 2CJUL 4KRPC 1DANU 5D2LE 2WIIB 4JDTL 5IM7A 5DMGC 5MEQA 4M5YL 4ZO8A 3VH8A 4L4TE 1FGNH 3MV01 3JTSA 3TO4B 4AEHH 3KAAA 3MBED 5I1EH 4X4MA 1WZ1L 3IT8D 1VGEL 3GK8L 1NJ9B 3M8OL 3I2CL 3AMKA 5CZVL 1T0MB 3ZTJH 3I50H 5HYSB 4HK0B 4I5BB 1A6UH 3IDJA 4G8GB 5HHQA 3B9KA 4NCDA 1AI1H 1P4LB 1RY7B 2P8LA 3GRWH 1K6QL 2ZSWA 3C9NA 5K9OA 4PGEB 3E3QE 1AGDB 4GG8A 3V0WL 1X6LA 5CILL 1F4XH 1CFTA 3LKSB 4O2CB 1M05B 5E99L 1KIPB 1KIUA 1REIA 5DVLA 1C16A 3S5LB 4D0BA 4MSWA 3IFLL 3KPSB 1OAQH 4MYWB 5IR1B 2K7PA 3QUKB 4HXBL 1I7ZA 6CGTA 1HQ4A 2UUDK 3RIAF 1M7XA 1UFUA 1JFQL 4GW5B 4MA1B 1Q9WB 2A1WH 1P4BH 1I9IL 2WQ8A 3N85H 3VWKA 1T03H 4TN9A 4WI4A 2XTJB 1WZLA 5I71B 3P40A 2MSPA 5DJ8B 5E4EB 2X4NA 3L3IA 1KC5H 4KI5D 1T83C 4M62H 1MH5B 2CKBH 1YQ2A 4FNLH 3RUGF 2WLZA 4TPRH 4OLEA 3H3KA 5DD5H 1BQHA 3I9GH 5KANI 3RBGA 1A6AA 3DROB 3TIEB 1C12B 4XB8A 5DUBB 3CFDB 1FH5L 3JWOL 5DT1L 3FO1B 3IAPA 1EVTC 4HXAL 4GUPB 1A3LL 4YFLF 4W4OA 3VFVB 2NY2B 3UEZA 4I0PC 3KPTA 1A9EA 2VABA 5FO9A 4WFGE 3HRZB 1BQUA 4Z7QF 5E8PB 3T0EA 4H88H 3B5HA 4OZIB 3IU3B 1OQXA 4XNMA 3QT2A 3UZVB 2R0ZH 3BPNB 4GRWH 3GGWA 4ODHL 4FXGB 1A9BB 3RAJH 2WUBL 4PJ7B 3IETB 3TPUA 4BFBD 2F54E 2W0FA 4CNIA 1MJ8H 2DBLH 1TQCB 4FQLH 1GOFA 4JG1L 3BQUC 4K9EC 1YYLH 4OCRL 3S8WA 4X83A 1I8KB 3L1OL 1B6DA 3O6FC 4W6XB 2DJSA 1XCTA 3ULSB 3QIWB 4YFLI 3TO4D 1E4JA 3PQYB 2EXYD 2FECL 4XP5L 3FN3A 1KGCD 1G6RB 1WIUA 1WEJL 2SEBA 4RZCA 5I1JL 4NQTA 4OBSA 4FTVB 5FOBA 1YUHA 3BN9D 5I19H 1JF6A 5JXEC 5F71A 5FHAL 4WJ5A 1NAMB 4KRMB 4LQFL 2F53E 5F9WB 3N50A 3TNNB 3AS2A 5SX5K 3O6KH 3DMMA 3UX9B 4FQXC 4OM0L 4ZOCA 4Z7NE 3PJSB 4G6MH 1M7DB 1J10A 5C07B 1NAML 4KK6D 12E8L 1LO4L 2B5IC 4XPTH 5FM4A 3KPSD 5GZNC 2IGFH 5GS1C 1P9MC 1U36A 3EYSL 1R3IH 1B2WL 2FX8L 3HI6H 4MNGA 1B0RB 5E08L 2H6PB 3BPCA 3H9SA 4FG6C 1BFOB 3CDGB 4PLNC 1S9WA 5GQBA 1P6FA 2GCYB 1OF2A 2O5ZH 4DKEL 1QFHA 3KPQA 3PP4H 3K4ZA 3SCMA 1BQSA 3K3QA 3O6LL 2XTJD 3MRBB 2JB5L 4OZHB 3O2DL 4OV5A 1K2DA 2IJ0C 3DVNA 2BVTA 1AXTL 2UY6A 2ZNWA 3TVMC 4YGVA 4BKLA 2OJEA 5I1LA 1VFAA 1JL8A 1OW0C 2R69H 3DPBA 3V0AC 1AGBA 4RAVA 5T1LA 1KTLA 2EH7L 2YN3A 4P2YA 1MIMH 1EEUA 4C58B 1RURL 4OCYH 1RJZA 2NY5C 4DGIL 1BBJA 3A6CL 4PJAB 4OZIF 4HPYL 1BQLL 4QRQB 4JDVA 4NRZB 2FX9L 3BKCL 4Y4FB 1TZIB 2N56A 2NY2D 1DBMH 4Z7VF 1SBSH 4NQDB 4WGVB 1S9YB 4BQ8A 1Q9KA 2I60L 1VACB 5D96C 1A47A 3WNOA 1J12A 3VGAB 1T80A 2NZ9D 5CUSH 1TJGH 3RWIA 1L7IH 1D5XB 1EH9A 3BUYA 3U0TB 4GBXC 2OSLA 3NCFB 3G5ZB 5K9QG 3RKDC 2D03H 3OWEA 1OGAB 1KULA 4OZGE 4OIBA 1KPUA 5ERWA 5IHBA 1SJEB 2AEPL 4IRZH 1H3GA 3WIHH 3MRHA 1MOEA 4MX7A 5HGDA 1JHLL 2CSPA 3QUXC 1E28B 1BVKB 1GZQA 3PQYD 3RNKA 5DRZB 3H42L 2VUOA 4FTVD 3B4NA 1XGYH 2ARJB 1YNKL 2ZSVA 2EDBA 2Y6SD 1AR1C 2BNRE 4D9RD 3P0YH 4ELKB 3VDBA 3U7YH 1NFKA 4HUKB 3TO2B 1JGDB 4M7LH 4XP1H 3WFEL 3WIFB 2CIIB 2E7LA 2HP4A 1ZT4B 1MCOL 1FG2B 4OFDA 5DJZB 4O2EB 1Y18A 3PHQA 2ZPKL 4RISL 4XNQA 1XIWB 4C54A 5C07D 4JPIA 5DHVB 1MHEB 2LV4A 3O4OC 4LCWA 4UNVA 1U8HA 1U93B 3KYMA 5GZOD 5IF0A 4CVXB 4FA8A 4PV9A 2BOBB 5FF6A 3VRLE 2Z0BA 1PLGL 3MNZB 3C5ZC 5IHUH 2VB5A 1QLEH 5DVMA 5F7WC 2NY3B 5BZDB 1M6OB 4GW1B 1KB9K 1U92B 4XVJH 4YQXL 1DDHB 3SGEH 4PRBA 1YPZB 3DHJA 2IWGA 3LKOB 