4EXRA

Crystal structure of a putative lipoprotein (cd1622) from clostridium difficile 630 at 1.85 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
152
structure length
152
Chain Sequence
b'NENLMEQDFKVPYTDAINIFKDKYKDADIVDLSLERDLNKFVYTVEGVDDNNEYKMKIDANTKDVLEDKTEKLDSEDLNGVARKEKLDLNDIMTPQQAMEIALKEQNGIVKEWSLDKDLDVTFYKIRIDKDKNEYDIKVDSKKGTVLKVEKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative lipoprotein (CD1622) from Clostridium difficile 630 at 1.85 A resolution
rcsb
molecule keywords Putative lipoprotein
source organism Clostridium difficile
molecule tags Unknown function
total genus 35
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2012-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03413 PepSY Peptidase propeptide and YPEB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4exrA01
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4exrA02
1IQYA 2CFKA 3SXXA 2OQEA 1W6CA 1IU7A 2E2TA 2CFLA 2E2UA 1WMNA 2CG1A 1TU5A 2Y74A 3AMOA 3HI7A 2GU3A 3X41A 2YX9A 3PGBA 4KFFA 3WA2X 1D6ZA 1IVUA 2IA7A 2WOHA 1W7CA 1IVWA 5IW9A 1IVXA 3KIIA 4EV5A 1UI7A 1W2ZA 3X42A 2OOVC 1RKYA 1LVNA 1W4NA 1AVKA 1OACA 2E2VA 1D6UA 2CFDA 1AVLA 1A2VA 3X3ZA 4KFDA 3X3XA 2WO0A 1IQXA 3NQYA 4KFEA 1DYUA 3MPHA 2Y73A 1KSIA 1IVVA 1SIIA 2PNCA 1W5ZA 2CFGA 2C10A 2WGQA 2CWUA 1SPUA 2CWTA 4BTYA 1EKMA 3KN4A 3LOYA 1AV4A 2K0MA 3X40A 4EXRA 1US1A 1SIHA 3HIIA 4EV2A 3WA3A 2BT3A 2OQEC 1N9EA 4BTXA 2CFWA 3ALAA 1W6GA 3N9HA 1PU4A 4BTWA 2WOFA 3HIGA 2OOVA 1QAKA 3SX1A 2ZL8A 1QALA 1UI8A 3AMOB 2CWVA 1RJOA 3NBBA 1WMPA 2CG0A 1D6YA 3K5TA 1JRQA 1QAFA 3X3YA 2W0QA 1WMOA 3NBJA 2D1WA 3NQZA 3T0UA 2C11A
chains in the Genus database with same CATH superfamily
1IQYA 5IEPA 2CFKA 1K28A 1ROAA 1GMQA 1R4CA 2F86B 1FUSA 1RN1A 1RGAA 1A2KA 1W6CA 4XDVA 2QGUA 3LT9A 4KT3B 3G713 2E2UA 1RTUA 3CXC2 2W2CA 1MWSA 1EG9B 3WR2A 4MMYB 1EUIC 2F5WA 1WQLB 2GEYA 2IUJA 1OHSA 3HI7A 4HBRA 3WHOA 3I553 1CEWI 2P0MA 1I70A 9RNTA 1O7MB 2YX9A 3PGBA 4HM4B 2ZHXB 1T2IA 5JPUA 1NB5I 2HMJB 3DGMA 4HM1B 2WOHA 1OF5B 1UUWB 1W7CA 1GYBA 2W56B 5A0OB 4ZM8A 1I3FA 1FGQA 1JB5A 3FKAA 3KCHA 2BMOB 5FGOA 1M1K4 1VQ93 2R4IA 4TX4A 4FMAA 3BNCA 3S28A 3EB8A 2QEX3 5M18A 3F40A 3B7CA 4KVHA 1T3BA 1RKYA 4O2HA 1JBTA 2HMNB 1UUVB 1W4NA 1OCVA 2CFDA 3SOAA 3CCE3 4BL2A 4IT7A 2WO0A 1GD3A 4LMIA 1UCJA 5JBSA 1E3RA 4AKYA 1B2UA 1E97A 1QMAA 2BMQB 2W03A 3PCRA 5KP3A 3DXOA 1BNJA 1FGMA 1O7NB 4MEIA 5AEUB 4K1UA 1BNFA 1NB3I 1SIIA 4N6V0 4CPKA 3JUQA 2BIRA 1VQ63 4U13A 4NPBA 3DUKA 1W2B2 1PFPA 3T8NA 1NJI4 1TRQA 2YFIB 4G1MB 2KAAA 4O3VA 3OWSA 4J5KA 1JKGB 4XDWA 1IT7A 1M904 3U97A 2QIYA 1RGCA 1RGGA 1UDII 3JUOA 5M19A 1BRIA 1MWRA 1ZO2A 5IEOA 2XSHB 4HM7B 3ZG5A 3B4OA 1BIRA 