4EXPX

Structure of mouse interleukin-34 in complex with mouse fms
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
283
structure length
283
Chain Sequence
ADPAPVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-34
publication title The mechanism of shared but distinct CSF-1R signaling by the non-homologous cytokines IL-34 and CSF-1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cytokine/transferase
total genus 36
structure length 283
sequence length 283
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00047 ig Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4expX02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4expX03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4expX01
5JHDB 1NFDF 4F15B 4JPVL 3MBXL 1IM9A 4PJFF 1XCQB 4PBVC 3TV3H 1KCRH 1D3CA 4OKVA 2AXHA 1AI1L 4M5ZL 5H94B 5GRXG 1ZT4A 3U48A 4F57H 1ROWA 4Q2ZA 3VXMA 3MMEA 2DM2A 4Z77A 3LRHA 1DQQB 2F74B 3O11A 3RX5A 4WO4D 2X4PA 4I3SL 2AJZA 2RJMA 3HZKB 3MZTA 1MEXL 1MCEA 3REWB 3QFJE 3ZDXE 5D70L 5LJYH 5J89A 4P4KA 2ZOLB 2QSCL 2W0FB 4MZ2A 4O9HL 5CJBA 4P57A 2BSSA 4D0DB 2Y5EA 4JLRB 1WFNA 1B88A 1K8DB 1PBYA 2KZWA 1KENH 5JPMA 3L3KA 2H2SC 2Q8AL 1HHJA 4H20L 2CDGB 1NGQH 4C56D 4PJ9D 5SV4A 5FEBA 1ORSB 4KV5E 4O2CA 3U0PB 3LPGA 5KVFH 1OAUH 4F58H 3QJFB 5FECB 1OAXH 4GAGH 1K9TA 2BSRB 2BY1A 1QKZH 4U2YA 2QLVB 4X9IA 2ZOKB 2MKWA 3BOVA 5I8CA 1DBKL 5I74C 1F58L 1K4DB 1YY9D 4R7DA 3DO7A 1E4KA 1GGCH 2ESVD 2Z91A 3TT1L 4MA3A 2V5RA 5HGAB 3UTSD 4MS8C 4DUWA 4QRQA 3FN0L 3ZTJG 4G8GD 5MHSD 2AKRA 2NY7L 1P4BH 1L7IL 4ZS6C 3CVHB 1JRHL 2E7MA 4WTZA 1FYTD 4BSVA 4N90E 1XH3B 3BQUA 5D1ZA 2ZG2A 3GSQB 3VFRA 3G6AA 4ELMB 5DRWB 2EIDA 3WFHA 4PJAA 4JREB 2HTKC 4DN4L 1XGPB 2R29L 2UUDK 4D9QE 2X10A 4U0RB 2X1WL 1I3RA 5MEOA 1IGCL 1WEJL 1YEHL 3NACL 3OR7A 3SO3C 4U1GC 1BREA 3O9WC 5FDYA 4U7MA 3IU3B 2AS5M 4O4YL 2DKMA 3ROLB 1M7IA 2FX7L 4OLYH 4QY8A 1ZEAH 1NLBH 5DJCB 4LNRA 1KB5H 2HT2C 1Z5LB 1OPGH 2DWEA 4UQ3B 1NFDB 2RCSH 1RZ8B 3ULVL 2R2BB 1I7RB 4AQ1B 4PJFB 2R1XA 3S37L 5DHVB 2EIBA 5T1DL 5FYKE 2E7LA 1RZJH 1V3MA 5JZ7D 2DS4A 4OGXH 3GRWL 1XF3A 3BI9X 3L3IB 2QHLA 5FF6B 3VW3L 2DOCA 2BFVL 3MRCA 2XZAH 1W0YT 3HE6C 3RWHB 3SGJA 1Q9LA 5JW3H 4F7TA 3BP4B 1JZ4A 2IAND 3TO2A 3B9KD 3O4LA 1UEYA 3GSNH 4WU7B 4YFEA 5KSBF 2R9HD 1DVFC 3PWJA 1UJTA 4O2FB 4UAOB 2BVQB 4S1QL 3WNLA 3CC5B 1BZ9B 3RGVA 1V7NH 4IRJB 4JE4B 5F1IB 5F7HA 3TH4T 2WAHA 4HCRL 3D69B 4RDQF 1J1PH 3MV7A 3R0MA 1XZ0A 2Y06L 1EV2E 4HBQA 4K8RH 4HKXA 5C09D 4I13B 1NBZB 5F7DB 5BQ7A 2X4NA 1JPFB 3LEYH 5F7EL 4YXLH 2YXMA 1FP5A 2DQGH 2UV3A 1FN4A 4HD9A 4HC1H 3W82A 3CLFH 1S78C 3QI9C 4N0FB 1T83C 2M26A 2NY2D 2IG2L 5CJ5A 5AAMA 1KN4H 1TCRA 2Y25A 3TJHD 1Q94A 4ODUA 1FO0L 1I8IB 1CWVA 3WUWG 1WWAX 1KFAH 4F7PA 3QDGD 4GRLB 5GGSA 1G0XA 1MJ7L 3BP6A 3VXOB 5H2BA 2BVEA 3FTGA 3RWGB 3ILQC 5F9OH 5T1LA 4G43A 4XPHL 2VDPH 5HDQL 4RQQB 3TC9A 3KPLB 3MRFB 3QUMA 2JB6B 1T1YB 5CIPB 1QHPA 3W0WE 5IMOB 4LASL 4RGNE 3NZ8B 1YN6A 4I18C 1T5XA 4WY7H 3MRHB 1N5AB 1G9EA 4JFXA 1ZGLB 4PJHE 2X4TA 5FOJA 3I3DA 3HE7C 5L2KE 3K1DA 2OCFD 4NBYB 1WBYB 3A6BL 4P59H 5EU4B 4NQEE 4M7LT 3CX5J 3MLRL 1CDHA 3TBVA 1JNJA 4EEEA 5ICYA 4Q6YA 2DKUA 2FNBA 4R4BB 1IQWL 1JP5A 4Y1AD 1IAMA 2AJVL 1RZFL 4HJ0C 1FVEA 1FE8L 2BOBA 5IGXL 1RFDL 3ARED 1N64L 2XWTA 3HAEB 2EXYC 2P24B 1A7RL 3TGXA 1MOEA 3ORJA 4ZYKB 3GNMH 5BW7C 5HHQB 2I9LA 1CDYA 4JKKA 2VLKA 5D5MA 3TO4D 3KNBA 1UXWB 4E42B 5ICZB 5CHNA 2OI9C 2ZCKL 3WDHA 1ZA6A 2J4WH 5ITFB 3S3SA 1IGJA 2JJSC 5BRZD 2AXFB 3DXAE 3CU7A 4BFIB 5A40E 5HJ3B 5KSBB 2WUBL 1IC4H 3S5LA 4P9HL 1DLHA 4DZBA 1EA9C 2G2RB 1IM3A 5GISL 5EWIH 5GGTL 3RVUD 3QWRA 4KROD 1XF2B 4PV8A 1HXMB 5DUBB 4NHUA 5B4MD 5KN5A 4YHZL 3MPCA 3G5VB 4JJ5A 5E99H 4EI5D 4YHIA 2CLVB 3DJ9A 3FQRA 1W72H 4I9WD 2CKBH 4GMSL 4M1CC 4FABH 1OL0A 3WXVL 2VABB 3GBMH 4HIHB 4LRNL 3PWPE 5INDA 4O5LL 4U6XB 2J8UE 1N5YH 3ESUF 2IQAB 4MXVE 1OGAB 3IXAB 2HTLC 5KVEH 4UT9L 3OAZK 3IJSB 4HG4K 4UNTA 4XPAL 1YNTA 4KKCC 4LAJH 1NBYB 3BAEL 4PRBA 5AZ2L 5KVMC 3RVXC 1J8HD 4GLRH 4PGBA 4OV5A 2DMCA 3BZFA 1MAMH 4XNUL 4JN2B 4DFHA 4KUZH 5ILTL 1UWEH 3QPQD 1RIVH 2LVCA 5DD3H 3QEQA 5E6YA 3MA9L 5D1XC 4BZYA 2EECA 5AD0A 4W81A 2WW8A 1TZHA 4QHMA 4L5FL 5IB5A 4QXTA 2KZ1B 3GHEH 1X3DA 2XZCL 3LRSB 4MD5B 1FZOA 3V4PH 1RQ5A 1JGDB 5D7KE 2X4OB 5HPMB 3WO4C 2ARJQ 2D7TL 3P0YH 2A9ML 4X7SL 1IEAB 4JFYA 3K2UL 1E6JL 3NFNB 3CZFB 3FHQA 4TRPH 1IVLA 1MVUA 1CU4L 4JO3H 2AABH 5IEKA 3ZDXF 2YA2A 4OCLC 1MF2H 3Q3GB 1UM4L 4X80L 3O2WH 4HLJA 2G60H 2W65A 4TVPD 3PWNB 2YBRB 3IJHB 4G6AD 4FG6C 4ODHH 2ZKHH 4NWTH 2XV6B 1A6WL 3TBYB 4KC3B 1CTNA 2VXVH 3MRLA 4U0QB 4NSKB 2KUTA 1HWHB 4X4XA 2C3GA 3HR6A 4CVXB 3VI3E 4KV5F 4JHWL 2HWZL 4IS6B 2NY6D 3FL7A 5E8OA 1HYRC 4N0UB 1INQA 4LLMB 1T2QH 3PQYA 1SMOA 4LARH 4ODWA 5I1AA 4U1HB 4LSSL 2P46B 3H9HB 5KG9B 1WV7T 4H5SB 4EOWH 3QWQB 1PG7X 2DQTL 1DQLH 1CGUA 1I9IH 1NFIA 2DI7A 1OP5H 5DJAB 2FH8A 3ALXA 3P4MA 4P2QB 4IOFD 1IE5A 4ORGB 3NBNA 4JREC 6FABH 1ZK9A 4TQEL 3GDBA 4QHLA 2E6JA 2YWYA 4G9DB 2AEQL 1YEJH 4P23B 1YPZA 3EW3B 5HYJB 2VLJE 3T0EC 2OLDA 4YFLF 4TPRL 4MA7H 5DC0A 1S8DA 2EO1A 3SDXE 5F6IC 1FNHA 1PZ5A 4D3CH 5D7LD 4JZOA 4OZFH 2A77L 4OZGA 4KKAD 5I1HH 4NQSA 2X5PA 2FL5B 4LCWA 