4EXRA

Crystal structure of a putative lipoprotein (cd1622) from clostridium difficile 630 at 1.85 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
152
structure length
152
Chain Sequence
b'NENLMEQDFKVPYTDAINIFKDKYKDADIVDLSLERDLNKFVYTVEGVDDNNEYKMKIDANTKDVLEDKTEKLDSEDLNGVARKEKLDLNDIMTPQQAMEIALKEQNGIVKEWSLDKDLDVTFYKIRIDKDKNEYDIKVDSKKGTVLKVEKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative lipoprotein
molecule tags Unknown function
source organism Clostridium difficile
publication title Crystal structure of a putative lipoprotein (CD1622) from Clostridium difficile 630 at 1.85 A resolution
rcsb
total genus 35
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2012-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03413 PepSY Peptidase propeptide and YPEB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4exrA01
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4exrA02
1A2VA 2BT3A 2CWUA 3X3XA 5IW9A 2WO0A 3ALAA 2CFGA 4KFDA 1EKMA 2CFWA 2E2TA 3NBBA 1W4NA 2OQEC 4EXRA 1WMPA 1JRQA 3PGBA 2IA7A 2K0MA 2WOFA 4BTWA 1DYUA 1KSIA 3WA3A 3AMOA 1W5ZA 1IU7A 2CG1A 1IVXA 1SIIA 2E2VA 2CG0A 2OQEA 1QAKA 1AV4A 3HIGA 2YX9A 3MPHA 1IVUA 3T0UA 2OOVA 1AVKA 1W6CA 3HI7A 3K5TA 1D6YA 2CWVA 2E2UA 2Y74A 2WOHA 2C11A 1TU5A 3WA2X 1IVWA 1W6GA 4BTXA 2WGQA 2OOVC 2W0QA 3NBJA 1RKYA 1IVVA 1OACA 3AMOB 1AVLA 2CWTA 3NQZA 3X42A 2GU3A 2ZL8A 3N9HA 3NQYA 1UI7A 1WMOA 1IQYA 3KN4A 1W2ZA 1D6ZA 1N9EA 3X41A 1US1A 4EV5A 2CFLA 4KFEA 1SPUA 3SXXA 3HIIA 3X3YA 1QALA 3X3ZA 1LVNA 3X40A 1RJOA 2CFKA 4KFFA 1W7CA 2C10A 1D6UA 1WMNA 3SX1A 3KIIA 1PU4A 3LOYA 2Y73A 2CFDA 4BTYA 2D1WA 1QAFA 1UI8A 4EV2A 1SIHA 2PNCA 1IQXA
chains in the Genus database with same CATH superfamily
1A2VA 1MOLA 1TRPA 1RLSA 4TX4A 1UCLA 5AI1A 2INXA 3S28A 2ZA4A 3LYGA 1RCLA 3ZG5A 1RGLA 1Q814 5IW9A 3NBRA 3EJVA 3J7Yd 4HM1B 4DKIA 1KD14 2BO9B 4HM7B 1BSDA 1Q42A 2BHMA 2CKFB 5CF1A 4XDWA 1DVCA 4N6TA 3LZAA 1TIJA 1T2IA 2CFWA 4IT7A 3BLZA 4RNZA 2F99A 1I2EA 1QJGA 4FMDA 5IEPA 1BOXA 1JZDA 1W4NA 2OQEC 2P38A 3LXUX 3OWSA 1VQP3 4HKVB 3F8HA 4ZM8A 2W6JH 2YFJB 2P0XA 3F8XA 1EEJA 3F7XA 1RGCA 3GZXB 3S27A 1UGIA 4GHOA 2XSOB 1B21A 1ULIB 1DYUA 1KSIA 1W6YA 4GSPA 5CXOA 1GY5A 1RGFA 5AEUB 2L1SA 1FA3A 3LTDA 3CMA3 1N5HA 1OF5A 2YFIB 5EQLA 1Q40A 2CG0A 2F98A 3FKAA 4XM4A 5CK6A 3B4OA 3KSPA 2OQEA 3FLJA 3BB9A 3STDA 1SQWA 3SEDA 1K8A4 1IDPA 3PCSA 2BMOB 2P05A 1VQ83 2W9QA 3S5CA 3DGMA 3GZRA 4HJLB 3RNTA 1W00A 4ILFA 1E3VA 3MG2A 3NHXA 2QEX3 3CCM3 4LZIA 3WHOA 1Q7Y4 1AVKA 1LRAA 3HI7A 4O02B 1TUHA 3K5TA 4WWUC 2CC3A 3NUVA 3EBTA 4FCZA 2Y74A 2FNQA 2WOHA 3D5IA 3KKGA 1R4YA 4HM8B 5FGOA 4WYKA 1IQ8A 1IK3A 3B8LA 1Q7HA 1RGHA 3WA2X 1RRLA 1W6GA 3GAXA 3NV0A 1FUSA 1U5OA 1RDSA 4X2OA 5I97A 1QVF2 1DVDA 2OOVC 1DETA 1U8CB 3QK9A 1BSAA 3OX9A 5LC7A 3DXOA 1UUGB 1KWIA 2D42A 5BXQA 1OACA 2PZVA 3DGYA 3K9MC 1K9M4 3PZWA 1RNTA 4GB5A 1K41A 2CWTA 2KF5A 1Q40B 3NQZA 4N6V0 2Z77A 2K54A 3NQYA 1GOVA 3NXJA 2WGOA 1C7HA 1OPYA 7GSPA 3DMCA 1BNIA 3B4PA 4Q53A 1RCKA 2AADA 3HX8A 3MSOA 5FW5A 3HK4A 1S723 3WMDA 1STDA 3PXMA 4N6UA 2KCDA 5BIRA 1D6ZA 1JN5A 2GBXB 2QIYA 1YHQ3 5AIIA 4L8OA 1N9EA 3X41A 1OHPA 1I70A 2FGTA 4K1VA 1US1A 3CCV3 3EN1B 3FG3A 3HZPA 2B24B 3DH2A 2IMJA 1SPUA 4IPBA 3SXXA 1IYYA 1RGKA 4HM2B 1O7WB 1JKGB 5GSPA 3X3YA 3NV0B 3X3ZA 1YIJ3 1LVNA 3EE1A 4HM6B 5KP4A 4HM4B 1FGMA 3U97A 3DGNA 3D5GA 4WP5A 4L7KA 1K734 1WMNA 3BNEA 1JB5A 3SX1A 3UJMA 1G96A 1OHSA 2KAAA 3GZYB 5IENA 1F8NA 3SOAA 1N9JA 3WR2A 3FF2A 1QAFA 2XFTA 1BNGA 1GS3A 1N8R4 1UW1A 1SIHA 3CU3A 3B7CA 3KSED 1T5YA 1I8VA 1I2FA 3K7CA 3LT9A 1QVG2 2BT3A 1BRNL 2BNGA 2CWUA 2B1XB 1DMMA 2GU1A 4LGQA 2XFSA 3SLUA 5BVBA 3HOHA 1V74A 1BNFA 3U1WA 4AEQA 3H3HA 3CCJ3 1DMQA 1RSNA 1CYVA 5RNTA 1WTHA 4HVNA 2F56A 4RNTA 3Q2PA 2AAEA 2R4IA 1EUIC 3MHEA 1Q9EA 1M9GA 2M7OA 7STDA 1I2GA 3CC73 1B27A 1CYUA 1L5GB 1IV9A 1JB4A 2CK3H 1RGEA 1X1UA 1GD3A 2QA43 2GEYA 3EBYA 3JVCA 1HYFA 1DE3A 2V1LA 1WMPA 1G02A 3PGBA 1NU3A 2IA7A 