1SIHA 1GSPA 3HIIA 1RMSA 1DMMA 1TIJA 1G0TA 2BT3A 4PEJA 4BTXA 3Q3FA 1CYVA 2IYJA 1JB2A 1QVF2 1QJGA 4FMCA 1A90A 2HMOB 3FF2A 3L0RA 1PU4A 5IG3A 2MF7A 5BU4A 1G96A 1K734 2OOVA 2CIUA 1BRKA 1UI8A 3DZLA 2H0HA 1HZ1A 3N54B 1ZX2A 3AMOB 2P38A 1JJ22 1X1YA 1LOXA 2CWVA 2XFSA 2AAEA 3NXJA 3S29A 4LZIA 1LXEA 3D5GA 3F14A 4BIRA 3DGNA 1STFI 1FGRA 3BIRA 2INXA 1GOYA 3D5IA 3NHXA 1D6YA 1WNHA 2Z76A 3WOFB 3D9RA 4BL3A 1JN5A 2F5MA 4Q53A 1VQQA 1JRQA 3RGRA 1NWWA 1TRPA 1N9JA 2FGTA 3IPTA 4FMDA 4J8TA 3D3LA 1VQK3 4RNZA 3OWUA 2KRTA 3LZAA 1WMOA 3JUNA 2FXTA 4R9LA 1Z1SA 2XR8B 2KF5A 3VF1A 4HYZA 3CC73 2HMLB 5CF1A 3LT8A 3PCSA 1RNBA 2CKFB 3MKIA 1K9M4 3RGAA 3DGYA 5BXQA 2OTJ3 3FG1A 3MG2A 2QA43 1ASKA 2B1XB 3TDGA 3H3HA 3FCSB 1U5OA 2XEPA 4L8OA 2E2TA 2ML5A 3CD63 1CYUA 1NU3A 3NUVA 5DRVA 3S5CA 1Q864 3F8XA 1FYSA 5AIIA 1EQKA 4WYKB 4N6LA 2CX0A 2I9WA 1TU5A 4L8PA 1BGSA 2GXFA 3EHCA 3EQQB 3ECFA 4KZ1A 1Q7HA 1I8VA 2GU3A 3G6E3 3X41A 1I3IA 3EBTA 3WA2X 1D6ZA 3NV0A 2KF3A 4WYKA 2L1SA 2GSPA 1DMQA 1IVUA 1KWIA 1RRHA 2IA7A 3M8CA 3PYJA 5AIGA 5AIFA 1W02A 5G1LA 3NM2A 3V98A 3AGNA 1LNIA 1IVWA 2BO9B 3SOYA 4IIAA 1SJWA 1MGWA 1GOUA 5IW9A 1IVXA 2YFLB 1YNVX 2RBIA 1V58A 3KIIA 1JBRA 4NREA 3D79A 4HZBB 1FGTA 4R9KA 2CK3H 8CHOA 3BU4A 3DY5A 1W2ZA 3ZFZA 1CH0A 1I0VA 1RGHA 3FLJA 3V92A 3CC23 1RGKA 2OOVC 1I2GA 2P09A 3BB9A 3EF8A 3OW22 3CCR3 1Q40B 1LVNA 3KSPA 1BNIA 1BVIA 2ML6A 2E2VA 1LNHA 1B2XA 1D6UA 1I2FA 5JPPA 1SQWA 3X3ZA 4KFDA 4XBTA 3X3XA 5GSPA 1R4YA 1MWTA 1N8R4 1Q40A 1LRAA 3CCQ3 1VQM3 1IQ8A 3WOEB 3BNBA 4JF8A 1SARA 3F8HA 3T8UA 4DKIA 1ULIB 2WGQA 2CX1A 1YI23 2CWUA 4J9AA 1OF5A 2CWTA 1IYYA 1O7WB 4EYCA 1ULJB 2W56A 3MYTA 1EKMA 3I0YA 3RNTA 3KN4A 4N6TA 2K0MA 1MOLA 3EX9A 1TFKA 3WMDA 1Q42A 4WWUC 3K7CA 2GU1A 1N9EA 4RBNA 3ALAA 1L5GB 2FNQA 2M7OA 3GZBA 3N9HA 1LOVA 4J5GA 2F99A 4BTWA 1RGFA 3Q90A 2WOFA 1O7GB 2PZVA 2Z7AA 2JDIH 3U1WA 3B4PA 7GSPA 3SX1A 1C54A 2ZL8A 1TJDA 1QALA 3MHEA 2IY2A 4CDLA 2IUKA 3E99A 3KE7A 4OK0A 1VQ73 3AGOA 3UB1A 1NO3A 3H51A 5AYSC 5I97A 3FF0A 2KF4A 4RNYA 3K5TA 1BSCA 1JB4A 3CPOA 1JKGA 2BHMA 1Y4KA 4O8SA 5AI1A 3CME3 5G1KA 1KC84 5LC6A 5HOHA 5CF2A 5EEOA 1BRSA 3DGLA 3NBJA 3DM8A 3LTCA 2D1WA 3EN8A 3IMAB 5EVHA 5TGNA 1TTOA 2GEXA 3NQZA 3WDGB 1QVG2 1GY7A 4HM3B 1V57A 1BRJA 1B2SA 1FGOA 3NX0A 1YJW3 3A76A 4FCZA 3SXXA 3RDEA 3S67A 3UL6A 2IMJA 3B8LA 1VQN3 1IU7A 1F8NA 1NDOB 2W04A 1B20A 1WMNA 2L4VA 3FG4A 4LGQA 2CG1A 1YVSA 3AMOA 1RCKA 3UJMA 1YJ93 1O7PB 3EJVA 4OVMA 2P05A 5BVBA 1BU4A 3F7XA 2KXGA 4XB5A 1S5AA 2XGLA 4KFFA 1BSAA 3HX8A 4WP5A 5IENA 2HMMB 1W00A 3EBYA 5AEWB 4HM8B 2BMRB 1BSDA 1BSBA 1DETA 1TFOA 2H0IA 2RNTA 1LQMB 3LTDA 2RCDA 1WTHA 3NBRA 1MWUA 3OXAA 1OPYA 5IERA 1UW1A 1C7HA 3SEDA 1U8CB 1RGLA 3EE1A 5CLKA 1JNQA 1BOXA 1GY5A 3D4AA 