3ULVE 5IW3A 2KH2B 5DMYA 1S7WB 3KPMA 3VU2A 4HT1H 4G8EB 1CFNB 1XGQB 2ICWA 1EGJA 4P99A 5AWNH 2XWBB 3ARBC 3FO1A 1UG9A 1IAOA 5L2JB 5EZOL 2R1WA 1BLNA 3H0TB 5KBNC 3AMKA 5JQ6L 4R90L 3VWJC 4OLUL 1V7MH 3MTRA 3MROB 5DD1L 1UA6L 3B9EA 3BJ91 15C8L 4BELD 5LGHL 3BYYA 4R7NB 3G9VA 3W2DH 3BW9B 3ZKSD 2J2ZA 2DTSA 4JKPL 2VXUH 3PL6D 2X4SB 4NCC2 4BZ1L 4IRSC 5J8OA 3ARXA 2E8YA 1E4XI 1NQBA 3BH9B 2Q86B 3QQ9C 1CD0A 3UYRH 1KJ3H 3QCTH 3VXUD 3ZKXC 4MXQD 4CMHC 3HMWH 2DRUA 2YPLA 3L3OA 4JFFE 4MNHB 3D9AL 3DECA 2H32H 2Y7QB 3QFJB 5C0DA 1QFWI 4ODBD 4Y4FC 3BSZH 3O2DA 3O3AA 4RX4D 4HJGB 4JHZA 1M7DB 1EO5A 2F74A 5IFHL 3QIBD 5D7IA 3TZVD 4HFWB 1EFXD 3OR6A 3FB6A 3REWA 4PB0L 1U3YA 2VDKH 5E5MB 5E95B 2N56A 3F8UB 1K4CA 1BIIA 2XQYK 3R06A 3LOWA 1S9XB 2Y5TB 2CH8A 4GRLC 2Q6WA 4HIXH 1MFAL 4ZUVA 1KCLA 1N7ML 3FFCD 1IGTA 4X6CE 1XCTA 1XR9B 4D0DA 3DVFA 3MOQA 4NO0B 2OL3H 5ALCH 2VKXA 2YC1B 4M1GL 4U1IA 3FQXA 3GFUA 2CK0H 3U0PA 2XNAB 3HB3D 3ARYA 1CD1B 4OZFG 3SPVA 2FX9L 3WCYA 1Q0YH 4LHUB 1S7XA 4JG0L 5EBMB 1NC2B 1SEBB 4P2RA 5D7SH 2EDKA 2ZOKA 4D94A 3AFLA 1EDQA 1SEQL 4Q74A 1RZGA 3IFPB 3T04D 4BSWB 1CZ8L 1WZLA 5C07E 5MI0C 1FNSH 4HIEB 5ISZD 1XGUA 1OSPH 1GGBH 4PJHF 1CLCA 1DSFL 5I1KH 4W6XB 4NC2B 4WRLA 1YNLL 4Y16B 3CVHA 3GSVB 5DA0B 5GRVK 1XH3A 1JNNH 2CIKB 4HPYH 2W60B 1K2DA 1ZAGA 4ELMA 4FQJL 2WBJC 4LAQH 4UIKL 3BIKA 3QHZH 2NY1C 1KIRA 4C57C 1KSRA 1C16B 3K3QA 3U4BH 5IMMA 1MNUH 1UJ3C 4QLRA 1YYMH 1EIBA 4EDWH 2DLGA 1FCGA 4G6FD 4ZFGL 3OHXB 1S5IL 3DGCR 3F7YB 1W0WB 1KEMH 3ROLA 4WWKD 4AEEA 3F6LA 5DJCA 1Z5LA 1RZ8A 4NNPL 5KSUA 2RHEA 4CNIB 1P84J 1P5VA 2R2BA 4PJFA 3EJZC 3GMNB 4MXWL 1CR9L 4WO4C 4HS3B 4PP2B 1H0DA 4F37F 5A3ID 3L3IA 4JZJC 3X14A 1YEIL 1KC5L 4L9LB 3UC0L 3MLVL 1KEGH 4UB0H 4LBEA 1JZ8A 3VXRD 4MA8L 5B39G 1JTOA 4G7YH 1WBZA 2N4IA 3TA3B 5IEHA 3FMGH 1QSZA 3RIAF 3WHE0 5FYJD 4O2FA 4MA1B 1I8LA 4F9PC 4NO5B 3CC5A 4JQXC 4HGKC 1V5JA 1TETL 3D69A 1VA9A 4UU9B 1Y6KR 1LK3H 1F6AA 2LTQB 5M95B 5B38G 2J8UF 4PJ9C 5JLZB 3MXWL 4MXVF 3MOAL 3OGCB 1NBZA 1U95B 1BBDL 4CW1B 3O6MH 2X2YA 5IF0B 1FBIH 1HNGA 4DQOL 1QZ1A 3BKMH 1S7QA 2FIKB 2OP4L 3BPLC 1KYOK 3SCMB 3UTTD 1OARL 5IUSA 5EOCH 1YY9C 5I9QB 1XGRA 2MCG1 3VFOB 3W0WB 3ZHLA 4RGNB 5FHAL 3T1FA 4Y2DD 1TQBB 2DTML 5GGUB 2CJUH 5L7XH 3HI5H 1JF5A 3DSFL 4NQCD 1URLA 4RQQA 3X11B 3U2SB 4MMXC 5HHOD 1YNKH 1H3VA 1T1YA 4ZAKB 3U46B 5D96B 4PJHB 1A4KB 1UCBH 5CIPA 5GRJL 5L2KB 1WFUA 4N8CH 5J11B 1RUMH 4HWBA 3L3JA 5F44A 3R1GL 4NQEB 2R56H 4G42A 4JDZB 4M4PA 3WHE1 4G7VL 4B7LA 1ZGLA 5E2TL 1C1EH 1NKOA 5D6DC 2HVKA 3TWCL 7FABH 4L8SB 4G8IB 3QDJE 5ERWB 1IRAY 3RL1A 5F21B 4NC0B 2NXZD 5D2NC 4U6YA 1LQSR 3V6OA 2Z8SA 5T5NF 3B9AA 1OW0C 3B6SA 1HEZA 2BJMH 3OKNA 4R4BA 1U8KA 3EYVA 1BZ7B 4JAMA 1NEZG 3L3GA 3GK8H 4GBXA 4OJFL 5CSZB 5IBTL 2CMRL 2DL9A 1U3HB 3UBXA 4PG2A 2R2EB 2E9BA 1A3RL 3VI3F 4XPGL 1IAIH 2Z35B 3HMXL 3DXAB 4YDIH 2ZNWA 1QSFA 5SWSE 3F58H 1WICA 1UM5H 3GM8A 5GS3A 3UROR 3WIHA 3NA9L 2R9HC 2MCPH 3WUZA 1QEWB 1CN4A 1FJ1B 4AEIL 3ZZ1A 2FJHA 4QRSB 1QLEL 4M9OA 4PRID 3SKNA 3IFNH 2I60H 5HJ3A 4S1DC 4J3WA 2AEIT 1YDPB 3Q6FA 2G2RA 4CU6A 1FSKB 1QG3A 3ARDB 1YQVL 4GG6A 4I77H 4M7ZB 4RFEB 4QHUB 5GS1A 2J8UB 4NQVB 4MJ6B 5DUBA 2GJZB 2Y6SD 4I4WB 1LD9A 2QL1A 3SDXF 4I2XE 5J57B 4LPWA 3TJHC 4LLYB 4K3DH 3NCEB 5EU7C 1OWRM 1OP3H 5DVMA 1DN2A 5IVXE 4NNYB 4WHCA 1MIEH 2PNDA 5I15L 1BM3L 4DAGL 3RFZC 1YJDH 3ULVF 5C2BH 1HQ4B 4U6XA 3EYUH 2DN7A 4RFOH 4OT1L 1QRNE 2APFA 2DQDL 2PETA 2XZZA 3VWKB 5J13B 5ESAB 1WIPA 3FKUS 3B43A 1IEHA 2O93L 4HDIB 5KANI 4RRPA 1UACH 1NBYA 2ED7A 3H9SD 1X44A 3IS1X 2JB5L 5FGCE 4LVOB 4Z7NE 4JN2A 4YXKH 5D71H 5D8JH 2BNUA 4U7SA 3LN4B 1DUYB 1FNEA 4KWUA 1D7FA 2APBA 1R5VB 2GYSA 3SDYH 1EHXA 2HMID 4X98B 2APTA 3L5XH 3L6FB 3MLZL 4AK1A 1ZANL 3KS0H 3AGVA 1RUAL 4QWWD 3WL9B 2IMMA 3GSXB 3MLSH 2WLYA 4XX1G 3L1OL 1RVFH 3ZDZE 4BK5A 2FR4B 5FV2A 2HP4A 1KB9K 3RZCB 1AGBB 3QFDB 4MD5A 4P5TB 3QT2A 4LF3A 5DTFB 1JGDA 4KJWC 3VXQB 4JY6A 3ZYOA 1WK0A 1Y18B 4HUXB 5HPMA 1UM6H 4AEHH 1QSVA 1IEAA 1EEYB 5F89B 2CDFB 4K55A 3JTTA 2A1WH 1NANH 3TCLA 4JQIL 3BN9D 1NAMB 4LL9A 3RUGE 1XF4A 3TO4C 3Q3GA 5FGRA 1R5WB 1EO8H 1Y0LB 3FQNA 4QXUH 1TTFA 3RKDD 4ETYA 2ERJB 3BPCB 3IJHA 4JB9L 4PREB 3ZKMD 4X6CF 1SBSH 2J88H 3PDGA 4HWEL 2OJEA 1E27A 1G7LA 2L7JA 3MRQB 4G8FB 5DC9B 1B6DA 3N9GH 1N6UA 4OCXL 4NSKA 4HQQH 4C56E 3P30H 2YD2A 4OLZH 4GW1B 5FYKU 5KSAB 5JPNA 4IS6A 2HYMA 3OXSA 4PTTB 4LLMA 4WNQA 3RWJB 1RIHH 3RWDA 4U1HA 4TVPL 1YMHB 2NY5L 4LEOA 5B4MC 4QTHA 3IXTA 5KG9A 3MFFB 5IOPB 4EI5C 5FK9A 4JFDD 2C4FU 4OCRH 4WFFD 1G7MB 5HVGB 1WT5C 1TJHL 3MFGB 5T3XE 2PKDA 5DJAA 2VLJB 3RY6C 4JR9H 1U42A 4HBCL 3SDXB 4F7MB 4XPFL 2JJUA 4MNQA 3RX8A 1A0QH 1I9RL 1N6QL 1MCNA 2JJTC 1FYTE 2P8PB 3SGEH 5E9DD 1FC1A 3QIUC 2VRAA 4URTB 4ONHA 3W9EA 1S7TB 2DBLH 5EBLA 2RBLA 4Q0XL 5BS0E 2ZCHH 1R3KB 1Z3GL 2BHYA 3P9WB 1KGCD 4E41B 1EJ6A 3WJJC 1P7QB 3PDDA 2FSEB 5SWZD 5GHWL 1PFCA 3JV5A 1OAZL 4JY4A 1D6VH 3HNTH 2YMXL 4K94H 3CLEL 1CFNA 3RTQA 4R0LC 5E8PB 1PZUB 2DIJA 4FFZL 1XMWA 2NZIA 3N1FC 1ZLWH 4YHOH 4OZHE 4Y4KA 4ZUUB 5A2KH 1WIOA 3TJEL 3GMRA 1GAFH 4H26A 4U3XA 3H6JA 2ADJA 4PV9B 5B3JE 2Q76B 2GW5A 2PYED 3MV8E 2APVA 2A0LD 3NA4A 2VOTA 4JFFB 5T33L 3DYMA 5CWSA 4MJ5B 3RAJH 