2O9UX 1W01A 2BIRA 3Q3FA 3NM7A 1V57A 4BTWA 3L0RA 2CG1A 2LYXA 3VSYA 4MMXB 1GMPA 4QWTA 4L8PA 1LOYA 1OUNA 3LTCA 1FGQA 1BRJA 3WODG 2XSHB 3D9RA 2HMOB 1LNHA 3N8BA 3V98A 4STDA 2YX9A 3MPHA 1YGEA 2P0MA 1QMAA 1CEWI 1NB3I 2Z6BA 4NPBA 5G2GA 3CD63 2C4BA 2OOVA 2KF6A 3D79A 8CHOA 1A67A 3MYTA 3T8UA 2Q07A 4K90B 2MC8A 4EBGA 1M904 5STDA 2K3DA 1YIT3 2W2CA 5AIHA 1UCKA 4XBTA 3A76A 1TU5A 1I3IA 4FCMA 1VQL3 2QGUA 1MWRA 3CME3 2FXTA 4HM5B 4EYCA 2W0QA 4JRFA 3EHCA 3AHWA 3SVAA 1RKYA 1M1K4 3AMOB 1AVLA 1GMRA 3PS8A 1YJW3 3X42A 3K0ZA 1MGRA 1X1WA 1TJDA 3DM8A 1MGWA 1X1XA 4MMYB 1RN7A 9RNTA 1GYBA 2RNTA 2I9WA 2SBLA 1AY7A 4NREA 3WOEB 1N5PA 2L4VA 4HM0B 4EC6A 4BL3A 1K28A 1E97A 1NWWA 5TGNA 5DREA 2OTJ3 4LSOA 2LQVA 3GSPA 2RGQA 1A90A 3G8ZA 2CFLA 1O7GB 3CCL3 3HIIA 1ROVA 2IUKA 1GOYA 4HBRA 2HMJB 1BNSA 1BSEA 2XGLA 3JUMA 1IV7A 1TP6A 1VQK3 3JUQA 3F7SA 1RJOA 4KVHA 1OCVA 2CHCA 4KFFA 2KF3A 4ORLA 3NX0A 1B20A 2Z7AA 2JDIH 3CCR3 4N6LA 1LOWA 1BIRA 1PY3A 3FG4A 5D81A 2HMLB 1BRKA 1FZUA 4R4KA 8RNTA 3KIIA 3LOYA 2A15A 2Y73A 3EB8A 3LTAA 2CFDA 2CIUA 5DRVA 2YFLB 1UI8A 4I4KA 1ZX2A 1B2MA 1TFOA 5M18A 2PNCA 2CW9A 1HZ1A 4FMCA 1RNBA 4H61A 1B2UA 5AEWB 1UUVB 1YI23 3Q90A 4WHAA 1BSCA 1IT7A 5ELUA 1ULJB 2WO0A 2W56B 3DUKA 3M8CA 3CC43 4HZ9B 2CFGA 3CCQ3 4KFDA 1GOUA 1AR0A 1A2PA 1RN1A 1UCIA 3TDGA 1EKMA 1JBSA 1C54A 5JPPA 2E2TA 3G6E3 5EVHA 1UDII 3MKIA 2JQ5A 2ML5A 2XH9A 4BU4A 1M1XB 3KFQC 4N6NB 4O3VA 4RBNA 1JRQA 3I563 1VQ93 2HOHA 2KXGA 3DY5A 2K0MA 3GWRA 3MG3A 3O8YA 3RGRA 2HMMB 3AMOA 1IU7A 2H0HA 5IF6A 1IVXA 5G1LA 5IEOA 1TTOA 2E2VA 1A2KA 1KC84 2RFRA 4XB5A 2CH9A 3OXAA 1W2B2 4O2HA 2H0IA 3V92A 1YJ93 1PYLA 3D4AA 1NNVA 3EF8A 4JF8A 1RGGA 1FUTA 4N6MA 1YVBI 2HMNB 2OCTA 3T0UA 1RN4A 3EX9A 1NDOB 1PFPA 1GSPA 3G16A 1OGXA 6RNTA 1NB5I 5HOHA 2UX0A 1MWSA 4N6OB 3NM2A 1D6YA 2CWVA 1GY6A 3OV4A 3FZWA 2UUGC 1BRGA 2C11A 2P09A 1OH0A 1OGZA 4GL6A 1OHOA 3EQQB 3SOYA 1Q864 2WGQA 3S29A 3F9SA 1BGSA 1MNLA 3CNMA 2BMQB 3AGOA 5HGRA 3UB1A 1Z1SA 4R1KA 3CC23 3GRDA 4J5GA 2XF3A 5D82A 1MWTA 1VQ43 5JPUA 2MF7A 3OW22 2GU3A 1IT8A 3I553 3MWZA 2GSPA 1BANA 1T2HA 2RBIA 4PEJA 4WYKB 1O7NB 3D3LA 1EA2A 4H3UA 4CCVA 1GMQA 1VQ63 3BIRA 1BUJA 4AKZA 3DGLA 3RGAA 4K61A 3T8NA 4FR9A 3G713 1LQMB 1LXEA 5AIFA 2IUJA 2HMKB 4I5QA 5IG3A 1FGTA 3FG1A 1G0TA 2W56A 1RHLA 3OWUA 4R80A 1TRQA 1TFKA 1ZO2A 3I0YA 4LEHA 1QALA 3ER7A 1EQKA 3CPOA 1RGAA 1SJWA 4LYLB 3CPW2 1VQ73 4CPKA 1RRHA 1O7PB 1NO3A 1AQZA 3E99A 4OUQA 3X40A 3ZG0A 3VGNA 3DGOA 4BL2A 2XR8B 1JN5B 1WQLB 1ZGXA 2O3OA 4HAAA 3KCHA 1YNVX 3JUOA 3IMAB 2R41A 4MMZB 3ROBA 6STDA 2C10A 1VQ53 3UNLA 4R9LA 1UCJA 3IPTA 4O8SA 3ECFA 1YVSA 1B2XA 3H51A 4U13A 2OTL3 1BNRA 1X1YA 1JV2B 4FMAA 1ASKA 2SARA 4BTYA 1JKGA 2ML6A 1JB2A 4EV2A 1B2ZA 5CF2A 3PYJA 1JBRA 1BU4A 3QRDA 3Q1CA 1STFI 1BSBA 1JNQA 1ISKA 3CNXA 3X3XA 1EG9B 5IERA 2F5WA 4J9AA 3FF0A 4RNYA 5IG0A 5JBSA 3ALAA 4X2HA 1ROAA 3KE7A 1JZOA 2H0GA 1T3BA 2BMRB 3NBBA 1LQGC 3FCSB 4HM3B 2RSXA 1KQS2 5G1KA 2IYJA 4EXRA 4KT3B 1RTUA 2W04A 4OVMA 4MEIA 4HYZA 2WOFA 3JUPA 1GD4A 1BUQA 3WA3A 2RCDA 2BU4A 1W5ZA 5IG5A 1V58A 1VZZA 1SIIA 1UUWB 2ZHXB 1Q824 1YGWA 1QAKA 1MWUA 1AV4A 3V99A 3VF1A 1FGRA 4HOHA 4BIRA 7RNTA 1NJI4 2ZDJA 3SYUA 2J8XB 4KZ1A 1CQSA 2CX0A 3LH4A 2XGNA 3HIGA 4N3VA 3CCE3 3BNBA 4FCJA 3F40A 3FGYA 1IVUA 4K1UA 4CDLA 2KF4A 1R4CA 5IG4A 4NHFA 3S67A 1W6CA 2GEXA 1JJ22 1BNEA 1I0VA 1LOXA 1WNHA 1DMNA 2CX1A 2E2UA 3CCU3 4R9KA 2UGIA 1FUWA 1I3FA 1VQQA 5KP3A 2GXFA 4J8TA 1B3SA 1IVWA 1HKXA 4BTXA 1BRHA 4G1MB 4CJNA 2Z76A 1BNJA 6GSPA 3BNCA 1YJN3 3NBJA 4EW5A 1O7HB 3CXC2 1FW7A 1IVVA 3BNDA 1N8QA 1B2SA 3IJEB 5AYRB 1UGHI 2IY2A 3G0KA 1I0XA 1FGOA 1FYSA 1OF5B 2ZL8A 4XBYA 1GY7A 3N9HA 3OWYA 3F14A 3LT8A 5KP1A 3UL6A 1UI7A 3LTBA 4WFOA 3UL5A 2F4YA 1BRIA 4RZMA 2XRXB 1BRSA 3URPA 4XDVA 4HZBB 1WMOA 1IQYA 4LMIA 3KN4A 3LMLA 5AIGA 5EEOA 1W2ZA 1S5AA 1CH0A 1W02A 4FMBA 5D83A 5AYSC 5M19A 4AKYA 1VQM3 1JBTA 1HU9A 3WDGB 3RDEA 3AGNA 5LC6A 3FH1A 1ZS7A 3AHSA 3G4S3 4EV5A 3FSDA 4XBXA 3EN8A 3GZBA 4KFEA 1O7MB 1VQN3 2STDA 2F5MA 5A0OB 4IIAA 3DZLA 3PCRA 1Y4KA 3BU4A 3CCS3 5ELJA 1LNIA 1LOVA 4MJDA 2CFKA 3K63A 1BVIA 2W03A 5BU4A 3EC9A 1VQO3 3N54B 1W7CA 1RMSA 3JUNA 1D6UA 1J2BA 1E3RA 1SARA 3KZTA 1PU4A 2XEPA 2KRTA 2F86B 2OWPA 5CLKA 2W9PA 3WOFB 2D1WA 2GBWB 4J5KA 4OK0A 5M1AA 3MG1A 1BAOA 3ZFZA 3A5EA 1IQXA