2FR4A 5C7XL 3V5DA 1ZHKA 2DQCH 4PRPE 4NKIL 1HIMH 3NMEA 5KSBA 1J1PH 4R3SA 3QH3B 2W60A 4F9LC 4XC1L 3RJDA 3WD5L 4TRPL 3TWCL 1T89C 4F9PC 4Z77B 3TEUA 4HKZB 5I6XB 1NCTA 4NSKB 1U58A 1KJVA 4RGOH 4Y2DA 3UMTA 4KJQC 5DS8A 2ZG1A 1G1YA 2Q1EA 2R2HB 3UTPD 2CK0H 3REWA 4X7CC 5GS0C 4B7IA 4CMHB 4RFEB 5C2BL 4Y4FD 1KJ2A 3SBWA 5IFAL 4NQDD 3OKNB 2Q20A 3I84A 4IRSD 1SY6H 5A16A 4LPVA 1DCLA 1JK8B 3B9KC 3QWOA 4MD4B 5KOVC 1AQDA 5C8JB 2B20A 2VXVH 3S6CA 1FVDA 4E41B 1GGUA 2V9TA 4U0RC 5EU5B 1ODAA 4Z7UE 3QBTB 5FGSA 2YD7A 1OGAD 5FYKD 3BH8B 4WFHD 5KVFL 1X5ZA 1P2CB 4XAKE 4LIQL 3ABZA 3BESR 1NAKH 4F7PA 1UWXH 4XP9H 2W07A 2ESVE 4ZG1A 1D5MA 3BZDA 4LHUB 5BS0A 2R9HC 4RGMB 2E6QA 2PYEE 2AQ2A 4MQSB 4NQSB 3MR9B 4WUKH 1P84K 2ITCB 3VWKC 4LU5H 5CEZD 4YE4H 5J1AB 3O11A 5IB3A 3STZA 3F58H 4KMLB 2VIRA 1NGYA 3G6JE 1QA9B 4WI9A 3MV11 5CCKH 3NFPB 5JW3L 1D9KA 1XIWD 3ARBA 2MHAB 1LO3L 1RSFA 4Z7WF 2F15A 2D4FA 3DX6B 3U7AA 1BFTA 4GLRI 2ADGA 3WDJA 5BVPH 3L7FA 5AEAA 1W8OA 1PFCA 1EXUB 2OK0H 1DZBA 2AJ3A 2NQCA 3UPRA 3LKRB 3BO8B 3WE6A 3O8XB 1YEDB 3PDOB 2NY3D 4W4OC 2OTWA 1X5IA 3U7WH 1KBGL 4X8XA 1YN6B 3T0EC 4NNPL 5D93B 3JTTA 4ELME 2HRLA 4FOMA 5SWSE 3F5WB 5E56A 4N1HB 2RCSL 2XYCA 1F11A 1W0WA 3MLYL 1CK0H 3O41A 3PABB 1QFWM 4NP4H 1FNAA 4E0RB 3VD5A 1BPVA 3B83A 2Q8AH 3QAZC 1MVUA 1PX4A 1F6LL 3IFPB 1YEGL 4GW4A 1KENH 2YSSA 5FCUH 4XP4L 1M71B 1FIGH 4UU9A 1QRNB 3FFCE 4X6CB 1BECA 1EBPA 4KTEL 5KOMC 5ALBL 4OZFG 1OP3K 2XWTB 4WTZG 2YWYA 1QEWA 4JFFA 2CRYA 3TO4A 4PBVC 4MJIB 4DGYH 4P3DB 3G04B 1A1NB 1CDCA 5I30H 1H0DB 2GIYA 1NJ9A 4U1IB 1KEMH 1GIGH 1EVUA 1T0MA 4E41D 5LGKA 1CXIA 3DMMC 3UC0H 5HYSA 4HK0A 4I5BA 1P7QA 4G8GA 1I7TB 2JJTA 3MGTB 1U91B 4RMVA 1PAMA 4MAUH 4PGEA 5TE7H 5ECJE 3CVIH 3VXRE 1D6VL 3LKSA 3V4UL 3BGFB 1H5BB 5K59E 4O2CA 2DQUL 1M05A 5TQ2L 3L9RB 1GC1C 4NC2B 3U2SB 4JM2F 3MUHL 3VD4A 3KPSA 3ZKMD 4LHUD 5IR1A 2EH8H 3AS1A 1IGML 4KHTL 3V5KA 4IDJL 4UT7H 1AY1L 1A22B 1HE7A 1W72B 4F7EB 3IDNB 3SCMC 2BVYA 4D94A 4POYA 2P8PB 1Q9WA 4YXHH 4RNRA 5C0ND 1N6VA 3TBYA 2MJWA 4GOSA 1UYWL 3B2VH 4I3RL 1DBBH 1UWEH 5DJ8A 1W72L 4XRCB 1DL7L 1P84J 1FFPB 4NQEA 1QSEE 3RPIB 1MH5A 3V52L 1FRGL 1E4XI 1D5IH 3B2UD 1L7TL 3QDHA 1NGPH 4EVNA 4U1MB 3WDHA 1VEPA 1KFAH 1PY9A 5ACMA 1IILE 4CW1B 1F4HA 3VI4F 3D48R 5B3JF 4X4YB 2EDEA 3HI5H 5ITFB 5AG9A 1QUNA 1S3KH 3TIEA 5HDQL 2VR9A 5DUBA 4M8QB 1CGYA 1OB1A 1RFDL 4N5EC 5AZEL 4GUPA 3LMJL 3KPRB 3I3EA 4EBQL 3VFVA 3U9PH 3LKPA 5DUPL 1VEMA 1RIVH 3KXFA 2XY2A 2NX5B 2CK2A 3CC5B 4K94H 1OAXH 2C9AA 1EUUA 4R8WH 3GM8A 4OF3A 3IGAB 5DJCB 4LCYA 4PJ7A 4ZAKB 1J5OL 2YEZB 1C5BH 1T1WB 1MWAH 3MODL 7FABL 4D0DA 3CSGA 2J7LA 1QRND 4NKDB 1UEMA 3VFRB 2LTQB 1MCPH 3H9HB 5IG7B 4TNVF 5MERB 3KPMB 1I8KA 1YA5A 3GJEB 1OSPH 3VH8G 3ULSA 3QIWA 4DKAA 4MJID 3E2HC 3PQYA 3QHZH 4RRPA 3CFIC 1F3JB 1LWRA 2MTPA 1I75A 3NIFE 3AU1B 4Z0BH 2E7LC 4KWUA 4N9GB 2PCPB 1NAMA 2I26N 5DD1H 2AI0H 4APQB 2YD8A 5D6DA 3HC4L 1RIUH 5CJ5A 2E9IA 1UM6H 3MV9E 4JHWL 3SE9H 3ULUH 2AK4B 1AXSB 3KPLB 4OF7A 3PJSA 4WI3A 3E6HB 1M7DA 2VQUA 3JUYA 4NJ9H 5MI0B 3BFOA 3M17B 2CDGB 4N0UB 2H2PD 4YDJA 5TE4H 2CMRH 4OM1H 4CRPA 2MCPH 3UJIH 3CLEH 2VQTA 5C0BB 1V7ML 3ESVF 1B0RA 4TULH 4YHMH 1BFOA 