3X42A 1JZDA 1S723 4N6OB 3MG3A 2OWPA 3LXUX 1BNEA 2XFTA 4K1VA 2HOHA 4WHAA 1N5PA 1AVKA 1OACA 2KCDA 4CCVA 1J2BA 1A2VA 3LYGA 1Q824 3SVAA 1BRGA 4HM5B 1JBSA 1IQXA 4KFEA 1DYUA 1JZOA 2HMKB 1MNLA 1ISKA 1DMNA 3UL5A 3OV4A 1YIT3 4HM6B 2B24B 1W6YA 2Y73A 1OGZA 1VQP3 3HZPA 3JUMA 1B3SA 1W5ZA 2F4YA 2C10A 2CFGA 2RGQA 3CMA3 1X1WA 1GY6A 3FH1A 2W9PA 2F98A 3GWRA 4ORLA 3PZWA 4O02B 5CXOA 4BTYA 3VGNA 1ROVA 2OCTA 2W6JH 3LMLA 1DVDA 1A2PA 1RCLA 3BNEA 3CU3A 1GOVA 3LOYA 5IG0A 1AV4A 1CQSA 3CCU3 3N8BA 3MWZA 4HM0B 4FCMA 1W01A 1AY7A 2SBLA 3K63A 1I0XA 3NM7A 4R4KA 1US1A 2GBXB 4QWTA 5RNTA 1K8A4 1LOWA 3G0KA 3SYUA 4H61A 3CCS3 3SLUA 4AEQA 1AR0A 3WA3A 3G16A 4LYLB 4X2OA 1W6GA 1IV7A 1N8QA 1B21A 4R1KA 3BLZA 3ROBA 3HIGA 2W9QA 2Q07A 2CHCA 5IF6A 4EW5A 1T5YA 3WODG 3CPW2 5KP1A 3K0ZA 1RDSA 1BNGA 1EA2A 1ZS7A 1RJOA 1RN4A 2STDA 2UGIA 3IJEB 3MSOA 3NBBA 4HJLB 4FCJA 1WMPA 4GHOA 2CG0A 1HKXA 2AADA 2R41A 1E3VA 3FGYA 3J7Yd 1B2MA 1VQL3 1BRHA 1BUQA 1FUTA 1YHQ3 1B2ZA 4ILFA 1OH0A 6STDA 5G2GA 3KSED 4LEHA 4HKVB 3QK9A 4N6MA 3ZG0A 1BRNL 1BAOA 4GB5A 1T2HA 2BNGA 1BNSA 1BANA 1VZZA 3T0UA 3GSPA 2Z77A 4I4KA 2C11A 3CCL3 4N3VA 3PXMA 1N5HA 2GBWB 1GS3A 1Q7Y4 4LSOA 1B27A 2BU4A 4AKZA 1VQ53 1VQ43 4EC6A 1M1XB 2OQEA 4H3UA 1TUHA 2CFLA 1RNTA 2P0XA 3BNDA 3F9SA 1DVCA 1OHOA 3Q1CA 3EN1B 4BU4A 4EBGA 1I2EA 3GRDA 3HOHA 1RHLA 2XSOB 2YFJB 2Y74A 5STDA 2SARA 1YVBI 5EQLA 1Q814 1JV2B 1UCIA 4STDA 2ZA4A 1STDA 1IV9A 1HU9A 1UUGB 6GSPA 4L7KA 1O7HB 2LYXA 1K41A 2K54A 3V99A 1BNRA 2CH9A 4NHFA 3KKGA 4HAAA 2MC8A 3G8ZA 5DREA 3S27A 3A5EA 5BIRA 1ZGXA 3CCJ3 3K9MC 4K61A 2CC3A 1IDPA 5M1AA 3JVCA 4IPBA 3G4S3 1RLSA 1UGIA 4MMZB 4EV5A 1GMPA 1RRLA 2KF6A 2J8XB 3MG1A 3CC43 5IG5A 3OX9A 1MGRA 3AHWA 5ELUA 1UI7A 1FA3A 3DMCA 5D82A 3DGOA 2ZDJA 1PYLA 3DH2A 4N6NB 8RNTA 5KP4A 1TP6A 4HOHA 2XGNA 1Q9EA 4MMXB 3LTAA 3GAXA 3URPA 3UNLA 3F7SA 1GMRA 1RGEA 1AVLA 7RNTA 2XF3A 3FG3A 1HYFA 1YGWA 3VSYA 1YIJ3 4GSPA 6RNTA 1LQGC 3NQYA 3KZTA 2XRXB 2F56A 1PY3A 3MPHA 5AIHA 2LQVA 1KSIA 1IVVA 4HM2B 1FW7A 2PNCA 1X1XA 2UUGC 1FZUA 4R80A 1YGEA 4OUQA 1VQO3 3AHSA 4GL6A 1SPUA 3FSDA 4RNTA 1JN5B 5HGRA 1KD14 1RN7A 3JUPA 3LH4A 1GD4A 4K90B 1IK3A 3X40A 2Z6BA 3QRDA 4EXRA 2WGOA 2K3DA 3CNMA 4WFOA 4EV2A 4JRFA 2JQ5A 2OQEC 2CFWA 1V74A 3STDA 2OTL3 1YJN3 2H0GA 1KQS2 4XM4A 5CK6A 4XBYA 5D81A 2RSXA 3ER7A 3GZRA 3HK4A 5FW5A 4CJNA 3OWYA 4N6UA 1A67A 5IG4A 1BUJA 1QAKA 4FR9A 5LC7A 1FUWA 2D42A 4HZ9B 2O3OA 2V1LA 2C4BA 4FMBA 1RSNA 1BSEA 1OGXA 2A15A 4RZMA 4X2HA 1VQ83 1NNVA 1X1UA 3FZWA 4XBXA 5ELJA 3CCV3 3KFQC 1DE3A 2CW9A 1OHPA 5AYRB 3NV0B 2RFRA 1UCLA 3GZYB 5D83A 1LOYA 3Q2PA 2O9UX 1M9GA 2XH9A 4I5QA 1OUNA 3GZXB 3CCM3 3PS8A 1UGHI 1AQZA 1G02A 2UX0A 1QAFA 3LTBA 1EEJA 4MJDA 3X3YA 2W0QA 4HVNA 1UCKA 3EC9A 3I563 3O8YA 1IT8A 7STDA 3CNXA