chains in the Genus database with same CATH topology
1A2VA 1MOLA 4TX4A 5AI1A 2INXA 3S28A 3LYGA 1Q814 5IW9A 3NBRA 3EJVA 3J7Yd 4HM1B 1KD14 2BO9B 4HM7B 1Q42A 2BHMA 2CKFB 5CF1A 4XDWA 1DVCA 4N6TA 3LZAA 1TIJA 2CFWA 4IT7A 3BLZA 4RNZA 2F99A 1QJGA 4FMDA 5IEPA 1W4NA 2OQEC 2P38A 3LXUX 3OWSA 1VQP3 4HKVB 3F8HA 4ZM8A 2W6JH 2YFJB 2P0XA 3F8XA 3F7XA 3GZXB 3S27A 2XSOB 1ULIB 5CXOA 1KSIA 1DYUA 1W6YA 1GY5A 5AEUB 1FA3A 3LTDA 3CMA3 1N5HA 1OF5A 2YFIB 5EQLA 1Q40A 2CG0A 2F98A 3FKAA 4XM4A 5CK6A 3B4OA 3KSPA 2OQEA 3FLJA 3BB9A 3STDA 1SQWA 3SEDA 1K8A4 1IDPA 3PCSA 2BMOB 2P05A 1VQ83 2W9QA 3S5CA 3DGMA 3GZRA 4HJLB 1W00A 1E3VA 3MG2A 3NHXA 2QEX3 3CCM3 4LZIA 1Q7Y4 1AVKA 3HI7A 4O02B 1TUHA 3K5TA 4WWUC 2CC3A 3NUVA 3EBTA 4FCZA 2Y74A 2FNQA 2WOHA 3KKGA 5LC6A 5FGOA 4HM8B 4WYKA 1IQ8A 1IK3A 3B8LA 3WA2X 1RRLA 1W6GA 3GAXA 3NV0A 1U5OA 4X2OA 1DVDA 5I97A 2OOVC 1U8CB 3QK9A 3OX9A 5LC7A 3DXOA 2D42A 1KWIA 5BXQA 1OACA 2PZVA 3K9MC 1K9M4 3PZWA 4GB5A 1K41A 2CWTA 1Q40B 3NQZA 4N6V0 2Z77A 2K54A 3NQYA 3NXJA 2WGOA 1C7HA 1OPYA 3DMCA 3B4PA 4Q53A 3HX8A 3MSOA 5FW5A 3HK4A 1S723 3WMDA 1STDA 3PXMA 4N6UA 2KCDA 1D6ZA 1JN5A 2GBXB 2QIYA 1YHQ3 5AIIA 4L8OA 1N9EA 3X41A 1OHPA 4K1VA 2FGTA 3CCV3 1US1A 3EN1B 3FG3A 3HZPA 2B24B 2IMJA 1SPUA 4IPBA 3SXXA 4HM2B 1O7WB 1JKGB 3X3YA 3NV0B 3X3ZA 1YIJ3 1LVNA 3EE1A 4HM6B 5KP4A 4HM4B 1FGMA 3U97A 3DGNA 4WP5A 4L7KA 1K734 1WMNA 3BNEA 1JB5A 3SX1A 3UJMA 1G96A 1OHSA 3GZYB 5IENA 1F8NA 3SOAA 1N9JA 3FF2A 1QAFA 2XFTA 1GS3A 1N8R4 1UW1A 1SIHA 3CU3A 3B7CA 3KSED 1T5YA 3LT9A 3K7CA 1QVG2 2BT3A 2BNGA 2CWUA 2B1XB 1DMMA 2GU1A 4LGQA 2XFSA 3SLUA 5BVBA 3U1WA 1V74A 3CCJ3 4AEQA 3H3HA 1DMQA 1CYVA 1WTHA 4HVNA 3Q2PA 2R4IA 3MHEA 1M9GA 2M7OA 7STDA 3CC73 1CYUA 1L5GB 1IV9A 1JB4A 2CK3H 1GD3A 2QA43 2GEYA 3EBYA 3JVCA 2V1LA 1WMPA 3PGBA 1NU3A 2IA7A 2O9UX 1W01A 3NM7A 4BTWA 3L0RA 2CG1A 2LYXA 3VSYA 4MMXB 4QWTA 4L8PA 1OUNA 3LTCA 1FGQA 3WODG 2XSHB 3D9RA 2HMOB 1LNHA 3N8BA 3V98A 4STDA 2YX9A 3MPHA 1YGEA 2P0MA 1QMAA 1CEWI 1NB3I 2Z6BA 5G2GA 3CD63 2OOVA 1A67A 8CHOA 3MYTA 3T8UA 2Q07A 4K90B 2MC8A 4EBGA 1M904 5STDA 1YIT3 2W2CA 5AIHA 4XBTA 3A76A 1TU5A 4FCMA 1VQL3 2QGUA 3CME3 2FXTA 4HM5B 4EYCA 2W0QA 4JRFA 3EHCA 3SVAA 1RKYA 1M1K4 3AMOB 1AVLA 3PS8A 1YJW3 3X42A 3K0ZA 3DM8A 4MMYB 1RN7A 1GYBA 2I9WA 2SBLA 4NREA 3WOEB 1N5PA 2L4VA 4HM0B 4EC6A 1NWWA 1E97A 1K28A 5TGNA 5DREA 2OTJ3 4LSOA 2LQVA 2RGQA 1A90A 3G8ZA 2CFLA 1O7GB 3CCL3 3HIIA 1ROVA 2IUKA 4HBRA 2HMJB 2XGLA 3JUMA 1IV7A 1TP6A 1VQK3 3JUQA 3F7SA 1RJOA 4KVHA 1OCVA 2CHCA 4KFFA 4ORLA 3NX0A 2Z7AA 2JDIH 3CCR3 4N6LA 3FG4A 5D81A 2HMLB 4R4KA 3KIIA 3LOYA 2A15A 2Y73A 3EB8A 3LTAA 2CFDA 2CIUA 5DRVA 2YFLB 1UI8A 4I4KA 1ZX2A 1TFOA 2PNCA 2CW9A 4FMCA 4H61A 5AEWB 1UUVB 1YI23 3Q90A 4WHAA 1IT7A 5ELUA 1ULJB 2WO0A 2W56B 3DUKA 3M8CA 3CC43 4HZ9B 2CFGA 3CCQ3 4KFDA 1AR0A 3TDGA 1EKMA 5JPPA 2E2TA 3G6E3 5EVHA 3MKIA 2JQ5A 2ML5A 2XH9A 1M1XB 3KFQC 4N6NB 4O3VA 4RBNA 1JRQA 3I563 1VQ93 2KXGA 3DY5A 2K0MA 3GWRA 3MG3A 3O8YA 3RGRA 2HMMB 3AMOA 1IU7A 5IF6A 1IVXA 5IEOA 2E2VA 1A2KA 1KC84 2RFRA 4XB5A 2CH9A 3OXAA 1W2B2 4O2HA 3V92A 1YJ93 3EF8A 4JF8A 4N6MA 1YVBI 2HMNB 2OCTA 3T0UA 3EX9A 1NDOB 1PFPA 3G16A 1OGXA 1NB5I 2UX0A 4N6OB 3NM2A 1D6YA 2CWVA 1GY6A 3OV4A 3FZWA 2C11A 2P09A 1OH0A 1OGZA 4GL6A 1OHOA 3EQQB 3SOYA 1Q864 2WGQA 3S29A 3F9SA 1MNLA 3CNMA 2BMQB 5HGRA 3UB1A 1Z1SA 4R1KA 3CC23 3GRDA 2XF3A 5D82A 1VQ43 5JPUA 2MF7A 3OW22 2GU3A 1IT8A 3I553 3MWZA 4PEJA 4WYKB 1O7NB 3D3LA 1EA2A 4H3UA 4CCVA 1VQ63 4AKZA 3DGLA 3RGAA 4K61A 3T8NA 4FR9A 3G713 1LXEA 5AIFA 2IUJA 2HMKB 5IG3A 1FGTA 3FG1A 2W56A 3OWUA 4R80A 1TFKA 1ZO2A 3I0YA 4LEHA 1QALA 3ER7A 1EQKA 3CPOA 1SJWA 3CPW2 1VQ73 1RRHA 1O7PB 1NO3A 