3O2DA 1E4KA 5I15L 3C5JB 2GKIA 4HDIB 3L6FB 2L0DA 3VFTB 3VRIB 2CUMA 1IAII 3CNKA 5CBAA 1T22A 4R0LA 4QHUA 3ALXA 2HFTA 4OZHA 5SX4I 1NCWH 4ORGB 2F19L 3QG6B 4JRXB 4X6DB 4S1DD 4Y2DC 3OX8B 4U1NB 3HNVL 5DJAB 4HG4K 1MELA 5IVXF 1TIUA 1MJJB 5K93A 4KKBC 3QCTL 4PLJC 3EO9L 4DW2L 3O6ML 4I9WD 1Y0LB 2NXYB 4Z5RB 3MLRH 1U3JA 1WWWX 2VOTA 2YUWA 4LASL 3RZCA 1I9JL 2C4FU 1BQHG 3ILQC 3LS4L 3SBWC 5E4IA 5F9OH 4ODVL 3HPJA 3SDXA 4ODWB 2WINA 4QRQA 4NJAL 3UAJC 3L3GB 4UT6L 3TIDA 3KPRD 1WC7A 2G75B 4M1DH 4Y4FA 1M4KA 1TZIA 2YOCA 3VFSB 1U8OA 4NQDA 4ONGH 4MMXC 3NTCL 1NGZA 4C4KO 1Z0MA 4HUNB 4Y19B 5E9DB 2P48B 3TJEH 5HI4D 2NX5D 1VACA 1YEEH 4NUJA 4KK8D 2YD3A 1PKQE 5EZLA 5C6TH 5ILTL 4LMQI 4XPHL 4KMQA 4YHPB 3EYQC 1U8QA 1D5XA 3U0TA 2EDNA 5LCVL 4ZAKD 2V5RA 4PJDB 4IIQB 3MV7E 2OI9C 1QKZL 3SOBH 1LK2B 1XF4B 3CMOH 2EE3A 1HH6B 1OGAA 1PW3A 2YPVH 4M61B 5HYIA 3BWUC 1U6AL 3IDXH 1SJEA 3B3IB 3FO0H 4OCWH 3RWHA 3A67H 4FZ8L 3GUTB 3NCJL 4ODXB 3C2AL 1E28A 1BVKA 4EOWL 1FYTB 5C9KA 3SKJH 2YMXH 2PXYB 2ARJA 1LO5A 1WZKA 5C0AE 4ELKA 4XPFL 1KG0A 3H3PH 1KJ3H 3IFNH 1JGDA 4APQD 1D9KC 4BSJA 4KI5C 3TT1L 3WIFA 4NKOB 4QHMA 1FG2A 2AK4D 4O2EA 1NPUA 4FMFA 2BY3A 5DD3H 4O02L 3LRGA 3MYZA 5J56B 5E95B 1XIWA 5DHVA 1MHEA 2EDRA 3TH4T 3NCBB 5JNYB 3UJJL 1WJ3A 4CVXA 1I7UA 4JKKA 5C0BD 3PGFH 3MNWB 3VMPA 1K4CB 3MNZA 5JHLL 5JQHC 2EDKA 3KJ4C 1FDLH 5BZDA 1M6OA 4GW1A 1CFSA 4YR6B 5T1MB 2HWZH 3TN0D 1KYOK 1DDHA 1YPZA 5E1HB 3ZSSA 2XKNB 2LQRA 1YZZA 1Z9SA 3MOBL 3U6RB 4JRXD 5IVNA 2W65A 1KUMA 3S3JA 3PWUA 3QH3A 2WANA 3QO0B 5HHVH 3I3BA 1MFEL 4G8IB 3ZE2E 4XT1C 4HKZA 2R39A 4YXKH 1WBYB 2NXYD 1MQKL 1FGVH 4ENED 4NQUA 1RUAH 2Y5TB 3P4NB 3O2WH 2Q86B 3MA7B 5FKPB 1E6OH 3TO4C 5T1DH 4RFEA 2EXYC 1CU4H 5EZJB 5IB5A 4A6YL 3BZ4B 4JR9H 3BN9C 1MUJA 4Y19D 1J18A 5E9DD 3DRQB 4R6UA 2FB4L 1JK8A 1T66C 2JJTC 2AJVL 4PRHD 2DQJL 2LAAA 4MD4A 2IPTH 5C8JA 4ZUUB 4PJBF 4E41A 1IGFH 5TQ0L 1YEJL 1ZA3B 1HCVA 2E5EA 3D0LB 3IRPX 4CADB 5FYJH 2VDML 1A4JB 4K3DH 3EBAA 3ARDA 1WSST 2D9CA 3QDGB 3WO4B 3PF2A 1QG3A 5T5NF 3BH8A 1R5IB 4X5LA 1P2CA 2HH0L 4JAMB 4MJ6B 4M7LT 4KPHL 2JB6B 4PGCA 1GOHA 3L3JA 3V2AR 2QHRH 3BUTA 1FYTD 4WWKB 2BJMH 2PXYD 4C57C 1F13A 4TVPL 2HT4D 4NQSA 2ITCA 4OI9A 3TPKA 3MREB 4GKOA 5HVHB 5DDHB 2XTJC 5J1AA 1CZ8L 1NLBL 5I71C 5F21B 1CL7I 1F2QA 3ARFB 1QA9A 1HXYB 2ID5A 4XB7A 4UI2A 5IMLB 4NHCL 1E4WL 3JWOC 5L6YL 3NFPA 1SVZA 4NT6A 3KS0H 2UZIL 4X7FC 2MHAA 3LZFH 1DN2A 4BZ2L 1ZEAL 2A9ML 4AEIH 3OG6B 2C3WA 1MFBL 2V7NA 1NBVH 3GHBL 2DQFA 3FQXB 1EXUA 1SBBA 1EPFA 3LKRA 3BO8A 1Q1JL 3O8XA 5JLZB 3FN0L 3PDOA 4X4ME 4XNUH 2NPLX 4OQTH 2DI7A 2I9LB 3SKMB 5A2KH 3P4MB 3QI9A 2X4PB 4G6KH 2ZUTA 3BPNC 4PRDA 1TLKA 3UYRL 1U3ZA 5E8NB 2NZ9C 3PABA 5INDA 1C08B 3VWJB 5F7EH 5FA3B 1CGVA 2BOCA 4M5ZH 1DQQA 4J3OC 1TQCC 4OSUH 5DLMH 1KYOJ 1RAMA 3LRHA 1JHKH 3NH7H 1MEXH 3ARPA 4FS0A 5C08B 2Z91B 2FX7H 1JNLL 3MQIA 1M71A 3FJTA 2A77L 3QIWC 1QRNA 1RZFL 4X6CA 4GT7A 1UA6L 2FJHB 4P3WA 2XWTA 3HLAA 5ADPH 5JA8B 1JJUA 3AB0C 2LU7A 1C5CL 1AE6L 3QJFA 4L8BB 1CXEA 3PWLB 4PJ5B 4K7FB 4JO4L 4KQ3L 3BWAB 3U4BL 4MJIA 4P3DA 3G04A 4LKCA 1A1NA 3D9AL 5EOQL 3BDYH 5D6DC 1OGTB 5F9WC 1NFDB 5BMFL 4U1IA 1XF3B 4XPGH 3MLUL 4R4BA 