2C7UA 2DM4A 2Q86A 2PW2B 4JHAL 4PJXA 1FFPB 1N2RA 2LTQC 1DR9A 1VFOA 1EBAA 2NY5C 5DJYA 1I7TB 4G6AC 4QF1B 3GJFK 3NCYP 5LXGL 5JUEL 2XTJE 4FP8H 2R8SL 3AM8C 5KZCD 2PTUA 4ODVL 1M7DA 1WZ1L 1N3NA 1MREL 5C09E 4X6CB 5GRVL 4JFZH 5CILL 3TPUA 5E5MA 4U1MA 3K81A 2BSTB 3VFMB 2NY6C 3LEVH 2RQ8A 4UTAL 3QG7H 3AROA 4YE4H 1J7VR 3H3PL 3QZWG 5C0FB 4H1LB 4LLQA 1YMMA 4RGMB 3DV6B 3QAZB 1X5XA 1XR9A 1OTUD 1YEKL 4R4FL 5EU5A 4NZUH 4Q9BA 2FO4A 3QDGE 1FORL 5JW5B 4IOFC 4HKBB 1R5IB 4NIKB 4R26L 2F5BH 3IVKA 4E5XA 1QLRB 2OJZL 2XNAA 1CD1A 5C07B 4JGMA 4IMKA 2AI0H 4K2UL 3LQZB 5I73B 1MI5A 3ZYJA 2VDRL 5EBMA 1SEBA 5CINL 4PD4J 3PXHA 2MWCA 3GGWB 3FT4B 5DQJB 4KKAC 5IVZA 1L0XA 1I85C 4FS0A 3C5JB 5FB8B 2PTTB 3FCTB 3S34L 3QNZA 2QQLL 4JO4H 3CAFA 2WBKA 1T7YA 1EK3A 5CS7A 4P4RB 4CU8A 4JPWL 3OF6D 2Y4SA 1MRCL 4IRZH 1KN2H 1NJ9B 3GSVA 5K59E 1R0AL 2QADB 1A7PH 1DQML 3EJYD 4ZFFB 2W60A 5FA4B 2XN9E 4HKZA 5DEZA 4ZTOH 3S98A 1X5FA 4MDIA 3WXWH 3BKYH 5IMLB 5CEYA 3MV9A 5KVGL 4ZODA 2P5WE 1QBLH 4K8RD 3PL6C 3QXTA 2H3NB 5IW1A 3GSWB 1JPST 2EYSB 1R24B 3WSQL 5F97E 4Q6IA 3IB4A 5T1KD 1WCQA 2AJXH 1ZLUH 1U8MA 3F7YA 4S2SB 3BKCL 5JXAH 5JMOC 3GUTA 2FIRT 4AIZB 5LWYH 2R69L 1ADQH 5ACLA 5FGBA 5HI5D 2J3SA 3FB8A 5GQBA 5IB4B 5J6GB 4NNXB 2F5AL 1ZLSL 3PWVB 1NCWH 2IJ0C 1HQRB 5JR1H 2OMNA 5BRZE 1M05B 4GAYB 1BZQK 4PLJC 5DDHB 4LSTL 4XWGH 4XCYB 5GGSY 3NTCH 2YR3A 3GMNA 4HS3A 4PP2A 1UQSB 3QIBC 3SQBA 3TZVC 1ZHNA 4W6YB 1YZZA 1CGYA 1UYWL 3DVGA 1VEPA 1HKLH 1GGIH 4L9LA 1N4XH 3MJ9H 3T8XB 1C08A 2HFFB 3VD9A 4IDLA 3SY0A 3NCYS 5CBEA 3EYQC 3BXNB 4NO5A 5IVXF 1ACZA 4MAUL 3OAYK 4Y4HD 2EDDA 3FT2B 4JY5H 2H2PD 4LSRL 4LVOC 4JO2H 1MWAB 1U93B 3OX8A 1K6QL 1U95A 4X6EA 1BFVL 3MGTB 3G5XB 4UV7L 1MHPL 5I18H 1RUPH 3AY4C 2W9LA 5FYJL 2GY7B 4WENB 3V95A 5DD0L 4TVSa 4Z7NF 4OAWB 5F3BB 3EO0B 1TPXC 4PJEE 3VFOA 4M6ML 3U4EA 3B2UD 3NOIA 4MCZA 4NJ9H 5ESQB 5GGUA 2NX5D 1B90A 3X11A 4KRLB 3U2SA 4OM0L 3MRPA 1PG7L 2Z92A 3QCVL 4PJHA 3ZDZF 1AKJD 3WFCL 4WJ5B 3QDJB 4R2GB 4JEGB 3MSPA 3U30C 3ES6B 2H9GA 3QUXC 1LDPL 1AQKH 4W70A 2J5LC 5FO8B 3DUSA 1FFQA 4L8DB 3SO5A 4YR6A 4YBLB 2YPKA 2OZ4L 43CAB 3TN0B 5HYIA 2W92A 2W9DH 3VH8A 2Z31B 4DN3L 2A6JB 2A6DB 3SJVD 2C3VA 3DOSA 2EE2A 4WWKC 3RUGF 3ZMRA 2IQ9L 1I9EA 1DFBL 1I1FB 2UZIH 3QIWD 4M43H 4O2EA 2E6PA 3SGKC 4RA3A 1YEEH 4XNXL 1BQLH 2HFTA 1AFVH 4LCYA 2FDBP 5J56B 3GB7B 5CSZA 5SWSB 4FHBD 1DN0B 4WUUE 1JGLL 1RUQH 4PJDF 2NW2A 5A3IC 1UVQB 3C2AH 1OAKL 4V1DA 1MFEL 1BEYL 5GGVH 2P49B 1U8HB 5JOEA 2NR6C 2VLMD 1VESA 4YHLL 3DXAA 5BJTB 1VGKA 5K9QG 4KI1A 3HUJE 4QKXB 4MNGA 4YFDB 2FD6H 2WUCH 2PO6D 4PGCB 3EUUA 5ANMA 4GW4B 3HPLB 4OQTH 4CVZA 3UZQA 4QRSA 2HKFH 2I07B 4KY1H 4F8QA 1AY1L 3SGDI 2P48B 4I2XB 1YDPA 3HNSH 3KR3H 4Z0BL 4BZ2L 1EFQA 4X9BA 4A2MA 3OKMB 5A1AA 2HFGH 5IVXB 5IWLC 1A64A 3ARDA 3HG1D 4XP1H 5DMKB 2XWJB 1FL3B 4PTUB 1A8JH 5J1AB 3PWPA 4UDUB 4EN3B 3UTQB 4YJZL 1WBXB 3MNZA 4XP5H 1FAIL 1QRNB 1OAYH 3V0WH 5I8KH 4BA8A 5C6TH 2LFGA 3LZFL 5DJXA 1HH9B 2X89A 4PRDA 4O02L 4G6ML 3VRJB 5FGCB 5E4IA 2KQMA 1LHZA 3P4LA 4DGVL 3SOBH 3FQTA 1G7JB 5ESAA 1RULL 1D5ZB 3LKRB 4FTVA 4J8RA 4OZHF 4LKXA 4UNVA 1Q0XH 5EORH 3O9WA 4QHKJ 3PHSA 2ZUUA 2XXMB 4TULH 1DEDA 4JKLA 3LHPL 1HHHB 1XEDA 3LQAL 1ONQB 1AGFA 2GT9B 4DK6A 5C0BB 5B3JF 2VAAB 4I0PD 2W0PA 1SJEA 2ZWLT 4BQ6A 4A6YH 2E7HA 4UTBL 1PVHA 3DRTB 4EUPA 1HINL 1J5OH 4JN1H 3B8SA 4KH2A 5SWQB 2NXZC 3WL9A 5IBUG 3RA7L 3UYOD 3F5WB 5DJDA 4Y2OA 4HUMB 4HULB 2FR4A 1S7UA 5I30H 1UC6A 4PB9H 3QFDA 3NFSH 4P5TA 2WIIB 5T5FL 1NGPL 3HE6A 4RZCA 5ACZA 2DF3A 2KKQA 3VXQA 4KU1A 3QNYB 2FWOA 1KJ2B 3RUGB 3DBXB 2OK0L 3I3BA 5ECJE 4PJ5A 1I1AD 3PWUB 2OTWA 2AQ2A 4NKOB 1NBVH 4XMKH 1DDHB 1LEKA 1F4XH 4OZIE 1HSAB 4ZFZA 2E3VA 3QUYA 5E2WH 4NKIH 4PJDB 1I8MA 4DEPC 5H35A 4RBPH 1R5WA 4TUKH 1II4E 3UJIH 5JW4R 1TNNA 4KKLC 1EZVY 4OCWH 1DBBL 5FUCE 1BFOB 3QHFL 4UT7L 4KK6D 5K9OB 3H42L 2F53A 5J12C 5H8DA 1HZHL 2YPVH 4OD3L 1MJUL 5ADPL 3LS5L 2A6KA 1A6VL 2A73B 2UVEA 3QI9A 4ZPVB 3O6FD 5LCVH 1D5XB 5EFIA 3MUY1 2VQUA 4LPXA 3MLXH 3I2CH 1MY7A 3MA7B 2XA8L 5C0EB 4H88L 1QFHA 3LKOA 3MRGB 2X40A 5E6ID 1CDIA 4TSAL 5GS0C 4HXBH 5IOPA 2R1YB 4YH6A 1U2HA 5IHUL 3QR2A 1S5HB 3HC3L 2V9RA 3LQAC 5EIIA 2VLJA 3OAUH 1BJ1H 1PGRB 5HGGS 3P4NA 5AEAA 4ERSL 5BS0B 1BJMA 2ZPKH 4I18A 4GLRI 3SDXA 4F7MA 4HUUB 4ZD3L 1S7VA 2A6IB 4XCNB 3QCUH 1MLCA 2IPKA 3D2UD 1LNUA 2GUOB 3WIIL 2OTUA 3D39E 4NQDE 4N68A 2AJSL 3RNKB 2OR9L 4BFGA 2VZ3A 4GG8A 1R3KA 1MUJB 3GRWA 4FZEH 1AHWA 1NMCB 4OZHB 2FSEA 4NQTA 3A67H 1YN7B 3FAWA 2HMIC 5E00B 2AEPH 3ARSA 3CVIH 2OS7A 4X9FA 3KLHC 1T5WA 1A5FH 5C0IB 1D5IH 4F3FB 3TV3L 4OFIA 1KCRL 4QWWC 2EICA 2QQNH 3MV8B 4HCRA 5CP3H 3W9DB 4F57L 1W0VB 3RY4A 4HZLA 4IIQC 2AK4D 5I76A 1SM3H 2FEEI 3GMLA 2QR0A 3MCKB 3RPKA 3VXSA 4PV9A 2C1PB 3B9KB 2BVOA 2FO1A 2AXJA 5HYSB 2ID5A 2XTJB 4K71C 1CDUA 2V9TA 1KG0B 3BN9C 3MZGB 2PW2A 2VDLH 5HHME 1FO0A 1PKOA 2IEPA 1AIFB 2JK5A 3DX9B 3ZE0E 1CGTA 2CXKA 1FFPA 3PGDB 5C09B 3Q0HA 1KENL 3Q5TA 1I7TA 3Q6GH 5FYJE 2G9HB 4KUCD 1NGQL 2P8MB 3D6GA 3EAKA 3ZE2E 1HYSD 1WAAE 5IB3A 1A6ZB 5D7JD 5C08B 5AG8A 2I5YH 5KVFL 1OAUL 1Y6MR 4QCIA 4F58L 3VFWB 1OAXL 3VFSB 1HHGA 4HIIB 4GAGL 3CXDH 3LKNA 5GJTH 3P9LB 1QKZL 5D6CA 4XAKD 2LU3A 2YUWA 1UB6B 5D72H 