3E99A 4OUQA 3X40A 3VGNA 3DGOA 2XR8B 1JN5B 1WQLB 2O3OA 3ROBA 6STDA 3JUOA 3IMAB 4MMZB 2C10A 1VQ53 3UNLA 4R9LA 3IPTA 4O8SA 2OTL3 3ECFA 3H51A 4U13A 4FMAA 1JV2B 1ASKA 4BTYA 1JKGA 2ML6A 1JB2A 4EV2A 5CF2A 3PYJA 3QRDA 3Q1CA 1STFI 1JNQA 1ISKA 3CNXA 3X3XA 1EG9B 5IERA 4J9AA 5IG0A 3FF0A 4RNYA 5JBSA 3ALAA 4X2HA 1ROAA 3KE7A 2BMRB 3NBBA 3FCSB 4HM3B 2RSXA 1KQS2 4EXRA 2W04A 4OVMA 4MEIA 4HYZA 2WOFA 3JUPA 1GD4A 1BUQA 3WA3A 2RCDA 1W5ZA 5IG5A 1VZZA 1SIIA 1UUWB 1Q824 1QAKA 3V99A 1AV4A 3VF1A 1NJI4 1FGRA 1QVF2 2ZDJA 4KZ1A 1CQSA 3LH4A 4N3VA 2XGNA 3HIGA 3CCE3 3BNBA 4FCJA 3F40A 3FGYA 1IVUA 4K1UA 4CDLA 5IG4A 1R4CA 4NHFA 3S67A 1W6CA 2GEXA 1JJ22 1LOXA 1WNHA 1DMNA 2E2UA 3CCU3 4R9KA 1FUWA 5KP3A 2GXFA 4J8TA 1IVWA 1HKXA 4BTXA 4G1MB 2Z76A 1YJN3 3BNCA 3NBJA 1O7HB 3CXC2 1IVVA 3BNDA 1N8QA 3IJEB 5AYRB 3G0KA 1FGOA 2ZL8A 1OF5B 4XBYA 1GY7A 3N9HA 3OWYA 3F14A 3LT8A 5KP1A 3UL6A 1UI7A 3LTBA 4WFOA 3UL5A 4RZMA 2XRXB 4XDVA 4HZBB 1WMOA 1IQYA 4LMIA 3KN4A 3LMLA 5AIGA 5EEOA 1W2ZA 1S5AA 1VQM3 1W02A 4FMBA 5D83A 5AYSC 4AKYA 1HU9A 3WDGB 3RDEA 3FH1A 3G4S3 4EV5A 3FSDA 4XBXA 3EN8A 3GZBA 4KFEA 1O7MB 1VQN3 2STDA 5A0OB 4IIAA 3DZLA 3PCRA 1Y4KA 3CCS3 5ELJA 4MJDA 2CFKA 3K63A 2W03A 3EC9A 1VQO3 3N54B 1W7CA 3JUNA 1D6UA 1J2BA 1E3RA 3KZTA 1PU4A 2XEPA 2KRTA 2F86B 2OWPA 5CLKA 2W9PA 3WOFB 2D1WA 2GBWB 4OK0A 3MG1A 1IQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A2V A;  2BT3 A;  2CWU A;  3X3X A;  5IW9 A;  2WO0 A;  3ALA A;  2CFG A;  4KFD A;  1EKM A;  2CFW A;  2E2T A;  3NBB A;  1W4N A;  2OQE C;  4EXR A;  1WMP A;  1JRQ A;  3PGB A;  2IA7 A;  2K0M A;  2WOF A;  4BTW A;  1DYU A;  1KSI A;  3WA3 A;  3AMO A;  1W5Z A;  1IU7 A;  2CG1 A;  1IVX A;  1SII A;  2E2V A;  2CG0 A;  2OQE A;  1QAK A;  1AV4 A;  3HIG A;  2YX9 A;  3MPH A;  1IVU A;  3T0U A;  2OOV A;  1AVK A;  1W6C A;  3HI7 A;  3K5T A;  1D6Y A;  2CWV A;  2E2U A;  2Y74 A;  2WOH A;  2C11 A;  1TU5 A;  3WA2 X;  1IVW A;  1W6G A;  4BTX A;  2WGQ A;  2OOV C;  2W0Q A;  3NBJ A;  1RKY A;  1IVV A;  1OAC A;  3AMO B;  1AVL A;  2CWT A;  3NQZ A;  3X42 A;  2GU3 A;  2ZL8 A;  3N9H A;  3NQY A;  1UI7 A;  1WMO A;  1IQY A;  3KN4 A;  1W2Z A;  1D6Z A;  1N9E A;  3X41 A;  1US1 A;  4EV5 A;  2CFL A;  4KFE A;  1SPU A;  3SXX A;  3HII A;  3X3Y A;  1QAL A;  3X3Z A;  1LVN A;  3X40 A;  1RJO A;  2CFK A;  4KFF A;  1W7C A;  2C10 A;  1D6U A;  1WMN A;  3SX1 A;  3KII A;  1PU4 A;  3LOY A;  2Y73 A;  2CFD A;  4BTY A;  2D1W A;  1QAF A;  1UI8 A;  4EV2 A;  1SIH A;  2PNC A;  1IQX A; 
#chains in the Genus database with same CATH topology
 1A2V A;  1MOL A;  1TRP A;  1RLS A;  4TX4 A;  1UCL A;  5AI1 A;  2INX A;  3S28 A;  2ZA4 A;  3LYG A;  1RCL A;  3ZG5 A;  1RGL A;  1Q81 4;  5IW9 A;  3NBR A;  3EJV A;  3J7Y d;  4HM1 B;  4DKI A;  1KD1 4;  2BO9 B;  4HM7 B;  1BSD A;  1Q42 A;  2BHM A;  2CKF B;  5CF1 A;  4XDW A;  1DVC A;  4N6T A;  3LZA A;  1TIJ A;  1T2I A;  2CFW A;  4IT7 A;  3BLZ A;  4RNZ A;  2F99 A;  1I2E A;  1QJG A;  4FMD A;  5IEP A;  1BOX A;  1JZD A;  1W4N A;  2OQE C;  2P38 A;  3LXU X;  3OWS A;  1VQP 3;  4HKV B;  3F8H A;  4ZM8 A;  2W6J H;  2YFJ B;  2P0X A;  3F8X A;  1EEJ A;  3F7X A;  1RGC A;  3GZX B;  3S27 A;  1UGI A;  4GHO A;  2XSO B;  1B21 A;  1ULI B;  1DYU A;  1KSI A;  1W6Y A;  4GSP A;  5CXO A;  1GY5 A;  1RGF A;  5AEU B;  2L1S A;  1FA3 A;  3LTD A;  3CMA 3;  1N5H A;  1OF5 A;  2YFI B;  5EQL A;  1Q40 A;  2CG0 A;  2F98 A;  3FKA A;  4XM4 A;  5CK6 A;  3B4O A;  3KSP A;  2OQE A;  3FLJ A;  3BB9 A;  3STD A;  1SQW A;  3SED A;  1K8A 4;  1IDP A;  3PCS A;  2BMO B;  2P05 A;  1VQ8 3;  2W9Q A;  3S5C A;  3DGM A;  3GZR A;  4HJL B;  3RNT A;  1W00 A;  4ILF A;  1E3V A;  3MG2 A;  3NHX A;  2QEX 3;  3CCM 3;  4LZI A;  3WHO A;  1Q7Y 4;  1AVK A;  1LRA A;  3HI7 A;  4O02 B;  1TUH A;  3K5T A;  4WWU C;  2CC3 A;  3NUV A;  3EBT A;  4FCZ A;  2Y74 A;  2FNQ A;  2WOH A;  3D5I A;  3KKG A;  1R4Y A;  4HM8 B;  5FGO A;  4WYK A;  1IQ8 A;  1IK3 A;  3B8L A;  1Q7H A;  1RGH A;  