1UXWB 4OCMC 4P99A 4W70A 1ZLSL 3QHFL 3UTSB 3KHOA 1EO8H 5FGRA 1NEZA 2GSIA 4NZJA 3MGTA 1U91A 3QDGD 3F7PC 4HV8B 2KZ1B 3TZVA 4TVPD 4WI5A 3LS5H 4JG0H 1H5BA 1QSFB 5D70H 1CG9B 4U1KB 3L9RA 1AJ7H 1L0XA 3IJYB 1L0YA 1E4KC 4KZEL 4WWKD 3LEYH 3QXTA 2DQGL 1BF2A 2DM7A 1J0IA 2DYPB 3T0EE 1CXHA 4R4FH 3RL2B 5E2VL 1W72A 2IF7A 3IDNA 3OAZH 4F7EA 4U6YB 2B1AH 3SKNB 4P59H 2R4SL 2R8SL 4PJIB 4PJ9B 3K80A 3ZDXF 3ARFD 1GGIH 1FGNL 5KANG 4JKWA 4XRCA 4QXTB 4AEHL 2R1YB 1FFPA 2NR6D 3RPIA 3RZCC 4BELD 5I1EL 3MO1B 1VESA 3CH8A 1NLDH 1QYGH 3U1SH 4LCUA 4U1MA 3I50L 5T3ZE 3HZMB 4CW1A 4KV5E 4C56A 1A6UL 1BGXH 1CE1H 4U1LB 3FKUS 4HLZH 4CUCA 1AI1L 4X4YA 5CINH 1UC6A 3GRWL 4Y4FC 1FPTH 4KY1H 3U46B 2IH1A 4TTDC 3FQWB 4M8QA 1F4XL 2V2TA 5F9DC 3UJTH 2D9QB 3KPRA 3H9ZA 3BRFA 2NYYD 1LEKB 3VGAC 3BE1H 5EU4B 5L8JB 3HB3C 1ZHNB 1UKTA 3VWJD 2NX5A 3KPNB 3QXWA 1B9ZA 3ZDYF 1UH3A 4KXZI 2E7MA 3EDFA 5F8QC 3IGAA 3ALWA 5DJCA 4OD1H 5IJKA 5C08D 4NO5B 2CKBB 3VXMB 1T1WA 5IMMB 2A1WL 2GY5A 1P4BL 5F9JB 3N85L 1T03L 1FJ1B 4PP2B 4NKDA 3H9SE 3VXUD 4F15C 2PW1B 4MJ5B 3U36B 4BH7B 1S7SB 3H9HA 5IG7A 1KC5L 5MERA 3KPMA 2G60H 4DK6A 3QEQB 5F1NB 4M62L 3ULVF 2YPKA 2CKBL 2XY1A 4FNLL 1CE6B 3PXHA 1F3JA 4TPRL 5KVGH 3VXPA 2EDYA 4DAGH 5EUOB 3AU1A 5ESAB 5LAXB 1OWRM 2VZ3A 5DD5L 3WFCH 3I9GL 5HDBE 4N9GA 5I1GH 2V9RA 5HYSG 3Q0HA 1JGUH 4P9HH 4U31A 5DYOB 3ARWA 1FCGA 1XIWC 5JOEA 4GRWB 1S7XB 4BM7A 2AK4A 3O9WB 1AXSA 3KPLA 5I8OH 3BIKB 2VRAA 1YNLH 3NCCB 2HG5A 4NFCA 3ZMRA 4DCQB 4ERSH 2MMXA 1QSFD 3VFPB 1RUMH 4H88L 5CWSB 4PTUB 2WWMD 5T33H 3OV6A 3M17A 5GRJH 2CDGA 2R0ZL 4N0UA 3S5LG 1TDQA 2ARWA 5E94A 5C0BA 2DYPD 3RAJL 3MPCA 1F3DJ 1OTUD 2EDJA 4NZTH 4D9QE 4MWFB 3EOAB 1MJ8L 2DBLL 3LQAH 5EO9B 3IJHA 5GSVB 4WUUB 2XWBB 4HDIA 5DVKA 4FQLL 3L6FA 1UB5B 4P46A 4PJ9D 2EYTB 4NN7B 2FBOJ 1YYLL 1CXLA 4R90H 3VFTA 3VRIA 4L5FH 1FO0L 3VFOB 4LOUD 3BPOB 5EC1B 5I6XC 3QG6A 4JRXA 2O5YH 1DN0B 4JM4L 1CD1B 3H9YA 4U6TA 4XCCH 3SY0B 3WXVL 3ZZ1A 4J8RB 3ARTA 2XN9D 1MJJA 2VDRH 4KMTH 5I19L 4CMHC 1KTRL 1Y0LA 4Z5RA 3SDDD 4FQHB 3IXTB 3VI3E 5E24E 4UILH 3S36H 3MRJA 3V9FA 3RWCB 5D72H 5EU6B 3O6KL 1B6UA 2OR8A 3L3GA 1OARH 3W5NA 4ZODA 2X40A 5MP6H 3O3EA 4G6ML 3RWEB 2G75A 2CO7B 4B53A 5JIIA 4ODBD 1P5UA 4K07A 4XPTL 2AERT 4I8DA 5E9DA 2IGFL 3P77B 4L3AA 1S5IH 5JIHA 3HI6L 1R3IL 4TTGA 5L2KB 1GJIA 4PJGF 3P73B 2FIRT 2D0HA 3H0TB 2VN7A 4WW1B 4LCWE 2YA1A 3DBXA 2F9BT 2O5ZL 4HF5H 5AYUH 4PJDA 4J3SA 3T77A 4IIQA 3S9DB 3VXMD 3PP4L 2FD6H 5IMKB 1XF4A 1N5AB 1MHHB 1HH6A 1UENA 5D1QD 5EIQA 1HH9A 1A21A 4WEBH 4F3FB 3B3IA 3GMPB 3CXHK 1BX2A 2YR3A 2A6KA 3QEQD 3GUTA 4RGMC 1RV6X 2R69L 4QY8A 3RFZC 1FCCA 3SGDI 3GB7B 2QTEA 1EJOH 1FYTA 3RVUD 3MRFB 1MIML 2FYYB 2PXYA 4OCYL 5HHXH 5KSBE 1ADQH 4ONFH 4LLWB 5C92A 5I1HH 5C0NC 2AQ3A 5F8RC 4MZ3A 4P9MH 4UB0H 4OIAA 1MREH 4NKOA 5KZCD 3RVWD 1A64A 1DQDH 3EO1B 4PJ8B 2CO6B 3K8MA 3O9WD 1DBML 1SBSL 2DQEH 3DX7B 3FCTA 2E9JA 5IJVA 1I4FB 3FMGH 3RTQB 2BNUB 3V6BR 4DKDC 2OS7A 5JNYA 3IKCB 3O8XC 1G9MH 4OFVA 5CUSL 1W8NA 1L7IL 3QQ9D 2YZ8A 3MNWA 3QRFM 4BYHA 3QXAB 1K4CA 3FT2B 2NNAB 3QI9C 2D03L 2VN4A 4YR6A 1C1EH 5T1MA 4IRZL 4U6HA 4JRYA 1NBYB 3WIHL 3MCKB 4ZO6A 2FO1A 1I1FB 4ZO9A 1ZWIB 