3SDAB 3N85H 4OTXH 2VKWA 4U31A 4ONFH 1CICB 1GGCL 2BRRH 1KT2B 4X6FB 2VLLA 2L0DA 4AT6B 4ZTPH 2VL4A 3ARFD 3LD8B 3UTTE 5JNYA 4EQ2A 2ITCB 3VGDA 4MYWB 4PJEF 1P4BL 5DUPH 4DFIA 1F5WA 1K8IA 3L7EB 5D93B 5BXFB 4WI7A 3EO1B 1RURH 3CVHH 2HVJB 3Q5OA 2SEBA 4HG4J 4ETQA 1S9YB 4TN9A 3O3BB 3MRMA 4M93B 4S1RH 1JNHA 1YECH 4XP6H 3GSRB 3KYMA 3ZDYE 3J7HA 1T0MA 5ABDE 3SE9H 4WI2A 3BEWB 3KPPA 4XI5D 1IGIH 1UGNA 5FB8A 3FCTA 5MERA 2XN9B 3RWEB 3SKMA 2ICEA 3FB5A 2X9WA 3QRGH 3T3ME 1A1MA 3PJSA 3T65A 4OLYL 1AXSB 1ZEAL 3SDCB 4M8QA 1NLBL 4C59B 1KB5L 5C0JA 5JXED 1CGWA 1OPGL 3GMQB 2P5WB 4MDJB 1BMGA 2EDRA 4TSBH 1EAJA 2RCSL 1VEMA 1YC8A 2VXQH 3BHBB 4JPIB 5DMGD 1TTUA 1NGZB 3Q5YA 3FAXA 1NDGB 2X41A 1SJVA 1TCMA 4KVNH 3E6HA 2MQ3A 5E4EC 2CQVA 2BNRA 1QFPA 1RZJL 3FO2B 1KLFA 5DHVH 5GGTA 4OGXL 3DPBA 5K33A 4EJ1C 3OKDA 4R4NC 3OV6A 2XZAL 1NCNA 3LPWA 3GSWA 1AD9A 2EYSA 2VO5A 3KWWB 1QO3B 2ORBH 5JW3L 1IGFH 1FDLH 5CZXD 3MJ7B 1PG7W 3GSNL 3HZYA 5C3TA 2P47B 4B41A 1ZHKB 1T7XA 4MX7B 1WLHA 3HUJF 3IDJB 1V7NL 3VFNB 2BZDA 2VISA 5H37G 1J1PL 3IAPA 4YDVA 4K8RL 4YEFA 3IDIB 4G9FE 1MJ8H 4YXLL 3LEYL 4S0SD 1H5BC 2DQGL 4FQPA 1O5DT 1FIGH 2NY3D 4HC1L 3VD7A 3CLFL 3DHJA 3BWAB 3QXAB 3P73B 1MELA 1K3IA 1KN4L 2VQ1B 5TFSH 1G6RB 2ARWA 5F96H 3FONB 5JDSB 2BOCA 4QRPE 1CXEA 1KFAL 1KLUB 2LU4A 1KIQB 1OTUC 3A6OA 1S3KH 2N7AA 4ZFOL 1HOCA 1FV1B 5F88B 5F9OL 5GGQH 3KJ4B 3T0EA 2VDPL 1RJCA 1H3WM 3QEUB 4JRYE 4HSQA 4I48A 5BZDB 3CFBB 1ZMYA 3IAQA 3MGTA 4HMDA 1OF2A 1F6FB 5CUSH 2Z9TA 4WY7L 4J3TA 4CMMA 5INCA 4ZNEE 1INDH 2O5XL 3ARBA 4NQXB 2VXSH 4KJYB 4OAWA 3DETC 3EO0A 5C0CA 4Z7VF 1ZT7B 1RZJC 4P59L 3DX8B 5F8RC 3VWJA 4DCQA 2J6EH 5TDNB 3HRZB 4PG9A 3E0GA 1VPOH 3KPSD 3MJGX 2IBGA 3RWFB 1T3FB 1F97A 1ZA3A 4NC1C 1PD6A 3NAAH 4WJ5A 3NGBC 2HLFC 4IRSA 2AW2A 1UCTA 4M7LH 4MMZC 4N9OB 4OCMC 5DK3A 5LAXB 3B2VH 2ADIB 3VXME 4RFNC 1Q9WA 5C0ND 1E4JA 4OFKA 1L0YA 4G5ZH 5FO8A 2XTLA 2NTSP 4L8DA 1IKNC 3GNML 3LEXB 3FO0H 3HAEH 1V3KA 3IFLH 4QTIH 2P7TB 3QG6B 4Y4FA 2A6DA 1QQDB 4P5KB 1B9ZA 4OZIF 4K7PH 1I1CA 4WUUB 4KVCH 2PYFA 1I1FA 2J4WL 1SY6H 5B8CB 3QRFM 5DQDH 4YZFE 3ZHKA 4ALAH 3QUZD 3ARGD 3O6KH 1IC4L 4J3SA 4OCSH 3V6ZA 3OWEA 1TQCC 3GB7A 4PRAA 1H3TA 4U6VH 3V5KB 5SWSA 5J06A 3UAJD 1ZHLA 2CUMA 3HUJB 4FQHA 5EWIL 3OB0K 5FYLH 1A47A 3JZ7A 1KTDB 2H8PB 4MD4A 4NM8H 1U8HA 4UMGA 4Z78A 3C5SB 4ZO6A 3H7BB 5B39B 1VACB 1W72L 3SKOB 1VKXB 2CKBL 4GXVH 2H26B 3KYOB 2WMPA 4FABL 3IDGA 5I1LB 3D87B 1N5YL 4ZPTB 1FVCA 2I07A 5DJ2B 5KVEL 3QWOA 5FM5O 4Y8DC 2P45B 3X13B 1NMCC 1BBJB 5E9DE 1QNZH 2V5SA 2XWJA 5TE6H 2D31A 3G6DH 3E8UH 1TNMA 2DWDB 4PJAE 4PTUA 4XAWH 1MAML 5J3HC 3ULSB 3ARVA 4EN3A 1JZ5A 3UTQA 4LQ1A 4KUZL 1JUFB 1UWEL 5DXWA 2DM3A 1RIVL 1J12A 5DD3L 4GMTH 4UI2A 1VFAB 3RDTD 4XH2A 3T0WA 1HH9A 3F62A 4APQD 3G04B 3O3DB 4M1DH 3VRJA 1G1CA 3STLB 3STZB 1MCWW 3GHEL 3UBXG 1G7JA 1QSED 4Z7VB 1UT9A 2VZ1A 4WWID 1KCUH 3V4PL 3PGFH 3L3HB 3WV0A 3QXWA 4P9MH 1JZ7A 1OP3K 3P0YL 1FLTX 1MLBB 1UWXH 2VAAA 4TRPL 2PYEE 3IDUA 4LCCC 2CRIA 4JO3L 2FEEL 3GI9H 1B2WH 2AABL 3LKQA 2NXYB 1QBBA 3DYPA 1EEUA 1MF2L 2IH1B 3O2WL 5IMKB 2G60L 3UPAA 2FLBT 4MHHG 1UKSA 3O4LE 1NL0H 4ODHL 3ZE0F 2ZKHL 5FCSH 4NWTL 4WO4A 1KELH 4U1SB 5AZEH 4FQLH 1ZTXH 4Z7OE 4JZJA 2WIIA 1U58A 2VXVL 1NEZB 1IAII 4RDQG 4OZIB 3ZE2F 1WAAF 1EAPB 1G7PB 2YOCA 3MV7E 4OFDA 3RUGA 2PXYD 4EVNB 5IHLB 3P0VH 3TVMD 1CICC 1MCOH 1T2QL 4FN0A 4LARL 4F9PA 3ROOB 1TVHA 4J4PD 3QPXH 4EOWL 1JVKA 1R3JB 4C56A 4X7DC 4PJ9A 1JN6B 3FO9A 1DQLL 1I9IL 3JXAA 3I9GH 4LKCB 1J1XH 2PO6C 4KHTH 4HWZA 5DD6A 4RRPG 5EOCJ 5HD8D 5K9OA 3CSGA 2VXTL 6FABL 5E2JA 3C60D 4Z7WA 3GZKA 1DLFH 2O61B 1YEJL 2EDHA 1GGYA 1OTTC 3UO1H 2IAMD 4GKNB 43C9B 2H6PA 4MA7L 2ESVA 3B3IA 4XNYH 4WGVB 3MA7A 4OD1H 1NUGA 4D3CL 3UTSA 3MLWH 4LVHB 1C12B 1P7KB 4G8GA 2V2WA 1EJOH 5I1HL 1QR1A 1ORQB 1KYOJ 1GVIA 5I8EA 3ZDYF 1FYTA 4BQCA 4RSVA 2A74A 1B3JA 4HT1L 3ARPA 3D39B 3EFFA 4Y5XC 3W39B 4EDXA 4NQDB 4OF5A 4Z9KB 4DKEH 5AWNL 5JIIA 1F3JA 5MEPA 5E8EA 2H1PH 3SDDD 1NC4D 4XWOD 4XVSH 3QSKB 1GCFA 4JVPA 9CGTA 3T3MF 4XCNA 3CUPB 3X3GH 4CGTA 1OGTB 1MCKA 5CJXA 3TP4A 5HI3D 3DROB 1ACYH 4M02A 1V7ML 5D6DA 1J9CT 3HI1B 1T89C 1FVDB 4MAYC 3JVGC 5F70A 3RNKA 4WI9A 2Z8RA 3FN3A 2APXA 1MUJA 3W2DL 5E94A 2VXUL 5E1AA 4P46B 5GRUH 4X6DE 2JIXD 3A6CH 4I0PC 4NQUA 5HYFA 4CRPA 3DURB 1AE6H 1OW0A 1CD8A 2EC9T 3RHWK 3UYRL 3V52L 3CNKA 1KJ3L 1BWWA 3QCTL 5C0IA 2MJWA 5F9JA 3ALWA 4ZOBA 3D0VA 2EH7H 2Y9RT 3IRZA 5D5ME 5HXMA 1J0IA 3HMWL 4GFTB 5C0AD 3BKJH 2C3XA 3OJMB 3NCFB 5J1TC 4IOSD 3BSZL 5HGBA 3C6LD 4RMUA 1AD0B 4Y0GA 2F9BT 2DD8H 5I17B 2DI8A 1NANI 2I9TB 2DYPD 5K93A 5HHMB 4ODTH 2IANA 4KKBD 1UXSB 1CE1H 3B9KA 2VDKL 2V2TA 5DRZB 4YBHA 5J4MA 2GTZB 5HYSA 1A7OH 4N5ED 5DMJB 3R8BB 4UQ2B 2DQUH 5EPMB 1KACB 4LK4A 1U8NB 4HIXL 4LCIH 1F2XK 1BD2E 1QACA 3BEVA 3QO0B 5E1HB 3VFVB 1D9KB 5JORB 3KJ4C 1TVDA 5HDLA 4AG4H 1HNFA 4K3JL 3PIQB 1TVBB 5C09A 1PW3A 5GIRB 4CADB 2OL3L 5ALCL 5BCAA 3KPRD 4PJCA 2CK0L 5EOQH 5J0BA 4PR5B 1JTPA 1I1YA 2YRZA 1Q0YL 5JTWA 1FC2D 4PS4H 5CGYD 3P9LA 1H3PH 3UTTB 2FGZA 5D7SL 1OSZB 1TJIH 2J1KA 3QDGA 1Z0NA 4K23H 2IPUK 4WFED 3W5MA 5F8QC 4ZUSA 4XB7A 1X4ZA 3VJ6B 1KT2A 3RVVD 4X6FA 1RJLA 4WFHD 1OSPL 1GGBL 3GIZH 3MRNB 2ITCA 2X1QA 3QEQE 