3WA2 X;  1RRL A;  1W6G A;  3GAX A;  3NV0 A;  1FUS A;  1U5O A;  1RDS A;  4X2O A;  5I97 A;  1QVF 2;  1DVD A;  2OOV C;  1DET A;  1U8C B;  3QK9 A;  1BSA A;  3OX9 A;  5LC7 A;  3DXO A;  1UUG B;  1KWI A;  2D42 A;  5BXQ A;  1OAC A;  2PZV A;  3DGY A;  3K9M C;  1K9M 4;  3PZW A;  1RNT A;  4GB5 A;  1K41 A;  2CWT A;  2KF5 A;  1Q40 B;  3NQZ A;  4N6V 0;  2Z77 A;  2K54 A;  3NQY A;  1GOV A;  3NXJ A;  2WGO A;  1C7H A;  1OPY A;  7GSP A;  3DMC A;  1BNI A;  3B4P A;  4Q53 A;  1RCK A;  2AAD A;  3HX8 A;  3MSO A;  5FW5 A;  3HK4 A;  1S72 3;  3WMD A;  1STD A;  3PXM A;  4N6U A;  2KCD A;  5BIR A;  1D6Z A;  1JN5 A;  2GBX B;  2QIY A;  1YHQ 3;  5AII A;  4L8O A;  1N9E A;  3X41 A;  1OHP A;  1I70 A;  2FGT A;  4K1V A;  1US1 A;  3CCV 3;  3EN1 B;  3FG3 A;  3HZP A;  2B24 B;  3DH2 A;  2IMJ A;  1SPU A;  4IPB A;  3SXX A;  1IYY A;  1RGK A;  4HM2 B;  1O7W B;  1JKG B;  5GSP A;  3X3Y A;  3NV0 B;  3X3Z A;  1YIJ 3;  1LVN A;  3EE1 A;  4HM6 B;  5KP4 A;  4HM4 B;  1FGM A;  3U97 A;  3DGN A;  3D5G A;  4WP5 A;  4L7K A;  1K73 4;  1WMN A;  3BNE A;  1JB5 A;  3SX1 A;  3UJM A;  1G96 A;  1OHS A;  2KAA A;  3GZY B;  5IEN A;  1F8N A;  3SOA A;  1N9J A;  3WR2 A;  3FF2 A;  1QAF A;  2XFT A;  1BNG A;  1GS3 A;  1N8R 4;  1UW1 A;  1SIH A;  3CU3 A;  3B7C A;  3KSE D;  1T5Y A;  1I8V A;  1I2F A;  3K7C A;  3LT9 A;  1QVG 2;  2BT3 A;  1BRN L;  2BNG A;  2CWU A;  2B1X B;  1DMM A;  2GU1 A;  4LGQ A;  2XFS A;  3SLU A;  5BVB A;  3HOH A;  1V74 A;  1BNF A;  3U1W A;  4AEQ A;  3H3H A;  3CCJ 3;  1DMQ A;  1RSN A;  1CYV A;  5RNT A;  1WTH A;  4HVN A;  2F56 A;  4RNT A;  3Q2P A;  2AAE A;  2R4I A;  1EUI C;  3MHE A;  1Q9E A;  1M9G A;  2M7O A;  7STD A;  1I2G A;  3CC7 3;  1B27 A;  1CYU A;  1L5G B;  1IV9 A;  1JB4 A;  2CK3 H;  1RGE A;  1X1U A;  1GD3 A;  2QA4 3;  2GEY A;  3EBY A;  3JVC A;  1HYF A;  1DE3 A;  2V1L A;  1WMP A;  1G02 A;  3PGB A;  1NU3 A;  2IA7 A;  2O9U X;  1W01 A;  2BIR A;  3Q3F A;  3NM7 A;  1V57 A;  4BTW A;  3L0R A;  2CG1 A;  2LYX A;  3VSY A;  4MMX B;  1GMP A;  4QWT A;  4L8P A;  1LOY A;  1OUN A;  3LTC A;  1FGQ A;  1BRJ A;  3WOD G;  2XSH B;  3D9R A;  2HMO B;  1LNH A;  3N8B A;  3V98 A;  4STD A;  2YX9 A;  3MPH A;  1YGE A;  2P0M A;  1QMA A;  1CEW I;  1NB3 I;  2Z6B A;  4NPB A;  5G2G A;  3CD6 3;  2C4B A;  2OOV A;  2KF6 A;  3D79 A;  8CHO A;  1A67 A;  3MYT A;  3T8U A;  2Q07 A;  4K90 B;  2MC8 A;  4EBG A;  1M90 4;  5STD A;  2K3D A;  1YIT 3;  2W2C A;  5AIH A;  1UCK A;  4XBT A;  3A76 A;  1TU5 A;  1I3I A;  4FCM A;  1VQL 3;  2QGU A;  1MWR A;  3CME 3;  2FXT A;  4HM5 B;  4EYC A;  2W0Q A;  4JRF A;  3EHC A;  3AHW A;  3SVA A;  1RKY A;  1M1K 4;  3AMO B;  1AVL A;  1GMR A;  3PS8 A;  1YJW 3;  3X42 A;  3K0Z A;  1MGR A;  1X1W A;  1TJD A;  3DM8 A;  1MGW A;  1X1X A;  4MMY B;  1RN7 A;  9RNT A;  1GYB A;  2RNT A;  2I9W A;  2SBL A;  1AY7 A;  4NRE A;  3WOE B;  1N5P A;  2L4V A;  4HM0 B;  4EC6 A;  4BL3 A;  1K28 A;  1E97 A;  1NWW A;  5TGN A;  5DRE A;  2OTJ 3;  4LSO A;  2LQV A;  3GSP A;  2RGQ A;  1A90 A;  3G8Z A;  2CFL A;  1O7G B;  3CCL 3;  3HII A;  1ROV A;  2IUK A;  1GOY A;  4HBR A;  2HMJ B;  1BNS A;  1BSE A;  2XGL A;  3JUM A;  1IV7 A;  1TP6 A;  1VQK 3;  3JUQ A;  3F7S A;  1RJO A;  4KVH A;  1OCV A;  2CHC A;  4KFF A;  2KF3 A;  4ORL A;  3NX0 A;  1B20 A;  2Z7A A;  2JDI H;  3CCR 3;  4N6L A;  1LOW A;  1BIR A;  1PY3 A;  3FG4 A;  5D81 A;  2HML B;  1BRK A;  1FZU A;  4R4K A;  8RNT A;  3KII A;  3LOY A;  2A15 A;  2Y73 A;  3EB8 A;  3LTA A;  2CFD A;  2CIU A;  5DRV A;  2YFL B;  1UI8 A;  4I4K A;  1ZX2 A;  1B2M A;  1TFO A;  5M18 A;  2PNC A;  2CW9 A;  1HZ1 A;  4FMC A;  1RNB A;  4H61 A;  1B2U A;  5AEW B;  1UUV B;  1YI2 3;  3Q90 A;  4WHA A;  1BSC A;  1IT7 A;  5ELU A;  1ULJ B;  2WO0 A;  2W56 B;  3DUK A;  3M8C A;  3CC4 3;  4HZ9 B;  2CFG A;  3CCQ 3;  4KFD A;  1GOU A;  1AR0 A;  1A2P A;  1RN1 A;  1UCI A;  3TDG A;  1EKM A;  1JBS A;  1C54 A;  5JPP A;  2E2T A;  3G6E 3;  5EVH A;  1UDI I;  3MKI A;  2JQ5 