2Y9RT 5D2LB 4KJYB 4WI6A 4U6XA 1U8PB 3QO0A 1YQVH 4LSUH 1XGYL 3LAFA 1NBZA 2CLVA 4G8IA 4MD5A 1W0YT 1HSAA 3P0YL 1J11A 3TF7C 1KCSH 2FBJH 1FORH 4A6YA 3BN3B 5DGRA 4M7LL 3NGBB 2VLMD 4XP1L 3P4NA 1KEGH 5BS0E 1OL0A 2Q86A 5L0QB 5EU6D 3MA7A 5FKPA 5EN2B 1KJMA 1QO3B 1K4DB 5GS2H 4WO4B 1XF5B 2NCMA 1Z2KA 3K8KA 5EZJA 2DQDH 4XCNB 3RVTD 4XNZB 3BZ4A 2H2SC 1J86A 4CVZB 1YN7B 1NH6A 2DS4A 2J8UF 3S35H 2YA2A 1FFOB 1UXSB 5CJ8A 4I48A 3NOIA 4KI5E 4WGWB 5IHUL 5L2KD 4ZUUA 1QLEL 4F2MB 1ZA3A 3D0LA 1YMHB 1UM4L 4CADA 4QO1A 4XVJL 5FUZH 1A4JA 3BGFC 4LFHD 4YPGA 1H5BC 1YECH 5FM5M 1K85A 3WN5A 3I02A 4HBQA 1R5IA 1N2RB 4LVNB 2B39A 2DQCL 1XAUA 4MJ6A 1HIML 2LABA 3T3MF 3PWPB 1TVHB 4I18B 2JB6A 1G7MB 3PWVA 4QNPF 4LSTH 3KWWA 1A6PA 3CX5K 4WWKA 4AJ0A 3GFUA 5A2JH 1CICB 1SM3H 4GMSH 1Z0NA 4RGOL 2YD4A 3J8F7 2E8YA 5I1IH 1NUGA 5DDHA 2CK0L 4JCMA 1CFQA 2EE6A 4U1SB 2XNAB 4S1DC 3VU2A 5FEBA 1HXYA 2FJFA 1LDPH 1CGWA 1G9NH 5TF0A 1SY6L 4X9GA 1DLHA 4IOFC 3LEVH 3MRKB 2APVA 4JREB 2VXVL 2WWKO 4YNYB 4EI6B 4JFFE 1LQSR 1AQKH 4Y1AD 3QWRD 1IZJA 1NCNA 4PRIA 4XHQA 1KGCE 3SDYH 4EIZC 5D2LF 4UTBH 2CGRH 3TBWA 2B1HH 3HCVA 1BD2A 3SKMA 2H3NB 4E5XB 1Z3GH 5HI4C 3P4MA 2X4PA 5K9KB 4G8GE 4KK8C 5LXGH 1NAKL 1KLUB 1HYSC 4XP9L 4TQEH 4DZBB 3R8BB 1CXKA 5E8NA 4S1QH 2P45B 1J05B 2A6IB 4XMPH 1C08A 1JCKA 5IJKC 5DRNB 1NGXB 1NFIB 5FA3A 2AJYH 2OZ4H 4WUKL 4A2LA 1CIDA 4XVTH 4K3GA 1V7NH 4BFGA 4LU5L 4N9OB 4RIRB 5I74B 4LAQH 2LTQC 2HJFB 4XI5D 3KPSE 5C08A 2Z91A 3F58L 4Z7OE 1JF5A 3KLAB 3BEVB 1YEFH 3TYGH 4NYLA 4OI8A 5CCKL 3GI8H 2FJHA 1VFMA 4HIIB 4L8BA 3PWLA 4PJ5A 5SWQB 1R5VB 1FZOB 5C70A 3BWAA 1WT5A 3RWJB 3IS1X 5BVPL 2XTJE 2OK0L 3HR6A 1SJVA 4HH8A 1OGTA 4ZFOL 1NFDA 1DP0A 2W9DH 4PR5B 4PV8A 4NQEE 4JJ5B 3UTSA 1HILB 3U7WL 4RA0C 2V5MA 3SO3B 1XF2A 5MI0C 3L95B 4HV8A 4PBWD 6FABL 3V6FB 3CSPA 1YC7A 3LN4A 5SWZB 1CK0L 2BRRH 3GHEH 1CG9A 4GAJH 4NP4L 5T1KB 3IJYA 5K9JH 5DJDB 1CICD 3LQMA 2Q8AL 1AP2B 1IEHA 4LHUG 1R0AH 4P46C 2DYPA 5MENA 5M7QA 3JV6B 4NRYA 1I8LA 5A3ID 3RL2A 4AEFA 3BAEH 1KENL 5FCUL 4U6YA 3NVQA 1FIGL 3SKNA 3RUGA 3RVVC 1T5XB 4PJIA 4RX4A 4PJ7E 3BP6B 3QNYB 4NZRH 1S5HB 4LEOA 2VLJB 3CH1B 3WV0A 2P47B 3FB6A 4DGYL 1KTDB 4QXTA 4U33A 3GRWA 3MFFB 2NXYC 5I30L 3MO1A 3AS3A 1KEML 1GIGL 2RFXB 1G0DA 3NFNA 4EUPH 3UC0L 3HZMA 2GJ6B 3Q6FB 3PQYE 4NM4H 5H37G 4MNQA 4HIJB 3E0GA 4JFHD 3TT3H 1ZSDB 1PBYA 5MEOA 1DEEB 4FTVE 4MAUL 4LVEA 5TE7L 5F89B 3U46A 3BVNB 4E9LA 4CVUA 5BV7H 3CVIL 2DM3A 3FQWA 4LHQB 4UQ2B 3SJVB 5EO1B 2F54D 2VISB 3J7HA 4TNWF 3OJDB 1EK3A 2JK5B 2KH2B 5TFSH 3LRSA 1JUFB 5EU4A 3TBVA 1WITA 3RIFF 1RUKH 2NY0C 4ZDHB 2EH8L 3KPNA 4IIQC 2BSRB 3T2OA 4UT7L 3V8CA 1QFWI 4GQ9L 1W2KT 2R0KH 3RY4A 3M45A 1IL1B 1KLFA 4MVBD 5DMKB 4NBXB 3T4YB 2CKBA 1IQDB 3VXMA 4Z7NF 4YXHL 2N1KA 1MCNA 1FJ1A 4PP2A 4LBEB 4MJ5A 3B2VL 3U36A 4WU7A 3WHE0 1DBBL 4BH7A 2VE6B 1S7SA 1UWEL 1EAJA 4G9DA 5DGQA 1T21B 2PXYC 2IANA 3QEQA 2HT4C 4CN1A 1D5IL 1S7QB 1JPSH 3IDUA 1CE6A 3G5YB 1NGPL 3QJHB 1KFAL 4OZHE 2V5SA 3MUY1 5EUOA 5ESAA 2NW2B 4XWGH 4AM0B 1WK0A 3HI5L 4F58H 1GRWA 2LVCA 3MXVH 1S3KL 3WSQH 3WNPA 1FL5A 1RZ7H 5DYOA 3ARGD 4R2GD 2PO6B 2VDNL 3FO9B 4YHIA 3U9PL 5SWZD 3BIKA 4DCQA 4HIEA 1RIVL 3VFPA 