chains in the Genus database with same CATH topology
1IQYA 5IEPA 2CFKA 1K28A 1ROAA 1R4CA 2F86B 1W6CA 4XDVA 1A2KA 2QGUA 3LT9A 3G713 2E2UA 3CXC2 2W2CA 1EG9B 4MMYB 2GEYA 1WQLB 2IUJA 1OHSA 3HI7A 4HBRA 3I553 1CEWI 2P0MA 1O7MB 2YX9A 3PGBA 4HM4B 5JPUA 1NB5I 2HMJB 3DGMA 4HM1B 2WOHA 1OF5B 1UUWB 1W7CA 1GYBA 2W56B 5A0OB 4ZM8A 1FGQA 1JB5A 3FKAA 2BMOB 5FGOA 1M1K4 1VQ93 2R4IA 4TX4A 4FMAA 3BNCA 3S28A 3EB8A 2QEX3 3F40A 3B7CA 4KVHA 1RKYA 4O2HA 2HMNB 1UUVB 1W4NA 1OCVA 2CFDA 3SOAA 3CCE3 4IT7A 2WO0A 1GD3A 4LMIA 5JBSA 1E3RA 4AKYA 1E97A 1QMAA 3PCRA 2BMQB 2W03A 5KP3A 3DXOA 1FGMA 1O7NB 4MEIA 5AEUB 4K1UA 1SIIA 1NB3I 4N6V0 3JUQA 1VQ63 4U13A 3DUKA 1W2B2 1PFPA 3T8NA 1NJI4 2YFIB 4G1MB 4O3VA 3OWSA 1JKGB 4XDWA 1IT7A 3U97A 2QIYA 3JUOA 1ZO2A 5IEOA 2XSHB 4HM7B 3B4OA 1SIHA 3HIIA 1DMMA 1TIJA 4PEJA 2BT3A 4BTXA 1CYVA 1JB2A 1QVF2 1QJGA 4FMCA 1A90A 2HMOB 3FF2A 3L0RA 1PU4A 5IG3A 2MF7A 1G96A 1K734 2OOVA 2CIUA 1UI8A 3DZLA 3N54B 1ZX2A 3AMOB 2P38A 1JJ22 1LOXA 2CWVA 2XFSA 3NXJA 3S29A 4LZIA 1LXEA 3F14A 3DGNA 1STFI 1FGRA 3NHXA 2INXA 1D6YA 1WNHA 2Z76A 3WOFB 3D9RA 1JN5A 4Q53A 1JRQA 3RGRA 1NWWA 1N9JA 2FGTA 3IPTA 4FMDA 4J8TA 3D3LA 1VQK3 4RNZA 3OWUA 2KRTA 3LZAA 1WMOA 3JUNA 2FXTA 4R9LA 1Z1SA 2XR8B 3VF1A 4HYZA 3CC73 2HMLB 5CF1A 3LT8A 3PCSA 2CKFB 3MKIA 1K9M4 3RGAA 5BXQA 2OTJ3 3FG1A 3MG2A 2QA43 1ASKA 2B1XB 3TDGA 3H3HA 3FCSB 1U5OA 2XEPA 4L8OA 2E2TA 2ML5A 3CD63 1CYUA 1NU3A 3NUVA 5DRVA 3S5CA 1Q864 3F8XA 5AIIA 1EQKA 4WYKB 4N6LA 1TU5A 2I9WA 4L8PA 2GXFA 3EHCA 3EQQB 3ECFA 4KZ1A 2GU3A 3G6E3 3X41A 3EBTA 3WA2X 1D6ZA 3NV0A 4WYKA 1DMQA 1IVUA 1KWIA 1RRHA 2IA7A 3M8CA 3PYJA 5AIGA 5AIFA 1W02A 3V98A 3NM2A 1IVWA 2BO9B 3SOYA 4IIAA 1SJWA 5IW9A 1IVXA 2YFLB 3KIIA 4NREA 4HZBB 4R9KA 1FGTA 2CK3H 8CHOA 3DY5A 1W2ZA 3CC23 3FLJA 3V92A 2OOVC 3EF8A 2P09A 3BB9A 3OW22 3CCR3 1Q40B 1LVNA 3KSPA 2ML6A 2E2VA 1LNHA 1D6UA 5JPPA 1SQWA 3X3ZA 4KFDA 4XBTA 3X3XA 1N8R4 1Q40A 3CCQ3 1VQM3 1IQ8A 3WOEB 3BNBA 4JF8A 3F8HA 3T8UA 1ULIB 2WGQA 1YI23 2CWUA 4J9AA 1OF5A 2CWTA 1O7WB 4EYCA 1ULJB 2W56A 3MYTA 1EKMA 3I0YA 3KN4A 4N6TA 2K0MA 1MOLA 3EX9A 1TFKA 3WMDA 1Q42A 4WWUC 3K7CA 2GU1A 1N9EA 4RBNA 3ALAA 1L5GB 2FNQA 2M7OA 3GZBA 3N9HA 2F99A 4BTWA 3Q90A 2WOFA 1O7GB 2PZVA 2Z7AA 2JDIH 3U1WA 3B4PA 3SX1A 2ZL8A 1QALA 3MHEA 4CDLA 2IUKA 3E99A 3KE7A 4OK0A 1VQ73 3UB1A 1NO3A 3H51A 5AYSC 5I97A 3FF0A 4RNYA 3K5TA 1JB4A 3CPOA 1JKGA 2BHMA 1Y4KA 4O8SA 5AI1A 3CME3 1KC84 5LC6A 5CF2A 5EEOA 3DGLA 3NBJA 3DM8A 3LTCA 2D1WA 3EN8A 3IMAB 5EVHA 5TGNA 2GEXA 3WDGB 3NQZA 1QVG2 1GY7A 4HM3B 1FGOA 3NX0A 1YJW3 3A76A 4FCZA 3SXXA 3RDEA 3S67A 3UL6A 2IMJA 3B8LA 1VQN3 1IU7A 1F8NA 1NDOB 2W04A 1WMNA 2L4VA 3FG4A 4LGQA 2CG1A 3AMOA 3UJMA 1YJ93 1O7PB 