A;  2ML5 A;  2XH9 A;  4BU4 A;  1M1X B;  3KFQ C;  4N6N B;  4O3V A;  4RBN A;  1JRQ A;  3I56 3;  1VQ9 3;  2HOH A;  2KXG A;  3DY5 A;  2K0M A;  3GWR A;  3MG3 A;  3O8Y A;  3RGR A;  2HMM B;  3AMO A;  1IU7 A;  2H0H A;  5IF6 A;  1IVX A;  5G1L A;  5IEO A;  1TTO A;  2E2V A;  1A2K A;  1KC8 4;  2RFR A;  4XB5 A;  2CH9 A;  3OXA A;  1W2B 2;  4O2H A;  2H0I A;  3V92 A;  1YJ9 3;  1PYL A;  3D4A A;  1NNV A;  3EF8 A;  4JF8 A;  1RGG A;  1FUT A;  4N6M A;  1YVB I;  2HMN B;  2OCT A;  3T0U A;  1RN4 A;  3EX9 A;  1NDO B;  1PFP A;  1GSP A;  3G16 A;  1OGX A;  6RNT A;  1NB5 I;  5HOH A;  2UX0 A;  1MWS A;  4N6O B;  3NM2 A;  1D6Y A;  2CWV A;  1GY6 A;  3OV4 A;  3FZW A;  2UUG C;  1BRG A;  2C11 A;  2P09 A;  1OH0 A;  1OGZ A;  4GL6 A;  1OHO A;  3EQQ B;  3SOY A;  1Q86 4;  2WGQ A;  3S29 A;  3F9S A;  1BGS A;  1MNL A;  3CNM A;  2BMQ B;  3AGO A;  5HGR A;  3UB1 A;  1Z1S A;  4R1K A;  3CC2 3;  3GRD A;  4J5G A;  2XF3 A;  5D82 A;  1MWT A;  1VQ4 3;  5JPU A;  2MF7 A;  3OW2 2;  2GU3 A;  1IT8 A;  3I55 3;  3MWZ A;  2GSP A;  1BAN A;  1T2H A;  2RBI A;  4PEJ A;  4WYK B;  1O7N B;  3D3L A;  1EA2 A;  4H3U A;  4CCV A;  1GMQ A;  1VQ6 3;  3BIR A;  1BUJ A;  4AKZ A;  3DGL A;  3RGA A;  4K61 A;  3T8N A;  4FR9 A;  3G71 3;  1LQM B;  1LXE A;  5AIF A;  2IUJ A;  2HMK B;  4I5Q A;  5IG3 A;  1FGT A;  3FG1 A;  1G0T A;  2W56 A;  1RHL A;  3OWU A;  4R80 A;  1TRQ A;  1TFK A;  1ZO2 A;  3I0Y A;  4LEH A;  1QAL A;  3ER7 A;  1EQK A;  3CPO A;  1RGA A;  1SJW A;  4LYL B;  3CPW 2;  1VQ7 3;  4CPK A;  1RRH A;  1O7P B;  1NO3 A;  1AQZ A;  3E99 A;  4OUQ A;  3X40 A;  3ZG0 A;  3VGN A;  3DGO A;  4BL2 A;  2XR8 B;  1JN5 B;  1WQL B;  1ZGX A;  2O3O A;  4HAA A;  3KCH A;  1YNV X;  3JUO A;  3IMA B;  2R41 A;  4MMZ B;  3ROB A;  6STD A;  2C10 A;  1VQ5 3;  3UNL A;  4R9L A;  1UCJ A;  3IPT A;  4O8S A;  3ECF A;  1YVS A;  1B2X A;  3H51 A;  4U13 A;  2OTL 3;  1BNR A;  1X1Y A;  1JV2 B;  4FMA A;  1ASK A;  2SAR A;  4BTY A;  1JKG A;  2ML6 A;  1JB2 A;  4EV2 A;  1B2Z A;  5CF2 A;  3PYJ A;  1JBR A;  1BU4 A;  3QRD A;  3Q1C A;  1STF I;  1BSB A;  1JNQ A;  1ISK A;  3CNX A;  3X3X A;  1EG9 B;  5IER A;  2F5W A;  4J9A A;  3FF0 A;  4RNY A;  5IG0 A;  5JBS A;  3ALA A;  4X2H A;  1ROA A;  3KE7 A;  1JZO A;  2H0G A;  1T3B A;  2BMR B;  3NBB A;  1LQG C;  3FCS B;  4HM3 B;  2RSX A;  1KQS 2;  5G1K A;  2IYJ A;  4EXR A;  4KT3 B;  1RTU A;  2W04 A;  4OVM A;  4MEI A;  4HYZ A;  2WOF A;  3JUP A;  1GD4 A;  1BUQ A;  3WA3 A;  2RCD A;  2BU4 A;  1W5Z A;  5IG5 A;  1V58 A;  1VZZ A;  1SII A;  1UUW B;  2ZHX B;  1Q82 4;  1YGW A;  1QAK A;  1MWU A;  1AV4 A;  3V99 A;  3VF1 A;  1FGR A;  4HOH A;  4BIR A;  7RNT A;  1NJI 4;  2ZDJ A;  3SYU A;  2J8X B;  4KZ1 A;  1CQS A;  2CX0 A;  3LH4 A;  2XGN A;  3HIG A;  4N3V A;  3CCE 3;  3BNB A;  4FCJ A;  3F40 A;  3FGY A;  1IVU A;  4K1U A;  4CDL A;  2KF4 A;  1R4C A;  5IG4 A;  4NHF A;  3S67 A;  1W6C A;  2GEX A;  1JJ2 2;  1BNE A;  1I0V A;  1LOX A;  1WNH A;  1DMN A;  2CX1 A;  2E2U A;  3CCU 3;  4R9K A;  2UGI A;  1FUW A;  1I3F A;  1VQQ A;  5KP3 A;  2GXF A;  4J8T A;  1B3S A;  1IVW A;  1HKX A;  4BTX A;  1BRH A;  4G1M B;  4CJN A;  2Z76 A;  1BNJ A;  6GSP A;  3BNC A;  1YJN 3;  3NBJ A;  4EW5 A;  1O7H B;  3CXC 2;  1FW7 A;  1IVV A;  3BND A;  1N8Q A;  1B2S A;  3IJE B;  5AYR B;  1UGH I;  2IY2 A;  3G0K A;  1I0X A;  1FGO A;  1FYS A;  1OF5 B;  2ZL8 A;  4XBY A;  1GY7 A;  3N9H A;  3OWY A;  3F14 A;  3LT8 A;  5KP1 A;  3UL6 A;  1UI7 A;  3LTB A;  4WFO A;  3UL5 A;  2F4Y A;  1BRI A;  4RZM A;  2XRX B;  1BRS A;  3URP A;  4XDV A;  4HZB B;  1WMO A;  1IQY A;  4LMI A;  3KN4 A;  3LML A;  5AIG A;  5EEO A;  1W2Z A;  1S5A A;  1CH0 A;  1W02 A;  4FMB A;  5D83 A;  5AYS C;  5M19 A;  4AKY A;  1VQM 3;  1JBT A;  1HU9 A;  3WDG B;  3RDE A;  3AGN A;  5LC6 A;  3FH1 A;  1ZS7 A;  3AHS A;  3G4S 3;  4EV5 A;  3FSD A;  4XBX A;  3EN8 A;  3GZB A;  4KFE A;  1O7M B;  1VQN 3;  2STD A;  2F5M A;  5A0O B;  4IIA A;  3DZL A;  3PCR A;  1Y4K A;  3BU4 A;  3CCS 3;  5ELJ A;  1LNI A;  1LOV A;  4MJD A;  2CFK A;  3K63 A;  1BVI A;  2W03 A;  5BU4 A;  3EC9 A;  1VQO 3;  3N54 B;  1W7C A;  1RMS A;  3JUN A;  1D6U A;  1J2B A;  1E3R A;  1SAR A;  3KZT A;  1PU4 A;  2XEP A;  2KRT A;  2F86 B;  2OWP A;  5CLK A;  2W9P A;  3WOF B;  2D1W A;  2GBW B;  4J5K A;  4OK0 A;  5M1A A;  3MG1 A;  1BAO A;  3ZFZ A;  3A5E A;  1IQX A; 