1JZ2A 3SDXE 1MWAB 1FL3B 3A6OA 4RQQB 5CWSA 4HUWA 4PTUA 3OKDB 2Y07L 5T1KD 1KT2B 4K94L 3T04D 4ZFFB 3WLBB 1OAXL 4PRPB 4WRLA 5C3TA 4R8WL 1T7XA 1O0VA 2JCCB 4NQDE 5DSCB 3L7EA 1DR9A 3K74B 1C5BL 4MWFA 1KIRB 3EOAA 4NQCB 1MWAL 5EO9A 1B88A 2AABH 3ZYOA 2YZ1A 5GSVA 4UZGA 1PZ5A 2XWBA 4HIHB 4WUUA 5BZWA 1N5YH 5AAWA 1UB5A 2EYTA 3ARED 1MCPL 1BLNB 1PSKH 4LPUA 1FL6B 3VFOA 5KSUB 1T7WA 1OGAE 5KVDL 3QHZL 3G9VA 4F37K 2P5WA 1IJ9A 2AJXH 5A40E 1CD1A 2XQYG 3EJZC 1A6TA 1H3PH 4Z0BL 1DTUA 4XVUD 3UTTB 4OZGF 2GJ6D 2GY7B 1XGPB 5DD1L 2AI0L 3IXTA 5DA4A 4HFWB 1RIUL 1PX3A 3RWCA 1UM6L 4ZUWB 4FQIH 5I1AB 4BH8B 4V2BA 5EU6A 3SE9L 3ULUL 4Z7UB 2WK2A 3SJVD 5ICYB 4QXGH 3JUZA 5CEZE 2X10A 4RBPK 3RWEA 2DQIH 2JTDA 1AGCB 1YMMA 1LK3H 1VERA 3WFZA 4NJ9L 4OGAC 4HMEA 5TE4L 2QL1A 2XIDA 2CMRL 4OM1L 1F4AA 2MCPL 3P77A 3UJIL 3CLEL 5C0RH 2FO4B 5KVEH 3WN5C 4TULL 2ESVB 4YHML 3PDGA 3DX9B 5L2KA 3P73A 3THMH 3H0TA 1ZV5A 2B4CH 5F88B 3BT2H 4IDLA 2PYEB 3SDAA 5J1TC 5IMKA 1N5AA 1MHHA 1H15B 4F3FA 4Z0XA 4KC3B 4WWKC 3GMPA 1NCWL 2PNDA 1YEIH 4OD3H 3KYOB 3VRLF 1HHJB 1YPZE 3GB7A 1MFDH 1JFQH 1ORQB 5HVHC 3MRFA 2UZXB 2FYYA 1CFVH 2DRUA 4H8WH 3MLRL 1IZKA 4LLWA 4QWWD 2UV3A 3LDBC 4X4ZA 4M7JH 3GKWL 4UIKH 5F9OL 5EBLB 5F93C 1LEIB 2VAAA 5ITBH 4PJEB 1CXFA 1JNHB 2PO6D 4PJ8A 3EO1A 4M03A 3D0VB 4UQ3B 3DVGB 4M1DL 4NBZB 4J1UB 3QXDB 4ONGL 2D0GA 5DJ2B 2XWJA 2Q3ZA 3ZT7A 3QEHB 5D1XB 3TJEL 1I4FA 3RTQA 1YEEL 2BNUA 2K9UA 3IKCA 1WWCA 5C6TL 4PRPD 4TSBH 5C0GB 2V7HB 3WIHA 1SJXA 2CLZB 2GAZB 3QWRA 3QXAA 4LNVA 3TESA 3FT2A 2NNAA 3SOBL 4NQCD 2ICWB 5DEFB 2YPVL 4RMSA 3DI3B 4LIQE 3IDXL 1GH7A 4E41E 4KHXH 4Q9QH 3FO0L 4OCWL 1IC5H 4OLVH 3A67L 3HR5B 4XCYA 2Y36H 4AZ8A 1J0KA 1JTOA 5HJ3B 1U3HB 2YPLB 1I1FA 1ZWIA 3C60B 1N7MH 4LF3A 3SKJL 2YMXL 3ULUD 5KBNC 2K7QA 3UTTD 2APBA 3H3PL 5IVOA 5J1SC 2WUCH 4WV1B 1KJ3L 3IFNL 1I7RB 1VFOA 4TVSa 3RQ3A 4KK9D 4ZS6D 1AD0B 1RHHA 5I8CB 1MCWW 4LGPB 1QO3A 4RWHA 2FIKB 1WT5C 2RB8A 1K4DA 4WO4A 1XF5A 2X4UB 5DD3L 3BH9B 4WVRA 4CVZA 1YN7A 3VXRB 4NDMB 1NDMB 1OVZA 3GMLB 3BIBX 1UXSA 3EJYD 2G9HB 4LQFH 3PGFL 2ESVD 3MRGB 3G6JF 3MV8A 4F2MA 1NDGB 4JE4B 1FDLL 5LQBH 1YMHA 2PYED 2HWZL 2VLRA 1ZK9A 4QRTB 1I8MB 1U8KA 3MJ7B 4NNXB 3FTGA 3NN8B 3JV5A 5IBTH 4FQJH 2QSQA 3PWPA 1A3RL 1TVHA 1B2WH 1OTUC 1I8LC 1G7MA 2QQNH 5E5MB 3VA2C 4M6NH 5HHVL 2NTSP 3C8HA 1ZXQA 5JW5A 1CICA 4LDOB 5IV2B 4YXKL 3SPVB 1FGVL 5CEYB 3D85B 2AGJH 1RUAL 4ZNCD 3O2WL 1SY6A 4ELMF 5BXFA 4LOUC 2Y5EA 1UZ6E 1E6OL 4J6RH 4U1SA 5T1DL 1CU4L 1A1OA 1VPOH 2AEQH 3T0DA 4Q9RH 1OP5K 3NACH 4JR9L 4HS3B 3UTQB 1QRNE 4X6CE 5D1XD 5SWSD 1EA9C 2R0WH 2Z93B 32C2B 3MRKA 2IPTL 4YNYA 4EI6A 2ZWLT 1IGFL 3MUJA 4MJIE 5FYJL 4K3DL 1B3JA 1NCBH 4JHZA 1T1YB 3ARZA 1IGTB 2C1PB 2YWZA 2GEEA 3NPSB 5K9KA 5J12B 3A0OA 1EAPB 5FYLH 43C9A 3FFCD 2YPLD 1PZUB 4N8VB 5TGBB 4KTYA 5HHPA 4JFYB 2QHRL 5DC9B 2BJML 1IQWH 3C60D 5D8JH 1J05A 2ICWI 1NGXA 1NFIA 1WISA 1JV5B 4LRIA 2Y06L 5E8EB 1JTPA 4B0MM 4KUZH 4M93B 2HJFA 3K1DA 1IKFH 2E9WA 1GHFH 3IB4A 1NGWA 5E2WH 3Q5YA 3QULA 3KLAA 5K59F 4NO2B 3P2TA 3BEVA 3HS0B 1R3HB 4KJPD 4YBQC 4ZFOA 3RVUC 2E9BA 4QHKI 3UO1H 2J4WH 3MRDA 3LZFL 4HIIA 1BIIA 5J3HC 5SWQA 1S78C 2BX5A 1FZOA 3VXRD 4AEIL 