3EJVA 4OVMA 2P05A 5BVBA 4XB5A 3F7XA 2KXGA 1S5AA 2XGLA 4KFFA 3HX8A 4WP5A 5IENA 2HMMB 1W00A 3EBYA 5AEWB 4HM8B 2BMRB 1TFOA 3LTDA 2RCDA 1WTHA 3NBRA 3OXAA 1OPYA 5IERA 1UW1A 1C7HA 3SEDA 1U8CB 3EE1A 5CLKA 1JNQA 1GY5A 3X42A 1S723 4N6OB 3MG3A 2OWPA 3LXUX 2XFTA 4K1VA 4WHAA 1N5PA 1AVKA 1OACA 2KCDA 4CCVA 1J2BA 1A2VA 3LYGA 1Q824 3SVAA 4HM5B 1IQXA 4KFEA 1DYUA 2HMKB 1MNLA 1ISKA 1DMNA 3UL5A 3OV4A 1YIT3 4HM6B 2B24B 1W6YA 2Y73A 1OGZA 1VQP3 3HZPA 3JUMA 3CMA3 1W5ZA 2C10A 2CFGA 2RGQA 3FH1A 1GY6A 2W9PA 2F98A 3GWRA 4ORLA 3PZWA 4O02B 5CXOA 4BTYA 3VGNA 1ROVA 2OCTA 2W6JH 3LMLA 1DVDA 3BNEA 3CU3A 5IG0A 3LOYA 1AV4A 1CQSA 3CCU3 3N8BA 3MWZA 4HM0B 4FCMA 1W01A 2SBLA 3K63A 3NM7A 4R4KA 1US1A 2GBXB 4QWTA 1K8A4 3G0KA 4H61A 3CCS3 3SLUA 4AEQA 1AR0A 3WA3A 3G16A 4X2OA 1W6GA 1IV7A 1N8QA 4R1KA 3ROBA 3BLZA 3HIGA 2W9QA 2Q07A 2CHCA 5IF6A 1T5YA 3WODG 3CPW2 5KP1A 3K0ZA 1EA2A 2STDA 1RJOA 3IJEB 3MSOA 4HJLB 3NBBA 4K61A 4FCJA 1WMPA 2CG0A 1HKXA 3FGYA 1E3VA 3J7Yd 1VQL3 1BUQA 1YHQ3 1OH0A 6STDA 5G2GA 3KSED 4LEHA 4HKVB 3QK9A 4N6MA 4GB5A 2BNGA 1VZZA 3T0UA 2Z77A 4I4KA 2C11A 3CCL3 4N3VA 3PXMA 1N5HA 2GBWB 1GS3A 1Q7Y4 4LSOA 4AKZA 1VQ53 1VQ43 4EC6A 1M1XB 2OQEA 4H3UA 1TUHA 2CFLA 2P0XA 3BNDA 3F9SA 1DVCA 1OHOA 3Q1CA 3EN1B 4EBGA 1M904 3GRDA 2XSOB 2YFJB 2Y74A 5STDA 5EQLA 1YVBI 1Q814 1JV2B 4STDA 1STDA 1IV9A 1HU9A 4L7KA 1O7HB 2LYXA 1K41A 2K54A 3V99A 2CH9A 4NHFA 3KKGA 2MC8A 3G8ZA 5DREA 3S27A 3CCJ3 3K9MC 2CC3A 1IDPA 3JVCA 4IPBA 3G4S3 4MMZB 4EV5A 3CC43 1RRLA 3MG1A 5IG5A 3OX9A 5ELUA 1UI7A 1FA3A 3DMCA 5D82A 3DGOA 2ZDJA 4N6NB 5KP4A 1TP6A 2XGNA 4MMXB 3LTAA 3GAXA 3UNLA 3F7SA 1AVLA 2XF3A 3FG3A 1YIJ3 3VSYA 3NQYA 3KZTA 2XRXB 3MPHA 5AIHA 2LQVA 1KSIA 1IVVA 4HM2B 2PNCA 4R80A 1YGEA 4OUQA 1VQO3 4GL6A 1SPUA 3FSDA 5HGRA 1JN5B 1KD14 1RN7A 3JUPA 3LH4A 1GD4A 4K90B 1IK3A 3X40A 2Z6BA 3QRDA 4EXRA 2WGOA 3CNMA 4WFOA 4EV2A 4JRFA 2JQ5A 2OQEC 2CFWA 1V74A 3STDA 2OTL3 1YJN3 1KQS2 4XM4A 5CK6A 4XBYA 5D81A 2RSXA 3ER7A 3GZRA 3HK4A 5FW5A 3OWYA 4N6UA 1A67A 5IG4A 1QAKA 4FR9A 5LC7A 1FUWA 2D42A 4HZ9B 2O3OA 2V1LA 4FMBA 1OGXA 2A15A 4RZMA 4X2HA 1VQ83 3FZWA 4XBXA 5ELJA 3CCV3 3KFQC 2CW9A 1OHPA 5AYRB 3NV0B 2RFRA 3GZYB 5D83A 3Q2PA 2O9UX 1M9GA 2XH9A 1OUNA 3GZXB 3CCM3 3PS8A 2UX0A 1QAFA 3LTBA 4MJDA 3X3YA 2W0QA 4HVNA 3EC9A 3I563 3O8YA 1IT8A 7STDA 3CNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IQY A;  2CFK A;  3SXX A;  2OQE A;  1W6C A;  1IU7 A;  2E2T A;  2CFL A;  2E2U A;  1WMN A;  2CG1 A;  1TU5 A;  2Y74 A;  3AMO A;  3HI7 A;  2GU3 A;  3X41 A;  2YX9 A;  3PGB A;  4KFF A;  3WA2 X;  1D6Z A;  1IVU A;  2IA7 A;  2WOH A;  1W7C A;  1IVW A;  5IW9 A;  1IVX A;  3KII A;  4EV5 A;  1UI7 A;  1W2Z A;  3X42 A;  2OOV C;  1RKY A;  1LVN A;  