1T4KA 5A43C 3DV4B 5I1KL 3ULUE 2D3VA 4JPKH 1ZT1B 4ZXBC 2CRZA 4WU5B 1C5DB 1HH6B 1JNNL 2NX5E 5D1QC 4HPYL 2G5BB 3PP4H 3BP5B 5J6HB 4JM2C 4LAQL 3QHZL 3MBEB 4F7EA 2X6MA 4W4OC 2ADFH 1S7RB 1CT8B 3U4BL 4X9GA 4GJTB 5KS9A 2E5EA 2WWMD 1MNUL 3TIEA 4PJIA 35C8H 1YYML 3DMMD 3HMXA 3BEWA 4Z5RA 5CFHA 1WCBB 4EDWL 3VG9B 3KGRA 1E4XH 1KUMA 2YS4A 1U8OB 1KEML 3O8XD 3QDMD 2EXWC 4PJ7E 4X5WB 4Y1AA 2BDNH 2GSGA 3O6LH 3FQWA 3SDCA 3GSUA 3SJVE 5FYKH 3HR5B 4J3VA 1LE9A 1H3GA 1CVRA 5EO9A 1RY7B 2Q8BL 3RL2B 3AREA 4XBPA 1E28A 4HFUH 1KB9J 1QFWH 2YK1H 4X5XA 4L4TD 3U0WH 2ITDB 4YZFF 3IU4H 4NRZB 3FO2A 3T0AA 4ZOAA 2IALB 1J05B 3OKOB 4WV1B 1FPTH 4GUPA 1FFNA 5IFJA 3T2PA 1IAIM 1KEGL 2EYTB 4UB0L 5DQ9B 2R23A 2RIKA 3PQYE 1XF1A 4UOW0 5BRZA 1AC6A 2FCBA 3MJ7A 5EU6D 4G7YL 4HUKB 3WJLC 1ES0B 3FMGL 4G9FB 5DRNB 3R8QA 1ZHKA 4LMQE 3BIAX 3HCVB 3VDBA 4LHUG 4S1SH 5FA3B 3UTOA 4J2XA 4JFHD 1CXFA 3DGGA 1LK3L 3SE4C 2WZPD 2P4AB 1U8QB 1EEZA 5FCUH 1L7TH 3UPCA 2V5TA 2FYYB 4QRPB 1JF1A 1S9VA 3O6ML 1FBIL 3AMLA 1YPZE 4EI5A 2VWEE 5JIHA 3BKML 1P5UA 5CP7A 1WT5A 1MHEB 3K46A 4MS8D 1VEOA 3BWAA 4QNPF 3HPJA 1IC7H 4LHQB 4PRHD 4R96B 5EOTB 4PJAF 4PJ8B 1XGYH 5IVOA 1IQDA 4YGVB 5IQ7H 1MQ8A 5IFAH 4JRYB 1FZMB 4ZO8A 1PEZA 3VD4A 3QULA 4OZGE 1KLUA 2JJTA 5AYUH 2QQQA 2VLRB 3X12A 4H8WH 2O5YH 2CJUL 5L7XL 4N9GB 1A9BA 1KPUA 3HI5L 3QEGH 2XT1B 1J8HA 3C08H 1YNKL 4EZMA 5JMRA 3NIFE 4LPYA 1UCBL 5BZDA 3RVWC 4J1UA 4N8CL 1NMAL 1RUML 4FQXD 4PJEA 1U92B 3HC0A 2XG5A 2R56L 4YC2B 4PRPD 2P5ED 4OZ4B 3ZT5A 4LEXH 1TITA 3U6RA 3UJTH 3GI8H 1C1EL 4NQXA 4KJYA 1CBVH 3ETBF 4F2MA 7FABL 2HT2D 4OKVB 1ZT7A 3RVTD 3F65A 3DX8A 5DSCA 1ZT4B 3M17A 5TDNA 2R15A 3VXMB 4I3GA 3O11B 1VCAA 5DURD 1KULA 5JXEC 2BJML 2X4PB 1J87A 1DBAH 2YPLE 5HVHB 1YEDB 3GK8L 1TXKA 4Z7OF 4BQ8A 3OJVC 3AS1A 3QXDA 4OFVA 3H7LA 4P4KB 3AXLA 1Z0MA 5KOVC 2BNQD 1H3UA 5D7IE 1DVFD 4P57B 3IJYB 1IAIL 2BSSB 2VZSA 3WN5B 1XGTA 2XZQH 4P2OD 1YY8B 4YDIL 1REIA 3KPTA 1Q9OA 2Q7NA 2P7TA 2YKLH 3V7AE 3L3KB 3F58L 1HHJB 1UM5L 4P5KA 4YHYC 5CZXC 3AM8A 4KK8D 1LO2H 2MCPL 1I7UA 4O2CB 5DYOA 5FHBH 4U1KA 5ALBH 2VJXA 5B8CA 1P9MA 5IIEB 2B0SH 5SX4H 3IFNL 4GOSA 2I60L 2XG4A 4F80A 3V5KA 2E7CA 3CFIC 5I8CB 2PW1B 3ARRA 2E8ZA 3HUJA 1WUNT 5JA9A 5EUOE 3GJFB 4I77L 4KPHH 1GL4B 7CGTA 5DJ8A 4H25B 4P2RE 3ZSTA 4X6BA 4QRQB 1AGEA 3IFOA 2AKRB 5EA0H 5K9QI 3H7BA 2ZUXA 4K3DL 2AXGB 1PLGH 1VKXA 2ATKB 4BSVB 1MIEL 3BQUB 3MRRA 1YJDL 5D1ZB 3VFRB 1I8KA 5I1LA 5C2BL 5E9DB 3G6AB 4FNLH 4QXGH 3EYUL 4RFOL 1F8TH 3WFHB 4PJAB 1SQ2N 2NPLX 2ZSVA 4YDLB 1TENA 5E8NB 1X9QA 3X13A 1I3RB 2B4CH 1UKQA 5D7LA 3RBGA 4YO0A 5MEOB 1UACL 1L4IA 3MR9A 3HE7D 2BC4A 2VH5H 3VH8G 2DWDA 3ULSA 4IJ3B 4Z76B 3CFCH 5D71L 4YXKL 4ESKA 5D8JL 3CXHK 3F7QA 5D4QA 3WNNA 1M7IB 2ZSWA 1LDSA 3SDYL 3LCYA 3L5XL 4X6DF 2WSKA 2DWEB 4X4MA 3SE3C 4TTDD 3MLSL 3STZA 2R1XB 4U6TA 1RVFL 3LKPA 5D5MF 5F1KC 3WKNA 1FG2A 1GZQB 4L9DA 1X5KA 3T2NH 3BZEB 1XF3B 4FFWC 4QRRD 1T0PB 3PL6A 3C5ZC 3MRCB 4M61A 1J1OH 5HVFB 3RWIA 4MQXC 1Q9LB 1UM6L 4F7TB 2RFXB 2LABA 4AEHL 3TO2B 4LLAA 2G5RA 1VB9A 3O4LB 5JW4M 3EZJB 1D5BA 2DICA 2NY0B 4XPBH 3PWJB 2A1WL 3CDFA 3RGVB 1M1SA 3K8MA 2IH1A 1NAMH 1KJVA 3MV7B 1OT2A 4L3ED 4RX4A 1XZ0B 4QYOA 1EO8L 4QXUL 4HKXB 4XP4H 1KPVB 1SBSL 2J88L 3PE9A 5BQ7B 5I1JH 2X4NB 1I7ZA 1KV3A 3QIBA 4U1SA 1EFXA 3BPOC 3N9GL 4PLOB 4LCWD 4XBGA 1NCDH 2LAGB 4HQQL 4OZIA 3OJDA 4U7KA 1FN4B 1YJDC 3ARGC 3P30L 3CCHA 4OLZL 1LEIA 2GJ6D 2V6HA 1TCRB 4EVNA 1Q94B 2YUXA 3VGBA 4DUVA 3FFCA 4DN4H 3H3KA 4JRXD 3HZVB 1RIHL 1OAQH 3L5WB 5TQ2H 4I3RH 1XIWD 3BP6B 5H2BB 3FTGB 2VZTA 1QA9B 4G43B 2HTLD 5JHLH 2MQ0A 1CLYH 4OCRL 4ZG1A 1JN6A 4KI5E 2IFGA 3QUMB 5CAYB 3TBTA 1B0WA 3D3VD 2EDYA 4WHYH 3EDFA 2XQBH 4JR9L 4KKCD 4MJID 1GC1H 1KB5B 3KXFD 1YN6B 1E6OH 1T5XB 3ULUF 3AY4A 1A0QL 3NH7H 5JHDD 1YEGH 1U8JA 2BXYA 2ADGA 4JFXB 3D5OF 4GKNA 2L4OA 1P6AB 2NLJA 2DBLL 1UZ8A 3WS3B 2ZCHL 5ISZA 4K7PX 3SE8H 5D1XD 4EUPG 4PBXA 1C12A 3TYGH 3W11C 2I27N 1JI2A 3K4DA 4BM7A 5ICYB 2WQRA 1D6VL 3HNTL 2WLZA 4K94L 1KIUA 3W39A 1UB5A 2IFFH 2QJDA 4APQC 4R3SA 3LDBC 4YHOL 4BJLA 4PJ7F 1FVEB 2BOBB 1JGVH 4S1QH 3V6OE 1BVLB 3EOBA 5T5NG 5CJQH 1N59B 2W91A 1GAFL 2HH0H 4OD2B 1HKFA 4OLEA 4AZ8A 5D5MB 3LQMA 1U41A 3KNBB 3I3EA 2GHWB 4WWKA 3QXUA 5CHNB 1FH5H 4FG6D 1ZA6B 3RAJL 4FFVD 3SGKA 2VDMH 4Y5YA 1QLFA 2HFEA 3G9AB 2MTPA 5CEZE 1YC7A 2VSCA 3UTZA 1JMXA 1AO7D 3S5LB 4DZBB 2HT4D 2D7PA 1IM3B 3IF1A 4FP8L 5E24E 3GMOA 2N1KA 5I17A 5AYQA 1KJMB 4PV8B 1BD2B 4NHUB 4CVUA 4YDKH 5DFTA 4MVBD 3PHOB 3KHOA 4JFZL 3VXRA 1XFPA 5DRZA 5IB2B 3LEVL 3QG7L 1YPZF 4GG6E 4YE4L 4UQ2A 4KMLB 1WAAA 5INDB 4UBDD 5DLMH 1DQDH 3A0OA 4H1LH 1WJ3A 4GS7C 5AUMA 1TVBA 5EIVA 1RIUH 5GIRA 1YNTB 4NZUL 1GJIA 4OZGF 5I2IA 5IWLA 2MMXA 4PRBB 5E70A 5HD8C 2F5BL 1Z9LA 4K94C 3BZFB 1U9KA 3C60C 2VDQH 1OCWH 2ICCA 2AI0L 4N0YH 4O51A 3CFDA 4U1JA 5EG6C 3NIFF 3UTTA 5IJKC 3QEQB 4NKQB 5MEND 1CXKA 2EIZA 5AD0B 3NCBB 2ICWI 1A7NH 4Y2DA 4FXKB 2OZ4A 2N7BA 2NX5B 5IB5B 1EH9A 3AS0A 4QXTB 4V2CB 4NQCA 5HHOA 4NN6B 1UH2A 4JO4L 3S3JA 4BQ9A 1S7SA 3DV4A 4YHPA 1FZOB 4IRZL 5TH2A 1KN2L 5K9KB 4XWOC 1MCCA 1A7PL 1C5DA 5GS0H 3U36A 4NUJA 5FAAA 2ZUYA 4PJBA 4ZTOL 4K7FA 5HI3C 2Z4QB 1A6UH 4UT6H 1MVUB 3WXWL 3BKYL 5F1SA 4PJ7B 1S7RA 