4D3CH 4FXLA 1IGYB 3RWJA 3VXNB 1L6XA 4ZNEA 1NBVL 1C8PA 3B9EA 3G5XB 1TTGA 1KIQB 4PR5A 3RVWC 4JJ5A 4XNUL 1HILA 2VZSA 4MQTB 2W1NA 4OQTL 1Q72H 5DFTA 4I9WE 4C56E 4G6KL 5HBBA 2ED8A 5DEZA 3V6FA 5CZXD 5BJTB 5GGVY 1U8JB 2HAZA 1HEZA 5F7EL 1GXEA 5DJDA 3KPRE 3Q5OA 4M5ZL 4UT9H 5ID0B 4OSUL 3HI1B 1K8IB 4YQXH 3MLXH 1QSED 2GK0B 1JHKL 5EOTB 1MEXL 2VNCA 4NN7C 4GJTB 3JV6A 3D85D 1RPQA 1RUPH 2NX5E 2JF1A 2FX7L 4HWBH 3BPOC 2A2QT 3BMWA 5F7MC 5K9QI 3CFJB 4WI2A 4F7CB 1T5XA 5KTEH 4ISVB 2D31B 3F6LA 3T1FB 3BP6A 1LDSA 4TRPH 5ADPL 4QOKA 3O6FB 1S5HA 3O3BB 2VLJA 4X98B 3QIBB 5DFVD 3NA9H 3NCEB 1KTDA 1BIHA 2YUZA 3DURB 1FFQA 1PG7X 4NOFA 4LLYB 3BDYL 3FRUB 2IPUG 4Y5XB 2RFXA 3RZWA 4XPGL 1HNGA 4JFDB 5JXAH 3LN5B 3QHTC 5FGBA 1EO8L 2GJ6A 3Q6FA 4HIJA 1KXTB 4DOHE 1ZSDA 1WBXB 3HUJB 35C8H 3UPAA 4AT6B 1P5VA 1DEEA 2NLJB 5FFLA 2A73B 3HZYB 4U1JB 3BVNA 4I2XB 4FQXB 4UQ2A 3SJVA 3QA3B 2VISA 1MRDH 2ZOKA 3LS5L 4JG0L 3OJDA 2JK5A 3IVKB 5D70L 1JZ3A 5B8CB 3NIFF 4OQ1A 4MCYB 1AJ7L 1OSZB 3LEYL 4AMKH 2AK4E 2EE2A 2HFEB 3KGRA 4H5SA 4ZDHA 5F6IC 3W11C 3Q2CA 3SDAC 2AJSH 1BP3B 1ND0B 3PDDA 4JRWA 5ESQB 3VXSB 2B1AL 3EHBD 4N0UE 4KKCD 1FSKB 3L3OA 4P59L 3PIQB 5DMKA 3T4YA 1F4YH 1IQDA 4OAWA 3A6BH 5C0BE 3KG5A 2X4SB 4Y5YA 1GGIL 2EE9A 3QXVA 4LBEA 1AKJD 3FRPA 1KACB 4MDJB 3EDEA 1DUYB 4X8JB 4R7DB 1T21A 3GKZA 3CFEB 3TVMB 3MV9D 1Q8MA 1JNJA 1X3DA 1NLDL 1QYGL 5B38B 2EC9T 5TE6H 3U1SL 1JYVA 3EOBB 3G5YA 2VQ1B 3QJHA 3BIAX 2ICEB 3RBSA 2UUDH 2GJZB 4JRXE 4X6DE 2NW2A 1BGXL 1CE1L 4PJ8C 3QNZB 1TCMA 5CINL 1BVLA 4XPBH 2EZ0C 5HVWA 1FPTL 4HUUA 4KY1L 3O3AA 4H0IA 2GT9B 3FONA 4JY4B 5D7LB 3UDWA 2PO6A 3RTQC 3QFJB 4WFEE 3UJTL 3FO9A 2H32H 2P8MB 2WBKA 3BE1L 1Y6NR 3MZGB 4OGXH 5HHOB 1MWAA 4RQQA 5ENWB 8FABB 2HLFC 1KT2A 3LKNB 4HHAB 4ZFFA 3WLBA 3K4AA 1F90H 4NHUB 4MJ2A 2Q7YA 1QBAA 2JCCA 1SMAA 4XXDB 4PB9L 5E9DE 3FB7B 4NQCA 1V3MA 2H45A 1JMZA 4ZUVB 3OKEB 1UWXK 4HIHA 4LKXA 25C8H 3BQUD 2J6EH 3VRJA 1L9MA 2OMBA 3QWQB 4ZPVB 3D3VA 2G60L 3O6FD 4PJDE 1FL6A 2GSGA 3QUXB 2XQBH 3RDTA 3QIBD 5E6ZA 2EDXA 4Q9CA 5KVGL 5EB9A 4DAGL 3NGBC 5H8DA 1MJ7H 4HUXB 5JXED 3WFCL 4YBHA 3UTTA 5I1GL 2E27H 4GXVH 1XGPA 4WO4C 1FYTE 1JGUL 4P9HL 5FUOH 4HFWA 4XNZC 3ARRA 5I1AA 4BH8A 1PJ9A 4FQXD 5I8OL 5ICYA 4XMLH 4YC2B 1U95B 1YNLL 1T7VA 4ERSL 1A7RH 1JGVH 1AGCA 1RUML 1MNUH 1YEKH 3BSZH 5T33L 4LVHB 5GRJL 2A6JB 4CDGC 1CI5A 2LU4A 3FB8B 2FO4A 4NZTL 1HI6B 1NCDH 3BKJH 4FG6D 4OLZH 4KI1A 3LQAL 1F97A 1JPST 4B5EA 1A1MB 4PUBH 4LVNC 5F88A 1WLHA 2C3HA 2AEWA 1TCRB 1XMWA 4GKZB 1TJHH 4R90L 2M2DA 4L5FL 1IC7H 4P4KB 4QRRB 4PJCB 4UOW1 1ONQB 5DJ0A 1IGMH 4JHBA 1CICC 2O5YL 3TVMD 2DLFH 1FLRH 3KYOA 3WXWH 3OMZA 3TCLB 4XCCL 5A3IC 4UDUB 4JRYE 3TYFA 1FVCB 1LMKA 1TNNA 4HH9A 1ORQA 3JBG7 2VDRL 4KMTL 3CLFH 4PRAB 3OKLB 3MJGX 1N0XH 3GSUB 3OR6B 4UILL 5IM7B 3S36L 4X6EB 5EBLA 5D72L 5JQ6H 1OARL 3LCYA 4PJEA 1QBML 1JNHA 4BQ6A 1IKNA 1DQLH 2VMFA 3QFJD 5MP6L 2YRLA 3DVGA 3QXDA 4JREC 3MYJB 3ZE2F 5HHOD 2KQNA 4YHLH 5D1XA 2H8PB 3IDJB 4G42A 4Q6YA 1S5IL 2WLYA 2V7HA 5HDQH 1Q9OA 2FZ3A 2CLZA 1N26A 1ZT1B 2GAZA 4X7SL 4HF5L 5AYUL 5LWYH 4AH2B 4FABH 1JBJA 3RA7H 5C0JB 2FD6L 2MCG1 3UPCA 3DVIA 5DEFA 1MHPH 2ADFH 1C16B 5GRZA 