1W4N A;  1AVK A;  1OAC A;  2E2V A;  1D6U A;  2CFD A;  1AVL A;  1A2V A;  3X3Z A;  4KFD A;  3X3X A;  2WO0 A;  1IQX A;  3NQY A;  4KFE A;  1DYU A;  3MPH A;  2Y73 A;  1KSI A;  1IVV A;  1SII A;  2PNC A;  1W5Z A;  2CFG A;  2C10 A;  2WGQ A;  2CWU A;  1SPU A;  2CWT A;  4BTY A;  1EKM A;  3KN4 A;  3LOY A;  1AV4 A;  2K0M A;  3X40 A;  4EXR A;  1US1 A;  1SIH A;  3HII A;  4EV2 A;  3WA3 A;  2BT3 A;  2OQE C;  1N9E A;  4BTX A;  2CFW A;  3ALA A;  1W6G A;  3N9H A;  1PU4 A;  4BTW A;  2WOF A;  3HIG A;  2OOV A;  1QAK A;  3SX1 A;  2ZL8 A;  1QAL A;  1UI8 A;  3AMO B;  2CWV A;  1RJO A;  3NBB A;  1WMP A;  2CG0 A;  1D6Y A;  3K5T A;  1JRQ A;  1QAF A;  3X3Y A;  2W0Q A;  1WMO A;  3NBJ A;  2D1W A;  3NQZ A;  3T0U A;  2C11 A; 
#chains in the Genus database with same CATH topology
 1IQY A;  5IEP A;  2CFK A;  1K28 A;  1ROA A;  1GMQ A;  1R4C A;  2F86 B;  1FUS A;  1RN1 A;  1RGA A;  1A2K A;  1W6C A;  4XDV A;  2QGU A;  3LT9 A;  4KT3 B;  3G71 3;  2E2U A;  1RTU A;  3CXC 2;  2W2C A;  1MWS A;  1EG9 B;  3WR2 A;  4MMY B;  1EUI C;  2F5W A;  1WQL B;  2GEY A;  2IUJ A;  1OHS A;  3HI7 A;  4HBR A;  3WHO A;  3I55 3;  1CEW I;  2P0M A;  1I70 A;  9RNT A;  1O7M B;  2YX9 A;  3PGB A;  4HM4 B;  2ZHX B;  1T2I A;  5JPU A;  1NB5 I;  2HMJ B;  3DGM A;  4HM1 B;  2WOH A;  1OF5 B;  1UUW B;  1W7C A;  1GYB A;  2W56 B;  5A0O B;  4ZM8 A;  1I3F A;  1FGQ A;  1JB5 A;  3FKA A;  3KCH A;  2BMO B;  5FGO A;  1M1K 4;  1VQ9 3;  2R4I A;  4TX4 A;  4FMA A;  3BNC A;  3S28 A;  3EB8 A;  2QEX 3;  5M18 A;  3F40 A;  3B7C A;  4KVH A;  1T3B A;  1RKY A;  4O2H A;  1JBT A;  2HMN B;  1UUV B;  1W4N A;  1OCV A;  2CFD A;  3SOA A;  3CCE 3;  4BL2 A;  4IT7 A;  2WO0 A;  1GD3 A;  4LMI A;  1UCJ A;  5JBS A;  1E3R A;  4AKY A;  1B2U A;  1E97 A;  1QMA A;  2BMQ B;  2W03 A;  3PCR A;  5KP3 A;  3DXO A;  1BNJ A;  1FGM A;  1O7N B;  4MEI A;  5AEU B;  4K1U A;  1BNF A;  1NB3 I;  1SII A;  4N6V 0;  4CPK A;  3JUQ A;  2BIR A;  1VQ6 3;  4U13 A;  4NPB A;  3DUK A;  1W2B 2;  1PFP A;  3T8N A;  1NJI 4;  1TRQ A;  2YFI B;  4G1M B;  2KAA A;  4O3V A;  3OWS A;  4J5K A;  1JKG B;  4XDW A;  1IT7 A;  1M90 4;  3U97 A;  2QIY A;  1RGC A;  1RGG A;  1UDI I;  3JUO A;  5M19 A;  1BRI A;  1MWR A;  1ZO2 A;  5IEO A;  2XSH B;  4HM7 B;  3ZG5 A;  3B4O A;  1BIR A;  1SIH A;  1GSP A;  3HII A;  1RMS A;  1DMM A;  1TIJ A;  1G0T A;  2BT3 A;  4PEJ A;  4BTX A;  3Q3F A;  1CYV A;  2IYJ A;  1JB2 A;  1QVF 2;  1QJG A;  4FMC A;  1A90 A;  2HMO B;  3FF2 A;  3L0R A;  1PU4 A;  5IG3 A;  2MF7 A;  5BU4 A;  1G96 A;  1K73 4;  2OOV A;  2CIU A;  1BRK A;  1UI8 A;  3DZL A;  2H0H A;  1HZ1 A;  3N54 B;  1ZX2 A;  3AMO B;  2P38 A;  1JJ2 2;  1X1Y A;  1LOX A;  2CWV A;  2XFS A;  2AAE A;  3NXJ A;  3S29 