5IEKB 1CT8A 4IRJD 4NKDA 3GEWB 1QBLL 2HJLA 1FGVH 3CX2A 3C9NB 3WFZA 2W65B 5D7IF 5BVPH 2AJXL 1BF8A 3PWLA 1A6AA 4X5WA 4D0BA 1I1RA 3WKMH 5JXAL 3MRLB 4L1DA 5LWYL 4X4XB 1ADQL 3HR5A 3E3QC 2NQCA 2AV7B 3GKZA 1PY4A 5JR1L 1NCWL 1JPSH 5E8OB 3C6LC 5I75C 2ITDA 3PQYB 4XWGL 4U6HA 3NTCL 4GRLD 4OIIH 2R4RH 1J05A 1HKLL 2WNGA 1NFIB 1N4XL 2A83A 3NIDE 3EO9H 5DQ9A 3BUTA 3MJ9L 2GITB 3L3DA 3RJDA 2NW3B 3BT2H 3INUH 4LVNB 3N1MC 1ZVHA 4QHLB 1CFSA 2QEJA 2V5MA 1YPZB 5IW6B 4LQFH 4N8VB 4RAUB 3WO3B 3WIFB 4JY5L 4ODXB 4LSDA 1NGXA 4JO2L 1VGEH 4NZRH 4MNQE 1NDMA 2EDOA 2ICWJ 2XZCH 4LDLB 4OZGB 1MWAH 4NQSB 5CGYC 1ZLVH 5I18L 1RUPL 5DVLA 4HH9B 1MCJA 3PV6A 3KPMB 3BD3A 2PCPA 3DX6A 4Q7DA 3N1GC 3HI6H 4MQ7A 1F45A 3FO1B 3P9MA 3RWCA 2AEWA 1KNOA 3RVVC 2CUHA 3DLQR 2R1WB 1BLNB 3LV3B 4NPYA 32C2A 1CIUA 4NJ9L 2WBJD 4HMEA 3ZTJH 4N9GA 3EOYG 4WW2C 4XCFH 3E2HC 3CFJA 4ZNEA 5F9WC 3MXVH 4JCLA 1LMKA 5IBLD 1RV6X 3K0WA 1QSEE 2UY7A 4QO1A 2NY0C 1HHIA 1HWGB 3G08A 3LN5A 1AQKL 3NIGE 4HX1A 4OZ4A 3RGVC 5DD5H 3V4VH 4Z0XB 2WWMC 2W07A 2X7LA 3DMMC 2W9DL 5CSGA 2YPLB 3L3OB 5FYLD 2BCKA 1IZKA 3UTPD 5C0DB 2JTDA 4HKJB 3O3AB 4NN7C 1L6ZA 2HAZA 3O8XC 4YXHH 3EJZD 2UZIL 4M43L 4PJXE 1FG9C 1HXYB 1FZJA 5D7IB 2Y23A 1YEEL 3OR6B 3FB6B 1YEDA 1BQLL 1T20A 4X7EC 1I1AB 1AFVL 1K4CB 4AIXA 1BIIB 1LVEA 2D0GA 3R06B 1C7TA 1RUQL 5EO0A 2Q6WB 1QBMH 3ME0A 4ZUVB 3C2AL 1OGAD 1IGTB 3CH1A 3IJYA 1XCTB 5GGVL 3WN5A 3U9UA 1KCSH 1YY8A 2Z0BA 4NRXA 4JM4H 2FZ3A 1OLZA 5BV7B 1VSCA 3FQXB 3NZHH 4U1IB 3O3EA 3SEPA 1YMME 2FD6L 2WUCL 4PIRF 3O6FB 3MREA 5IP4A 3SPVB 4OQTL 1FRGH 4KI5F 3KG5A 1S7XB 2HKFL 4KDWA 4JJHA 5IIEA 4KY1L 4P2RB 4KJQD 3VFGH 3NVQA 4GAFB 3I6LE 3HNSL 3KR3L 2PW1A 3QO1A 1RZGB 2HFGL 1EVTC 4X99A 5FKPA 4GXUM 3GJFA 4XP1L 3BDXA 4NCDA 1DEEA 2GEEA 4JFDA 4POUB 1XGUB 1ZWIB 4XVJH 1MI5E 4H25A 5EBGA 4XP5L 3JV0A 3HS0B 3KLSA 1OAYL 3V4UH 1F4AA 5I8KL 5LG1A 3V0WL 5C6TL 2MKLC 2AXGA 4Z7UA 3TIDB 1V3LA 2ATKA 2UVFA 3PDOB 4HV8A 2APWA 2DMKA 2Z8VC 4BKLA 4NFCA 1K2DB 4JFED 5E9DA 2VIRA 3BIKB 2C1OB 3SOBL 1F00I 2H32B 4XMLH 1KIRB 5E8NA 3BGMB 4YLQT 1Q0XL 4ENED 5IMMB 1IAKB 5EORL 1IL1A 4FQXC 4TUJB 3RY5A 5SWZA 3CSPA 1RU9H 1KXQE 1FGNH 5I1IH 3VGFA 4TULL 4Z76A 3O4OC 1MFDH 4IHOA 3MV9E 3MUHL 4A6YL 2W9EH 2UYLB 4U1LA 3RVTC 2FBJH 1J5OL 4JN1L 2UUDH 4BUGA 5KSUB 2ENSA 1Q1JH 2YD5A 3PP3K 5F1NA 3P40A 5I30L 2B5IC 4PB9L 5C0AE 1GZQA 4WIQA 1H0DB 3NFSL 1TMCB 3BZEA 2PYEA 4HZAA 1U2CA 5IVNA 5EB9A 3X14B 4GSDH 4YPGA 3B4NA 5DHYA 4LBEB 1KJ2H 2RFXA 2EH8H 4P2QD 1MPAH 1Q9KA 1TDQA 2V7NB 1WBZB 1U6AH 1NBVL 5IEHB 2UZXB 4XMKL 4YUEH 4POYA 1F4XL 4P2OC 4P23D 2ZJSH 3BP7A 2VYRE 3FJTA 4XNMB 1F4HA 1WTLA 5E2WL 5HYJD 4GG6F 3FOMA 1UKTA 4NKIL 1JBJA 1FFOA 1F6AB 4TUKL 5D7JB 3UJIL 4S1DD 1FFRA 4KK8C 1QTYT 4MHHI 4OCWL 1XT5A 1HI6A 1KPVA 5DC4B 1EHAA 1H5BA 4YWGH 2EDNA 2WANA 1F13A 3WUWA 2F58H 1UWXK 2EEDA 1S7QB 4R8WH 5LCVL 3U0TB 3SGDH 2Y07H 1GPOH 3UYPA 1WC7A 3MLXL 3I2CL 3QH3A 1XGRB 1XR8B 1CGSH 3ARFB 3HZVA 4DVRH 3L5WA 5T3XH 1T6VN 4NN6C 2J8HA 1M71B 3T1FB 2BXZA 1QA9A 4HXBL 4NBZB 3NMEA 3WFDH 5LGKA 3OAUL 3V7MA 2ZPKL 1MFCH 3L3JB 1KB5A 2D7NA 4KK9C 3B9DA 3K8KA 4G42B 3QCUL 3KPQA 4M7KH 5TGBA 3IDMB 5HDOA 1RK1A 3QQ3A 3WS3A 2HVKB 1SVCP 4G6KH 4FZEL 2DDQH 3RL1B 3QFJD 2GY5A 3OF6A 3A67L 4U6YB 3VMOA 5FO7A 1R3LB 4Y5VB 5GRZA 2PN5A 4N5UA 3SN6N 2AEPL 4CDHA 3B6SB 3CVIL 4M00A 1HEZB 3OKNB 4BFEA 3GSNA 1U8KB 3DARA 1A5FL 3VA2C 3HLAA 1D5IL 3EYVB 4KJWD 4JAMB 4KDTA 4TTDC 3FRPA 3L3GB 2XPGA 2AERT 1MCRA 4GBXB 5EU3A 4FXLA 3UBXB 2QQNL 2VR9A 2XKNA 3MLPA 5DUMH 4X6DA 1BVLA 5KOMC 1N59A 3PGCA 1D6EA 1SM3L 1IKNA 5HI4D 4NO2B 4OD2A 4FA8A 3VFTB 4YX2H 5JDJA 3MCLH 1BVZA 3V2AR 1PYWA 1LO4H 3ECBA 4NO0D 5T1KA 1QSFB 4PGEA 5CLWA 4HC1A 1RUKH 1FYHB 4UNUA 1BOGA 4V1DE 1MCBA 2E27H 2VDLL 4LHUD 1I9JH 2FJHB 2NNAA 5I66A 2UWEA 3ZL4H 3NIDF 2AQ1A 1J0ZA 4FQIH 3SKNB 1NC2D 1NUDA 3BVNA 2O26U 4ZFOA 5EC1A 4MNGE 3Q6FB 1H9VA 3Q6GL 5L9DH 4NYLA 4N90D 2LAAA 4HK3N 5ANME 2DQEH 4GG6B 3BMVA 2I5YL 5HBBA 2NY3B 4PRNA 1KJMA 5GS1B 1BD2A 5DJ6A 2BMKB 3CXDL 5GJTL 4RWYH 3PHOA 1LD9B 2D7OA 1T66D 4Y16D 2JELH 4QT5B 1JJUA 5IB2A 4P3CH 5D72L 4U1NB 4BK4A 3S35H 3N85L 4OTXL 2XXCB 3CSYB 4ONFL 5GGRB 4KRPB 1XIWC 5I6XC 3STBA 2BRRL 1FLRH 3N1QC 2LU7A 4Y4HA 1WITA 4ZTPL 5F71A 2DQJH 1HILA 4XC3H 3QIUD 3H8NA 5DUPL 1J18A 1I4FA 1SMAA 3VGAC 4YIQA 3AAZB 4L3CB 3MCG1 4DGIH 1GOHA 3MRIB 1RURL 1E4WH 1WISA 4WI5A 3FZUC 3LS4H 1GOFA 2BNUB 4F15C 1FNEB 5FYKD 4FTVE 4JANA 4AM0B 3GKWH 4S1RL 3I02B 1YECL 4XP6L 1N0XH 3OG6B 4HUWA 2P5EE 4FXKA 4IMLA 3SE9L 3NIGF 2NX5A 3VCLA 1AH1A 1IGIL 2WIMA 3TNNA 2NY4B 2DI9A 2I24N 2IPTH 3QRGL 1AKJA 4LF3B 5L88H 1UWGH 2DMBA 5K9KA 4JY6B 4TSBL 1A1OA 3TT3H 5L6YH 1JNLH 5L0QB 4M62H 2VXQL 4PJXF 4A2LA 3WYRA 4DVBA 5KAQF 3TA3D 2Z4QA 4LCCA 4KVNL 1G7IA 2VE6A 3JTTB 5HYSG 2YZ8A 4K3EH 4CKVX 1IFHH 3TCLB 4XCEA 4PJ7A 1NCCH 1XF4B 3SJVA 5BV7C 3LH2H 3RU8H 5ITBH 3C9NA 2DQIH 4LIQH 4XHQA 2BNQE 3FQNB 3QIWA 4PJ5E 2ORBL 5JW4N 1IGFL 1T80A 4C4KT 2KBGA 4YPJA 4FFVC 1FDLL 1INEH 2OJEB 2UZYB 3RHWF 3SKJH 2KQNA 1W72A 2CLRB 1E27B 1G7LB 2CKBA 4CN4A 3QUZB 4F33B 4XXCA 1KIPA 2Q7YB 4NOFA 2P43B 2AV7A 2HT4C 4ZDHA 3CDGA 5C8JA 3SCMD 5JPNB 4C55A 4XPTH 3OXSB 2FHFA 3MYJA 4WNQB 2F53E 5L8LB 