#chains in the Genus database with same CATH homology
 1A2V A;  1MOL A;  4TX4 A;  5AI1 A;  2INX A;  3S28 A;  3LYG A;  1Q81 4;  5IW9 A;  3NBR A;  3EJV A;  3J7Y d;  4HM1 B;  1KD1 4;  2BO9 B;  4HM7 B;  1Q42 A;  2BHM A;  2CKF B;  5CF1 A;  4XDW A;  1DVC A;  4N6T A;  3LZA A;  1TIJ A;  2CFW A;  4IT7 A;  3BLZ A;  4RNZ A;  2F99 A;  1QJG A;  4FMD A;  5IEP A;  1W4N A;  2OQE C;  2P38 A;  3LXU X;  3OWS A;  1VQP 3;  4HKV B;  3F8H A;  4ZM8 A;  2W6J H;  2YFJ B;  2P0X A;  3F8X A;  3F7X A;  3GZX B;  3S27 A;  2XSO B;  1ULI B;  5CXO A;  1KSI A;  1DYU A;  1W6Y A;  1GY5 A;  5AEU B;  1FA3 A;  3LTD A;  3CMA 3;  1N5H A;  1OF5 A;  2YFI B;  5EQL A;  1Q40 A;  2CG0 A;  2F98 A;  3FKA A;  4XM4 A;  5CK6 A;  3B4O A;  3KSP A;  2OQE A;  3FLJ A;  3BB9 A;  3STD A;  1SQW A;  3SED A;  1K8A 4;  1IDP A;  3PCS A;  2BMO B;  2P05 A;  1VQ8 3;  2W9Q A;  3S5C A;  3DGM A;  3GZR A;  4HJL B;  1W00 A;  1E3V A;  3MG2 A;  3NHX A;  2QEX 3;  3CCM 3;  4LZI A;  1Q7Y 4;  1AVK A;  3HI7 A;  4O02 B;  1TUH A;  3K5T A;  4WWU C;  2CC3 A;  3NUV A;  3EBT A;  4FCZ A;  2Y74 A;  2FNQ A;  2WOH A;  3KKG A;  5LC6 A;  5FGO A;  4HM8 B;  4WYK A;  1IQ8 A;  1IK3 A;  3B8L A;  3WA2 X;  1RRL A;  1W6G A;  3GAX A;  3NV0 A;  1U5O A;  4X2O A;  1DVD A;  5I97 A;  2OOV C;  1U8C B;  3QK9 A;  3OX9 A;  5LC7 A;  3DXO A;  2D42 A;  1KWI A;  5BXQ A;  1OAC A;  2PZV A;  3K9M C;  1K9M 4;  3PZW A;  4GB5 A;  1K41 A;  2CWT A;  1Q40 B;  3NQZ A;  4N6V 0;  2Z77 A;  2K54 A;  3NQY A;  3NXJ A;  2WGO A;  1C7H A;  1OPY A;  3DMC A;  3B4P A;  4Q53 A;  3HX8 A;  3MSO A;  5FW5 A;  3HK4 A;  1S72 3;  3WMD A;  1STD A;  3PXM A;  4N6U A;  2KCD A;  1D6Z A;  1JN5 A;  2GBX B;  2QIY A;  1YHQ 3;  5AII A;  4L8O A;  1N9E A;  3X41 A;  1OHP A;  4K1V A;  2FGT A;  3CCV 3;  1US1 A;  3EN1 B;  3FG3 A;  3HZP A;  2B24 B;  2IMJ A;  1SPU A;  4IPB A;  3SXX A;  4HM2 B;  1O7W B;  1JKG B;  3X3Y A;  3NV0 B;  3X3Z A;  1YIJ 3;  1LVN A;  3EE1 A;  4HM6 B;  5KP4 A;  4HM4 B;  1FGM A;  3U97 A;  3DGN A;  4WP5 A;  4L7K A;  1K73 4;  1WMN A;  3BNE A;  1JB5 A;  3SX1 A;  3UJM A;  1G96 A;  1OHS A;  3GZY B;  5IEN A;  1F8N A;  3SOA A;  1N9J A;  3FF2 A;  1QAF A;  2XFT A;  1GS3 A;  1N8R 4;  1UW1 A;  1SIH A;  3CU3 A;  3B7C A;  3KSE D;  1T5Y A;  3LT9 A;  3K7C A;  1QVG 2;  2BT3 A;  2BNG A;  2CWU A;  2B1X B;  1DMM A;  2GU1 A;  4LGQ A;  2XFS A;  3SLU A;  5BVB A;  3U1W A;  1V74 A;  3CCJ 3;  4AEQ A;  3H3H A;  1DMQ A;  1CYV A;  1WTH A;  4HVN A;  3Q2P A;  2R4I A;  3MHE A;  1M9G A;  2M7O A;  7STD A;  3CC7 3;  1CYU A;  1L5G B;  1IV9 A;  1JB4 A;  2CK3 H;  1GD3 A;  2QA4 3;  2GEY A;  3EBY A;  3JVC A;  2V1L A;  1WMP A;  3PGB A;  1NU3 A;  2IA7 A;  2O9U X;  1W01 A;  3NM7 A;  4BTW A;  3L0R A;  2CG1 A;  2LYX A;  3VSY A;  4MMX B;  4QWT A;  4L8P A;  1OUN A;  3LTC A;  1FGQ A;  3WOD G;  2XSH B;  3D9R A;  2HMO B;  1LNH A;  3N8B A;  3V98 A;  4STD A;  2YX9 A;  3MPH A;  1YGE A;  2P0M A;  1QMA A;  1CEW I;  1NB3 I;  2Z6B A;  5G2G A;  3CD6 3;  2OOV A;  1A67 A;  8CHO A;  3MYT A;  3T8U A;  2Q07 A;  4K90 B;  2MC8 A;  4EBG A;  1M90 4;  5STD A;  1YIT 3;  2W2C A;  5AIH A;  4XBT A;  3A76 A;  1TU5 A;  4FCM A;  1VQL 3;  2QGU A;  3CME 3;  2FXT A;  4HM5 B;  4EYC A;  2W0Q A;  4JRF A;  3EHC A;  3SVA A;  1RKY A;  1M1K 4;  3AMO B;  1AVL A;  3PS8 A;  1YJW 3;  3X42 A;  3K0Z A;  3DM8 A;  4MMY B;  1RN7 A;  1GYB A;  2I9W A;  2SBL A;  4NRE A;  3WOE B;  1N5P A;  2L4V A;  4HM0 B;  4EC6 A;  1NWW A;  1E97 A;  1K28 A;  5TGN A;  5DRE A;  2OTJ 3;  4LSO A;  2LQV A;  2RGQ A;  1A90 A;  3G8Z A;  2CFL A;  1O7G B;  