A;  4LZI A;  1LXE A;  3D5G A;  3F14 A;  4BIR A;  3DGN A;  1STF I;  1FGR A;  3BIR A;  2INX A;  1GOY A;  3D5I A;  3NHX A;  1D6Y A;  1WNH A;  2Z76 A;  3WOF B;  3D9R A;  4BL3 A;  1JN5 A;  2F5M A;  4Q53 A;  1VQQ A;  1JRQ A;  3RGR A;  1NWW A;  1TRP A;  1N9J A;  2FGT A;  3IPT A;  4FMD A;  4J8T A;  3D3L A;  1VQK 3;  4RNZ A;  3OWU A;  2KRT A;  3LZA A;  1WMO A;  3JUN A;  2FXT A;  4R9L A;  1Z1S A;  2XR8 B;  2KF5 A;  3VF1 A;  4HYZ A;  3CC7 3;  2HML B;  5CF1 A;  3LT8 A;  3PCS A;  1RNB A;  2CKF B;  3MKI A;  1K9M 4;  3RGA A;  3DGY A;  5BXQ A;  2OTJ 3;  3FG1 A;  3MG2 A;  2QA4 3;  1ASK A;  2B1X B;  3TDG A;  3H3H A;  3FCS B;  1U5O A;  2XEP A;  4L8O A;  2E2T A;  2ML5 A;  3CD6 3;  1CYU A;  1NU3 A;  3NUV A;  5DRV A;  3S5C A;  1Q86 4;  3F8X A;  1FYS A;  5AII A;  1EQK A;  4WYK B;  4N6L A;  2CX0 A;  2I9W A;  1TU5 A;  4L8P A;  1BGS A;  2GXF A;  3EHC A;  3EQQ B;  3ECF A;  4KZ1 A;  1Q7H A;  1I8V A;  2GU3 A;  3G6E 3;  3X41 A;  1I3I A;  3EBT A;  3WA2 X;  1D6Z A;  3NV0 A;  2KF3 A;  4WYK A;  2L1S A;  2GSP A;  1DMQ A;  1IVU A;  1KWI A;  1RRH A;  2IA7 A;  3M8C A;  3PYJ A;  5AIG A;  5AIF A;  1W02 A;  5G1L A;  3NM2 A;  3V98 A;  3AGN A;  1LNI A;  1IVW A;  2BO9 B;  3SOY A;  4IIA A;  1SJW A;  1MGW A;  1GOU A;  5IW9 A;  1IVX A;  2YFL B;  1YNV X;  2RBI A;  1V58 A;  3KII A;  1JBR A;  4NRE A;  3D79 A;  4HZB B;  1FGT A;  4R9K A;  2CK3 H;  8CHO A;  3BU4 A;  3DY5 A;  1W2Z A;  3ZFZ A;  1CH0 A;  1I0V A;  1RGH A;  3FLJ A;  3V92 A;  3CC2 3;  1RGK A;  2OOV C;  1I2G A;  2P09 A;  3BB9 A;  3EF8 A;  3OW2 2;  3CCR 3;  1Q40 B;  1LVN A;  3KSP A;  1BNI A;  1BVI A;  2ML6 A;  2E2V A;  1LNH A;  1B2X A;  1D6U A;  1I2F A;  5JPP A;  1SQW A;  3X3Z A;  4KFD A;  4XBT A;  3X3X A;  5GSP A;  1R4Y A;  1MWT A;  1N8R 4;  1Q40 A;  1LRA A;  3CCQ 3;  1VQM 3;  1IQ8 A;  3WOE B;  3BNB A;  4JF8 A;  1SAR A;  3F8H A;  3T8U A;  4DKI A;  1ULI B;  2WGQ A;  2CX1 A;  1YI2 3;  2CWU A;  4J9A A;  1OF5 A;  2CWT A;  1IYY A;  1O7W B;  4EYC A;  1ULJ B;  2W56 A;  3MYT A;  1EKM A;  3I0Y A;  3RNT A;  3KN4 A;  4N6T A;  2K0M A;  1MOL A;  3EX9 A;  1TFK A;  3WMD A;  1Q42 A;  4WWU C;  3K7C A;  2GU1 A;  1N9E A;  4RBN A;  3ALA A;  1L5G B;  2FNQ A;  2M7O A;  3GZB A;  3N9H A;  1LOV A;  4J5G A;  2F99 A;  4BTW A;  1RGF A;  3Q90 A;  2WOF A;  1O7G B;  2PZV A;  2Z7A A;  2JDI H;  3U1W A;  3B4P A;  7GSP A;  3SX1 A;  1C54 A;  2ZL8 A;  1TJD A;  1QAL A;  3MHE A;  2IY2 A;  4CDL A;  2IUK A;  3E99 A;  3KE7 A;  4OK0 A;  1VQ7 3;  3AGO A;  3UB1 A;  1NO3 A;  3H51 A;  5AYS C;  5I97 A;  3FF0 A;  2KF4 A;  4RNY A;  3K5T A;  1BSC A;  1JB4 A;  3CPO A;  1JKG A;  2BHM A;  1Y4K A;  4O8S A;  5AI1 A;  3CME 3;  5G1K A;  1KC8 4;  5LC6 A;  5HOH