3ZO0A 5EZJA 3W0WD 1MJ8L 1MQKH 3RWDB 4LEOB 1U91A 4MVBC 4QTHB 3IXTB 3UCRA 5CBAA 4MSWA 1FIGL 5FK9B 4WHDA 2PO6A 4ZAKD 5TFSL 2GITA 3JWOH 5F96L 4L4VD 4UBDC 5L2KD 4LGSB 2NW3A 5EZLA 1G6RH 1MCPL 4YK4B 4NQED 4MNQB 4PY7A 1S3KL 3MRKA 5IW6A 5GGQL 4U0RC 4ONHB 3W9EB 4N8VA 1AQDA 4RAUA 3HG1A 3WIFA 5EBLB 1P7HL 4HIJA 4OGYH 4ODXA 5GSRB 2EKJA 1P84K 4NGHH 4X7TB 2IGFH 4GRMB 5CUSL 3PG2A 5C92A 5HHXH 3MV11 4HH9A 4B5EA 4JY4B 4Y5XA 4YFLI 4OUOA 1INDL 3RTQB 3N1PC 2VXSL 2EKSA 3FFDB 4Y4KB 1U3HD 1B4JH 1DTUA 1QSEB 3LV3A 4PP1C 2J6EL 1RZKC 2HJFA 1H8NA 3KYNB 4XNZB 3GMRB 1VPOL 1Y6NR 3KLDA 4LDOB 2V9QA 4CN1A 4H26B 1Q8MA 4HW6A 1BFSA 2ADJB 5IJVB 4F9LA 1MCHA 3LMJH 5I71B 3RKPA 3I84A 3NAAL 1C5BH 1X5IA 4QRRE 4M7LL 5CWSB 2V2XA 1CFTB 3B2VL 5HYQA 3HZMA 5TPWH 2C7UB 4UAOC 1I8LC 4IRJC 2QSVA 3VXSE 4G5ZL 3O81A 4PJXB 2D7QA 4Z0XA 3FO0L 1N2RB 3THMH 3IFLL 4QTIL 5F7UA 5DJYB 2GCYB 4P0DA 4K7PL 2LVEA 2YEZA 4HKJA 2Z93A 1G9NC 3B9VA 4L29A 4HLZG 4PLJD 4KVCL 4ACPA 3H3BC 1SY6L 1VADB 1HXYA 2PXYB 1F3RB 3OPZH 1N3NB 5DQDL 3VGEA 4ALAL 3TPUB 4U1MB 1NKRA 3O6KL 4P2CG 1I1AA 2MPAH 4OCSL 4Q9QH 2XOTA 4U6VL 1EXUB 5FYLL 3VI4E 2VC2H 4P3DB 4LLQB 1YMMB 1JCKA 3TFKC 1OB1A 3EYQD 4NM8L 3VWKD 2Q20A 4L1HA 4XP9H 5AAWA 3O0RH 5EU5B 1GHFH 2FO4B 4L8CA 4XVTH 3ZT7A 1RZ7H 4GXVL 4OLVH 3IVKB 4E5XB 5EUOA 3WS6C 5FUZL 3O6FA 2IAMB 2PUQT 3E1F1 3D3VE 2YRLA 3BUYA 4MGXA 1MI5B 3KPNA 2EDJA 4MJIE 3KXFE 3RPIA 3EGSA 1W2KT 1G0YR 4FMFA 4XGZB 5E6IA 4RNRA 5D7KD 1QNZL 5TE6L 5IVZB 3G6DL 3E8UL 5DK0B 4XAWL 1ZWIA 1OHQA 3QNZB 5CGTA 3RZCD 3HS0A 4P5TD 4GMTL 2C3HA 4FQQB 4NP4H 4C4KO 4R97B 4XZUA 5F7LB 3TIDA 4JVUA 3PDOA 3OKKB 2X4UB 2NTFB 1LO3H 2IBZX 2Q3AA 4M1DL 3D2UA 5TE7H 3T4AA 4HKZB 2C1OA 3WDIA 2CSPA 2H32A 1G7QA 1DL7H 4MDIB 3QUXD 5DFVD 5CEYB 3MV9B 3TH3T 5IBLC 1KCUL 1PJ9A 3PABB 2VDOH 3BGMA 3PGFL 1IAKA 2DB8A 3NCJH 1MCQA 3C2SA 4TUJA 5IW1B 2EDTA 1MIMH 4P9ML 1VENA 5HHPA 4Q6IB 1BGXH 3BZ4A 2BNRE 1MREH 5DA4A 5FUOH 1NLDH 1U8MB 3VD5A 5HGHB 4NN5B 1T0NA 3GUTB 2C4FT 1B2WL 4JZNA 1BECA 2UYLA 1F11A 2DLTA 2M8XA 3FB8B 5KSAD 4UZGA 3QA3B 4AMKH 3NABH 2AK4A 5EC2A 1MH5A 5DVKA 1NL0L 1ZHBA 1KXVC 2OL3A 3BO8B 1AO7E 2JF1A 1KELL 5AZEL 4FQLL 3EYFA 1ZTXL 1OTSD 4G3YH 1ZHNB 1FIEA 3DVGB 5DMIH 1IBGH 2NR6D 1JHKH 3JWNC 1S9KC 3P0VL 1C08B 4X9HA 3WJLA 2V7NA 2NYYD 1MCOL 3SY0B 4RAVB 4JVWA 3AB0B 4KTEH 5CBEB 3LKSB 2XQYG 4XNMA 2FECI 3QPXL 3PNWA 5SX4I 1T03H 3SE4A 2E9WA 2G75B 5D7JA 3I9GL 2NZ9C 4CJ1A 1J1XL 5GZOD 2XA3A 3VGGA 3OX8B 4KHTL 3I75A 4E41D 3ZTNH 1P7QD 3I6GA 4X6EB 1ZSDB 2OX5A 4IDJH 4M4RA 1DLFL 4KJQC 5IK3A 3T0EE 5DVNA 1NAKH 4WEBH 3UO1L 3U0TA 5T3ZH 3L95A 2JJVA 4XNYL 5JOPE 3TM6A 1P4IH 1XR8A 4OD1L 1UH3A 3ARFA 3MLWL 3MODH 3U4EB 3FN9A 3BWUC 1M71A 1EJOL 4MCZB 5MENE 4DJMA 1NFDE 5DEFA 4YBQD 4XHJC 1HHKA 3MRPB 3TPKA 2Z92B 5C0CE 4DKEL 1HIMH 4FFYH 3MJ6A 5BVJA 4XVSL 4JFFD 1BVKA 5IHZB 1JWMA 5E2UH 1A02N 3X3GL 4J3UA 3OBAA 2H9GB 5F7NC 3CSBA 3IDMA 4X8JB 1ACYL 1T2JA 3DUSB 4WFGE 4ENEC 4YR6B 2YPKB 2BY2A 3CGTA 1T7VA 2YN3A 1PKQE 3VH8B 4NM4H 5GRUL 3A6CL 3CIQA 2C3VB 1CG9B 3MYZA 5CKAA 1UYWH 1AE6L 3B5GA 2YSSA 1R3LA 5JXEA 4Y5VA 1QP1A 5DJZA 4O2EB 4OGAD 4MZ3A 2NMSA 2ZG1A 1OVZA 3GBNH 1F6LL 2EH7L 4LCYB 3ALPA 3BKJL 4JKMA 4ZUWB 5F3HA 4GKZB 5BO1H 1ETZB 2B2XH 3EYSH 2NW2B 1QFWM 2DD8L 1RSFA 3BPNB 4V1DB 4NO2A 5FM8A 3VFTA 1JWUA 3T08A 1JGUH 3ZHDA 2EZ0D 4ODTL 1VGKB 1CE1L 2IADA 4YDJA 1TZIA 4MNGB 3FT3B 1A7OL 4KKLD 3U7WH 2DQUL 2LV4A 3T77A 4FQ1H 5C07D 5ANMB 3KYKH 4LCIL 4NZTH 4Y88A 4CVZB 4P23C 3RRQA 3JUZA 3IKCA 4AG4L 1JHTA 2CLZA 4LSVH 2VB5A 4LP4A 4J7RA 1S9WB 5D2LA 5I74B 5C71A 2C5DC 5EOQL 2DLFH 4ZSOE 3LAFA 3PWPB 3WFEH 3X3FH 1IT9H 5DWUH 3V0VA 2BMKA 3MNZB 2CR3A 3JWDH 2Z8WC 1JWSA 4PS4L 1H3PL 5GS0D 3FOLA 1EBPA 1BPVA 4J3OC 3RI5K 3MUGA 4QT5A 1DQJA 2GFBB 1TJIL 2QADD 5DJXB 1U8LB 4U1NA 4GXUN 3JBG7 4PRDB 1UENA 4Y4KC 4K23L 4YQXH 1RMFH 3CSYA 5GGRA 3MRJA 4O58H 4XNZC 2VNCA 4KHXH 3FQTB 3GIZL 2MQCA 3U1SH 4FTVB 5DK2B 3UXFA 4J8RB 4QRUB 4LKXB 3AAZA 4L3CA 3U4AA 4JPKL 4U05A 5I1DA 3SO3B 5E03A 4U1GB 3O9WB 3MRIA 3PP4L 2P5EB 2HJKA 4S11A 1AGFB 3TEUA 1NSNH 4WW1A 4DTGH 1DANT 1SJEB 4AM0A 1R3HA 3I02A 2ADFL 3HRPA 3KLHD 4EUPB 5DS8B 1GRWA 35C8L 3CXHJ 5LQBH 3UEZA 3SBWC 5DJDB 4DKAA 1BEYH 4TOYH 3KPSA 1S7UB 4YHLH 1E4XL 1KTLA 1ZXQA 2EDWA 2BDNL 3O6LL 5CSBA 4AL8H 3HE6B 4RZCB 5F9AC 5ACZB 5C0RH 5FYKL 1YYLH 2FWOB 3ARZA 4POZC 2HKHH 3U79A 3MV01 4HFUL 4QGTA 1QFWL 3RGHA 2BNQB 1G0DA 3NN8B 2YK1L 4PJ5B 1OQOA 1DVFB 3U0WL 2OTWB 1I75A 3DI2B 3IU4L 5HYEA 5HI4C 4WI8A 1MHHA 2D0FA 1LEKB 4ZFZB 3QUYB 4PD4K 3T3PE 1I8MB 1FPTL 3VI4F 3AVEA 1DBJH 5H35B 1KLGA 1JF6A 3DX7B 5CKGA 1TZGH 2IH3A 4IMKC 2CLRA 1UH4A 2F53B 3ILPA 3QUZA 3ARGA 2V5YA 4F33A 2A6KB 3QI9B 5E0QA 2Q7YA 5EFIB 4S1SL 2ED9A 3GMMB 5BMFH 1XF5A 4OCNC 3IETA 2YA1A 3GJEB 3J8F7 5TDOA 5FCUL 5EUKB 1L7TL 4Z7WE 3LKOB 1T66C 5FDWB 4Y16C 4R97C 4L8BB 1IC7L 2ESVE 5CZKA 4WEMB 5EIIB 3NCMA 1XGYL 3P4NB 5IFAL 3UTSE 1J88A 4KZEH 4G8GE 3GHBH 3QDJD 4I18B 5MHSE 1S7VB 5AYUL 1MLCB 2IPKB 3MNVA 1HDMA 3IGAA 1N8ZA 1MJJA 1R3IH 2BSED 4H8WL 4NRYA 2O5YL 1LNUB 1FNAA 2OTUB 1QOKA 3QEGL 2HRPH 4FRWA 4I0KA 4JFEE 5EN2A 3C08L 3TN0D 4GG8B 5GSRA 2Z31D 2VL5B 1AHWB 2AJUH 2FJGA 4Q6IC 1A7QH 4X7TA 5C6PB 2EYRB 