4WEBL 3KYNA 4NZUH 3VFMB 5HJ3A 2DI9A 1U3HA 3QUXD 2YPLA 4L8SB 2QR0B 3QDGE 4LRIC 1EJOL 3T2NH 2ZOLB 3C60A 3CIQA 5I74C 4TVPE 4MVBC 5HHXL 1A0QL 1AR1D 1ADQL 4ONFL 5I1HL 3VWKB 3G5VB 1QR1B 3HKFA 1WCBB 4P9ML 3GSWA 1JYWA 4NFDA 2EIBA 4UB0L 1MREL 1AD0A 5I8CA 4PP1D 1DQDL 4OCNC 3Q1SH 3QIUB 4QGYA 2DQEL 2X4UA 3RY5A 1MAMH 3EYFA 2VWEC 2C4XA 2AKRA 3FMGL 3BH9A 3OG4B 1G9ML 4X6FA 2X42A 5J6GB 3GMLA 2G9HA 3OB0H 1I3RA 2BC4B 2XXMB 4J4PA 3MRGA 1QHOA 2APFA 3GNMH 3R8QA 4Q0XH 1RI8A 1NDGA 4HC1H 2YD9A 1F4WH 5E8OA 5FO9B 1C1EL 1XGTB 5CEXB 1MF2H 1PD6A 1AXIB 1I8MA 4LFHG 1U8NA 1CN4A 1RUQH 4QRRD 4NNXA 3GGWB 1WWAX 3ARVA 3KNBA 5E6YA 3TPUB 3SN6N 1OAZH 4LSUL 1YQVL 5E5MA 4CNIB 4AY0A 5CAYB 3AC0A 5AUMB 3SPVA 4C55A 3BISA 1KCSL 2FBJL 4KJQD 3MA9H 1FORL 5CEYA 4MJ4A 1JGLH 1JRHH 4N0CD 1BM3H 1KEGL 3QDMB 5GS0D 2Y25A 5IQ7H 2G2RB 5GGSB 1AC6A 4PD4K 4RZCB 2YD5A 5DD0H 3LVEA 5C08E 2DQDL 2AV7B 2ZUYA 3P9LB 4V1DB 4AG4H 1T7YA 4KTDH 5TPWH 2CXGA 5FGBC 4L3EA 3S35L 1A7QH 3DX8B 4ZS7H 1CDHA 4EIGB 3DSFH 4PJ5E 2VXQH 1R6VA 3P4OB 1S9VB 2DLHA 1UVQB 1YECL 1T1YA 1NFDE 3DLQR 4WW2F 3F7VB 3UTSE 2C1PA 1DBAH 3ZTNH 2JJSA 4MNGB 1EAPA 3QG7H 4N8VA 5TGBA 4LSTL 1V8HA 3VMOA 3VG0H 5IGXH 2DQHH 1OF2B 4J3VA 1SM3L 3KJ6H 4GMSL 3KPQB 1ZGLP 1J0HA 2R9HD 1MIEH 4M9OA 2FLBT 2I24N 3VWKD 5I1IL 5CFHA 1JV5A 3SCMB 4Y5YC 2V9QA 5E8EA 4J3TA 1FNEB 1MFCH 4MA7H 4OV5B 5JOFA 2DKSA 4ZPTA 1WWBX 3DVNB 4BKLB 3NCJH 5IK3A 5I1LB 1VFAB 5T3XD 4NO2A 2MWCA 3QIUD 5CD5C 5ID1B 3HS0A 5T1LB 1R3HA 4F7TA 5CBEB 1LDPL 3FZUC 1G9NL 4IHOB 4MCZA 3MC0A 4PJIE 4KJWC 4QWWC 4OQTA 4HJGA 1KN2H 5EC2A 3LEVL 1IGYA 4BZYA 5IP4A 5F1IB 1B0WA 4K94C 1AQKL 5E2JA 3G5XA 3UDWC 1JZ5A 2PO6C 3SDYL 1KIQA 4CKVX 4M4PA 3BZFB 5HI3D 4UTBL 1T4KA 1CDIA 1QOKA 2B1HL 3O45B 3ZKNC 1XFPA 4Y4HA 3VGBA 3TBTB 1KCRH 1Z3GL 1JZ8A 1DUZB 5LXGL 4TQEL 5BJTA 5J8OA 1NKOA 3LPWA 4S1QL 3RWIB 1U8JA 2BXZA 4XMPL 2EICA 2OZ4L 5DMIH 4DKFH 1DFBH 5ID0A 4XVTL 5GS2D 3K2UH 1KPUB 1V7NL 5JHDB 1K8IA 2GK0A 3DUHA 5EOTA 4LAQL 3ZYJA 1TVBA 3MRHB 1JNNL 1MHCA 4ZTPH 3QDMD 4MX7B 3RDTC 2QV2A 1YEFL 3BJLA 3TYGL 5BCAA 3JWDH 1U41A 3E8UH 2HTLD 3RNKB 5TDOB 4F7CA 3GI8L 4ISVA 2D31A 3INUH 5CIPH 1OTTC 3T1FA 4KFZC 4M00A 4C4KT 4UTAH 5KG9A 3ULUC 3VXME 3O3BA 3PV6B 4V1DD 4X98A 3QIBA 3N1PC 3WMSA 4BJLA 4X7TB 4LLYA 4ZS6C 3IRZA 2W9DL 2IANE 4Y5XA 1XH3B 5JR1H 3QEQE 2R1XA 4JFDA 3LN5A 3K8LA 4MNHA 5HPMB 2X4TB 4XCEA 1WBXA 4AT6A 4JPIB 3IDGB 5EUOE 2A73A 4U1JA 1CQYA 4I2XA 1TENA 1OP3H 3KYMB 2QKIA 4PV9B 3IVKA 3GHEL 2BRRL 4GAJL 5HDLA 4O9HH 5B8CA 4MCYA 4GRWE 1OSZA 5K9JL 1X9QA 5HDBF 2HFEA 4J3WA 4X6BB 1R0AL 4TUOB 2NXZC 3MJ8A 4PRBB 1ND0A 5ESQA 5FOJA 3BAEL 3HE7A 3SCMD 5IW6B 3V5DB 3VXSA 1UWGH 1ZHKB 4OZ4A 5TDNB 2H26B 5CP7A 3PIQA 3QRGH 5I1KH 1HKFA 2DOCA 2X4SA 4EUPB 4NZRL 4GH7B 4UINL 1L4IA 5T1LD 4ZUSB 3VMNA 3V5HB 1WFOA 3CD4A 1DUYA 1T6WA 1QR4A 5H2BA 4WUUE 3CFEA 4FRWA 1KOAA 3U4AA 5BV7B 4RDQG 2WSKA 5B38A 4CBPA 1MCLA 4MAYB 3EOBA 2VQ1A 2ICEA 3LN9A 1FN4B 1TZGH 4NM4L 1IKNC 4X4XB 4UNUA 4NHCH 1AHWA 1UCTA 3MRNB 4HIXH 5BV7L 4N5ED 5A16B 2GT9A 4JY4A 5D1XC 1EZVX 1OPGH 3QZWB 5D7LA 3PV7A 1N59B 1QNZH 3QFJA 3QWOB 1KTKE 4E42A 2AXFB 5F1OB 1AQDB 4JKLA 2P8MA 5TFSL 3AFLA 2BXYA