3CCL 3;  3HII A;  1ROV A;  2IUK A;  4HBR A;  2HMJ B;  2XGL A;  3JUM A;  1IV7 A;  1TP6 A;  1VQK 3;  3JUQ A;  3F7S A;  1RJO A;  4KVH A;  1OCV A;  2CHC A;  4KFF A;  4ORL A;  3NX0 A;  2Z7A A;  2JDI H;  3CCR 3;  4N6L A;  3FG4 A;  5D81 A;  2HML B;  4R4K A;  3KII A;  3LOY A;  2A15 A;  2Y73 A;  3EB8 A;  3LTA A;  2CFD A;  2CIU A;  5DRV A;  2YFL B;  1UI8 A;  4I4K A;  1ZX2 A;  1TFO A;  2PNC A;  2CW9 A;  4FMC A;  4H61 A;  5AEW B;  1UUV B;  1YI2 3;  3Q90 A;  4WHA A;  1IT7 A;  5ELU A;  1ULJ B;  2WO0 A;  2W56 B;  3DUK A;  3M8C A;  3CC4 3;  4HZ9 B;  2CFG A;  3CCQ 3;  4KFD A;  1AR0 A;  3TDG A;  1EKM A;  5JPP A;  2E2T A;  3G6E 3;  5EVH A;  3MKI A;  2JQ5 A;  2ML5 A;  2XH9 A;  1M1X B;  3KFQ C;  4N6N B;  4O3V A;  4RBN A;  1JRQ A;  3I56 3;  1VQ9 3;  2KXG A;  3DY5 A;  2K0M A;  3GWR A;  3MG3 A;  3O8Y A;  3RGR A;  2HMM B;  3AMO A;  1IU7 A;  5IF6 A;  1IVX A;  5IEO A;  2E2V A;  1A2K A;  1KC8 4;  2RFR A;  4XB5 A;  2CH9 A;  3OXA A;  1W2B 2;  4O2H A;  3V92 A;  1YJ9 3;  3EF8 A;  4JF8 A;  4N6M A;  1YVB I;  2HMN B;  2OCT A;  3T0U A;  3EX9 A;  1NDO B;  1PFP A;  3G16 A;  1OGX A;  1NB5 I;  2UX0 A;  4N6O B;  3NM2 A;  1D6Y A;  2CWV A;  1GY6 A;  3OV4 A;  3FZW A;  2C11 A;  2P09 A;  1OH0 A;  1OGZ A;  4GL6 A;  1OHO A;  3EQQ B;  3SOY A;  1Q86 4;  2WGQ A;  3S29 A;  3F9S A;  1MNL A;  3CNM A;  2BMQ B;  5HGR A;  3UB1 A;  1Z1S A;  4R1K A;  3CC2 3;  3GRD A;  2XF3 A;  5D82 A;  1VQ4 3;  5JPU A;  2MF7 A;  3OW2 2;  2GU3 A;  1IT8 A;  3I55 3;  3MWZ A;  4PEJ A;  4WYK B;  1O7N B;  3D3L A;  1EA2 A;  4H3U A;  4CCV A;  1VQ6 3;  4AKZ A;  3DGL A;  3RGA A;  4K61 A;  3T8N A;  4FR9 A;  3G71 3;  1LXE A;  5AIF A;  2IUJ A;  2HMK B;  5IG3 A;  1FGT A;  3FG1 A;  2W56 A;  3OWU A;  4R80 A;  1TFK A;  1ZO2 A;  3I0Y A;  4LEH A;  1QAL A;  3ER7 A;  1EQK A;  3CPO A;  1SJW A;  3CPW 2;  1VQ7 3;  1RRH A;  1O7P B;  1NO3 A;  3E99 A;  4OUQ A;  3X40 A;  3VGN A;  3DGO A;  2XR8 B;  1JN5 B;  1WQL B;  2O3O A;  3ROB A;  6STD A;  3JUO A;  3IMA B;  4MMZ B;  2C10 A;  1VQ5 3;  3UNL A;  4R9L A;  3IPT A;  4O8S A;  2OTL 3;  3ECF A;  3H51 A;  4U13 A;  4FMA A;  1JV2 B;  1ASK A;  4BTY A;  1JKG A;  2ML6 A;  1JB2 A;  4EV2 A;  5CF2 A;  3PYJ A;  3QRD A;  3Q1C A;  1STF I;  1JNQ A;  1ISK A;  3CNX A;  3X3X A;  1EG9 B;  5IER A;  4J9A A;  5IG0 A;  3FF0 A;  4RNY A;  5JBS A;  3ALA A;  4X2H A;  1ROA A;  3KE7 A;  2BMR B;  3NBB A;  3FCS B;  4HM3 B;  2RSX A;  1KQS 2;  4EXR A;  2W04 A;  4OVM A;  4MEI A;  4HYZ A;  2WOF A;  3JUP A;  1GD4 A;  1BUQ A;  3WA3 A;  2RCD A;  1W5Z A;  5IG5 A;  1VZZ A;  1SII A;  1UUW B;  1Q82 4;  1QAK A;  3V99 A;  1AV4 A;  3VF1 A;  1NJI 4;  1FGR A;  1QVF 2;  2ZDJ A;  4KZ1 A;  1CQS A;  3LH4 A;  4N3V A;  2XGN A;  3HIG A;  3CCE 3;  3BNB A;  4FCJ A;  3F40 A;  3FGY A;  1IVU A;  4K1U A;  4CDL A;  5IG4 A;  1R4C A;  4NHF A;  3S67 A;  1W6C A;  2GEX A;  1JJ2 2;  1LOX A;  1WNH A;  1DMN A;  2E2U A;  3CCU 3;  4R9K A;  1FUW A;  5KP3 A;  2GXF A;  4J8T A;  1IVW A;  1HKX A;  4BTX A;  4G1M B;  2Z76 A;  1YJN 3;  3BNC A;  3NBJ A;  1O7H B;  3CXC 2;  1IVV A;  3BND A;  1N8Q A;  3IJE B;  5AYR B;  3G0K A;  1FGO A;  2ZL8 A;  1OF5 B;  4XBY A;  1GY7 A;  3N9H A;  3OWY A;  3F14 A;  3LT8 A;  5KP1 A;  3UL6 A;  1UI7 A;  3LTB A;  4WFO A;  3UL5 A;  4RZM A;  2XRX B;  4XDV A;  4HZB B;  1WMO A;  1IQY A;  4LMI A;  3KN4 A;  3LML A;  5AIG A;  5EEO A;  1W2Z A;  1S5A A;  1VQM 3;  1W02 A;  4FMB A;  5D83 A;  5AYS C;  4AKY A;  1HU9 A;  3WDG B;  3RDE A;  3FH1 A;  3G4S 3;  4EV5 A;  3FSD A;  4XBX A;  3EN8 A;  3GZB A;  4KFE A;  1O7M B;  1VQN 3;  2STD A;  5A0O B;  4IIA A;  3DZL A;  3PCR A;  1Y4K A;  3CCS 3;  5ELJ A;  4MJD A;  2CFK A;  3K63 A;  2W03 A;  3EC9 A;  1VQO 3;  3N54 B;  1W7C A;  3JUN A;  1D6U A;  1J2B A;  1E3R A;  3KZT A;  1PU4 A;  2XEP A;  2KRT A;  2F86 B;  2OWP A;  5CLK A;  2W9P A;  3WOF B;  2D1W A;  2GBW B;  4OK0 A;  3MG1 A;  1IQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...