4GRMA 4ISVB 1GGTA 3RDTA 3BN3B 4OF6A 3GBLA 2OSLA 4LEXL 5DVOA 1A21A 1T1ZB 3UJTL 3GI8L 1T5WB 5JW4Q 4EIGB 3DTXB 5CD5C 1CBVL 4KRMB 4LLWA 5D2NE 3FFDA 5KSVA 1EUTA 4P3WA 5A16A 1QSEA 4K3HA 2OM5A 3U83A 2GSIA 4QRRB 4HZLB 3KYNA 3LSOB 5I76B 2M2DA 1J11A 2VDNH 3S36H 2HN7A 3WEXB 3GMLB 2QR0B 3VXSB 4N0UE 4L9LC 1QVOA 4RISH 5IJVA 1DBAL 4R4ND 2AAVA 3S35X 2BVOB 3TA3C 4U3HA 1CFTA 4M03A 3AUVA 4MA1C 3CPLA 5GSVA 1FO0B 3ZKND 4OFPA 2JK5B 2IANE 2XZQL 1UADC 3O2VH 4OKDA 3TESA 2YKLL 4ELKA 2GCYA 3UDWA 2ZP0T 1IEBA 5IB3B 4UIMA 1LO2L 3ZLQC 2DIAA 1FQ9C 5FHBL 4QCIB 4PLKC 3BRFA 1VADA 2Q1EA 5E5RB 1HHGB 2PXYA 3QZWA 4NZJA 5ALBL 3LKNB 1QRND 3M8OH 2B0SL 5E2VH 3UMTA 3TVMA 5D6CB 1Z9SA 3SCMC 1H8SA 4UV4H 1X4YA 4PJCE 5I9QC 4NUGH 3SQOH 12E8H 2HG5A 1EXUA 4H8WC 4RGNC 4J4PA 4BH8B 4P3DA 4IOIB 5IV2B 4TNVK 2OQJB 4KPHL 1TQBC 3UJJH 5ID0B 1RJZA 2VLLB 1P1ZA 1A4JA 5EU7E 5JNYB 3D3VB 5EA0L 4ZAKC 2QV2A 5D96C 5HY9A 1LO0H 4MJIB 1K8IB 1PLGL 3KXFB 4OFYD 5J11C 3EDJA 4PLNC 1T7WA 3C60A 2R0KH 1X4XA 2SEBB 1T1WA 4FNLL 4IBLT 2IAMA 4QXGL 1P2CB 4ETQB 5C0BD 1F8TL 5E8DH 2FX8H 5IJKA 3MRMB 3BRDA 4EBQH 5D1XB 1JNHB 3VRIA 4L8SC 5M94B 2B4CL 4C58B 2BY3A 3KYMB 4UDTA 1Q72H 1KCVH 3DETD 1T0MB 4XGZA 2VH5L 3KPPB 5I8OH 5DK0A 5MERB 3CFCL 3TF7C 3SKMB 2QQKH 2ICEB 5F72S 3FB5B 5DJ0B 1A1MB 1NC4A 1SVZA 3PJSB 4FQQA 2F54D 4UILH 3SDDA 3T65B 1PQZB 5KS9E 4M8QB 4PJIE 5C0JB 3UPRA 3OKKA 4OBSA 2X4UA 2NTFA 5HGDA 3WO4B 1U3HC 2VN7A 1L9MA 2VZUA 2HLFD 5JOFA 1T2XA 3BPNC 2H41A 3E6HB 4MWFA 4Y1AE 1MY5A 2BNRB 4KZDH 3T2NL 3PABA 1IGYA 3OKDB 2JIXA 1RZIA 1VFBB 4RCAA 1J1OL 1AD9B 5IKCA 2PTVA 2VR5A 3HZYB 4ONOA 4XPBL 2CO6B 5HGHA 1AO7B 3S97C 1CLOH 3ELAT 5C0AA 4I0CC 2MSPA 2VITB 3IDXL 2VISB 1FSKC 4ZQKB 3RJQB 1NAML 3C6LA 3QA3A 4MLSA 3ARDC 5T3XD 4YDVB 4M7ZC 1JYXA 4XP4L 3S88H 1JPGA 2DYPA 3BO8A 5I1JL 4HWUA 2CUIA 2HLAB 3NFPA 4XMPH 5I1GH 1NCDL 1DANU 3FRUA 1F4WH 4E0RA 5IR1B 1G9MH 1LO5A 3GSOA 1HN1A 1RHHB 2BOCB 5BS0D 3LPFA 4RAVA 4WTZG 4F7CB 1OAQL 4C54A 3LKSA 3VWKC 5J13C 2B4CC 5TQ2L 1HOCB 4I3RL 4I9WE 4MQSB 2W38A 4GO6B 5JHLL 3T0EB 3KPRA 4LSQH 1CLYL 2G75A 2CRYA 3K1KC 4W6WB 5GJSH 5F6IB 2ZNXA 3L9RA 4I48B 2XQBL 1F3DJ 1HSBB 3QUMH 5I1EH 5IQ9A 4D9RD 1GC1L 1EX0A 2AGJH 1ZSDA 1E6OL 1OF2B 4OB5H 3NH7L 5J3HD 2FRGP 4OLWH 1NCBH 1YEGL 4CMMB 3C8DA 5MENB 5INCB 1J8HE 3ARBB 3P11H 2FBOJ 5C0CB 3DRQB 3SE8L 5IROA 1IZJA 1X5GA 3MV8D 1C5CH 5EO1A 3OAYH 3TYGL 5EZIH 1JYNA 3RZCC 3VWJB 4DCQB 4ZS7H 4P2YA 2GTWA 2R2CA 4WW2A 4JFPA 4P5TC 4PG9B 1WZKA 1RHFA 4OI9A 5B21A 4HF5H 4D0CB 2YWZA 3P4OA 5B3NA 1ZA3B 2IFFL 3BMWA 4TSCH 2YUVA 1F2QA 2FLRT 1PKQB 1X6NA 4XRCA 3RIFK 1ADQA 5IHZA 4IRSB 1NBQA 3K2MC 1JGVL 2XTJD 2QKIB 1Q9WB 5DFVC 5CJQL 3F12A 4X8JA 2FB4H 3ZKXB 3QUYC 3ARQA 2HH0L 4LPVA 4D8PB 4CMHB 2MOVA 3DMMA 4QHKI 2WP3O 4KXZH 2ERJC 4DGYH 3D48R 4Y4FB 4Z18A 3O8XA 3QDMA 4YHNA 3D18B 1CG9A 5C08D 1FH5L 2PYFB 3T3PF 3MJ9A 2VDML 3L7FA 4TVPE 5E5UB 5KSAC 3DVNA 3U7YH 2R0WH 2GAZA 4L4TA 3V6ZB 4N0RA 4PRAB 3SDAD 4ZUWA 4TYUA 1ZHLB 4FQHB 4GKZA 1ETZA 1CICD 1OTSC 4LP5A 3JV6A 4MD4B 3KJ6H 1U8PA 4YDKL 1OLLA 4Z78B 5FXCH 1ODAA 3BDYH 3IDYB 1GC1C 4M48H 5EU6A 4Z7WF 2WINA 3FT3A 2NYYC 3MJ8B 4QRTA 4OF8A 3TH2T 3IDGB 5CD3A 5DLML 3K7UA 3VDCA 5DFWH 1FVCB 1LGVA 2O5XH 2CDEA 1DQDL 4ZSOB 3ULVC 5DT1H 4L4VE 3QWOB 1SJHB 4AH2A 1RI8A 4TUOA 1G6VK 1OTTD 1RIUL 1S9WA 2X4RB 1IC5H 1JHLH 3VE0A 1K5NB 5GZOC 1AHWC 3AS2A 3P2TA 3QJHB 5MI0B 5CEXA 2VUOA 5ICXA 2D31B 2VDQL 3VXTA 1OCWL 4N0YL 2XN9D 3FQUB 4PRHA 5TDPA 3TBWA 3M07A 1SJXA 3OQ3B 4JHBA 3SDCD 2GFBA 4XH2B 5D7LE 5ESVA 5ADOH 4C83A 1U8LA 2YXFA 2W1NA 2DKSA 2P5WD 1DZBA 2WM0A 3BFOA 3C6SA 3ESVF 1JPTH 1A7NL 2WBJB 4HJJH 2P8LA 3ULUH 4R9HA 2NY1B 3FRPG 4YBQC 1CE6B 1U8IB 5CCKH 4M6OH 5DK2A 1GSMA 4QRUA 4EIZC 3HKFA 1UJ3B 4FQXA 4X4ME 2JJWA 4MAYD 5GS0L 2Y36H 3WFBH 3OSKA 4NHCH 4UUJB 4PRPA 1A9EB 2P5EA 2VTFA 3O41B 4OI8A 2DQCH 1A6UL 4GT7A 4UT6L 4X4YA 1TIUA 2AVGA 4XCCH 1LK2A 3LKQB 5DS8A 1IKFH 4XB8A 1FGVL 3ET9F 4NO3B 4AYFA 4Y89A 1DBMH 3S5LG 3L5IA 3VXUE 5BVPL 2B1HH 5A2IH 3EOAA 4WO4B 4KQ3H 4OGAC 4JZJB 1U58B 3WKML 4LRIC 4PFEA 4DKFH 4OQTA 4FQCH 4K3GA 4IEFB 1OD7A 3VXPB 1JPSL 5CGMA 4CBPA 3DWTA 1JYWA 2BNQA 3NN8A 1YUHA 1DVFA 4OF7A 4RGMC 1BQUA 3QAZC 4P2OA 5F7MC 1JFQH 4F8TA 2EZ0C 1TVHB 4OIIL 4PJCF 2R4RL 1A1NB 4C56B 4PJ9B 2ZG3A 3FO9B 4Z8FH 3DX7A 3EO9L 3FFCE 5T1MA 5IB1B 5LGJA 2BHZA 5KW9H 4HWZB 1X6LA 3JTSA 5DD6B 5B22A 3BT2L 3INUL 5I73C 3QP3A 1BX2B 1CFBA 4Z7WB 1T83A 3MX0A 3BPLB 1GOGA 3BYTA 4LQFL 2H6PB 4ODSH 3GMMA 2ESVB 3B3IB 1AGCA 3GJEA 3G5YA 5DRXB 5E7FA 1CGVA 5ID1B 1VGEL 5EUKA 4NZRL 2XRAH 3UTSB 5MEQA 2AP2A 4G8GB 2V2WB 3QEHA 1MWAL 4TNWK 4XBEH 5C6WH 1QR1B 5FOBB 5FDWA 5I8EB 4L8BA 1FYTB 2A74B 2QADC 5DEGB 4JDTH 1CDCA 3EFFB 4EDXB 5ISZE 4JFEB 1F3JB 5C9JA 5MEPB 4A6YA 5E8EB 3HI6L 1EEQA 5C3LD 5ENWA 1J8KA 1EGJH 1ZVSA 5DI8A 1WTGT 4ZXBD 2YN5A 4P9HC 1MRFH 5D1QD 4XXDA 4UOJA 5KS9F 5K59F 5I16B 5K9JH 4PJIF 3C8KB 4JM2D 2L7UA 3LIZH 1MFNA 4XCFL 3QDHA 3HE7A 3VXNA 5CMAA 3MXVL 1P6FA 5E94B 2VL5A 3WE6A 4Z7QE 4M6NH 5E1AB 5D2NB 1G7HA 1OP5K 2EYRA 3U9PH 4EXPX 4ISVA 1DUZB 2ILLA 3GIVA 2Y72A 4WUUD 2MFNA 1FL5B 1T1ZA 2X1OA 2EXWD 5DD5L 3V4VL 3DTXA 5F9JB 4KMTH 3D0VB 4QHNA 3BRGC 4CVWA 3QNXA 3OMZA 5HGBB