A;  5CF2 A;  5EEO A;  1BRS A;  3DGL A;  3NBJ A;  3DM8 A;  3LTC A;  2D1W A;  3EN8 A;  3IMA B;  5EVH A;  5TGN A;  1TTO A;  2GEX A;  3NQZ A;  3WDG B;  1QVG 2;  1GY7 A;  4HM3 B;  1V57 A;  1BRJ A;  1B2S A;  1FGO A;  3NX0 A;  1YJW 3;  3A76 A;  4FCZ A;  3SXX A;  3RDE A;  3S67 A;  3UL6 A;  2IMJ A;  3B8L A;  1VQN 3;  1IU7 A;  1F8N A;  1NDO B;  2W04 A;  1B20 A;  1WMN A;  2L4V A;  3FG4 A;  4LGQ A;  2CG1 A;  1YVS A;  3AMO A;  1RCK A;  3UJM A;  1YJ9 3;  1O7P B;  3EJV A;  4OVM A;  2P05 A;  5BVB A;  1BU4 A;  3F7X A;  2KXG A;  4XB5 A;  1S5A A;  2XGL A;  4KFF A;  1BSA A;  3HX8 A;  4WP5 A;  5IEN A;  2HMM B;  1W00 A;  3EBY A;  5AEW B;  4HM8 B;  2BMR B;  1BSD A;  1BSB A;  1DET A;  1TFO A;  2H0I A;  2RNT A;  1LQM B;  3LTD A;  2RCD A;  1WTH A;  3NBR A;  1MWU A;  3OXA A;  1OPY A;  5IER A;  1UW1 A;  1C7H A;  3SED A;  1U8C B;  1RGL A;  3EE1 A;  5CLK A;  1JNQ A;  1BOX A;  1GY5 A;  3D4A A;  3X42 A;  1JZD A;  1S72 3;  4N6O B;  3MG3 A;  2OWP A;  3LXU X;  1BNE A;  2XFT A;  4K1V A;  2HOH A;  4WHA A;  1N5P A;  1AVK A;  1OAC A;  2KCD A;  4CCV A;  1J2B A;  1A2V A;  3LYG A;  1Q82 4;  3SVA A;  1BRG A;  4HM5 B;  1JBS A;  1IQX A;  4KFE A;  1DYU A;  1JZO A;  2HMK B;  1MNL A;  1ISK A;  1DMN A;  3UL5 A;  3OV4 A;  1YIT 3;  4HM6 B;  2B24 B;  1W6Y A;  2Y73 A;  1OGZ A;  1VQP 3;  3HZP A;  3JUM A;  1B3S A;  1W5Z A;  2F4Y A;  2C10 A;  2CFG A;  2RGQ A;  3CMA 3;  1X1W A;  1GY6 A;  3FH1 A;  2W9P A;  2F98 A;  3GWR A;  4ORL A;  3PZW A;  4O02 B;  5CXO A;  4BTY A;  3VGN A;  1ROV A;  2OCT A;  2W6J H;  3LML A;  1DVD A;  1A2P A;  1RCL A;  3BNE A;  3CU3 A;  1GOV A;  3LOY A;  5IG0 A;  1AV4 A;  1CQS A;  3CCU 3;  3N8B A;  3MWZ A;  4HM0 B;  4FCM A;  1W01 A;  1AY7 A;  2SBL A;  3K63 A;  1I0X A;  3NM7 A;  4R4K A;  1US1 A;  2GBX B;  4QWT A;  5RNT A;  1K8A 4;  1LOW A;  3G0K A;  3SYU A;  4H61 A;  3CCS 3;  3SLU A;  4AEQ A;  1AR0 A;  3WA3 A;  3G16 A;  4LYL B;  4X2O A;  1W6G A;  1IV7 A;  1N8Q A;  1B21 A;  4R1K A;  3BLZ A;  3ROB A;  3HIG A;  2W9Q A;  2Q07 A;  2CHC A;  5IF6 A;  4EW5 A;  1T5Y A;  3WOD G;  3CPW 2;  5KP1 A;  3K0Z A;  1RDS A;  1BNG A;  1EA2 A;  1ZS7 A;  1RJO A;  1RN4 A;  2STD A;  2UGI A;  3IJE B;  3MSO A;  3NBB A;  4HJL B;  4FCJ A;  1WMP A;  4GHO A;  2CG0 A;  1HKX A;  2AAD A;  2R41 A;  1E3V A;  3FGY A;  3J7Y d;  1B2M A;  1VQL 3;  1BRH A;  1BUQ A;  1FUT A;  1YHQ 3;  1B2Z A;  4ILF A;  1OH0 A;  6STD A;  5G2G A;  3KSE D;  4LEH A;  4HKV B;  3QK9 A;  4N6M A;  3ZG0 A;  1BRN L;  1BAO A;  4GB5 A;  1T2H A;  2BNG A;  1BNS A;  1BAN A;  1VZZ A;  3T0U A;  3GSP A;  2Z77 A;  4I4K A;  2C11 A;  3CCL 3;  4N3V A;  3PXM A;  1N5H A;  2GBW B;  1GS3 A;  1Q7Y 4;  4LSO A;  1B27 A;  2BU4 A;  4AKZ A;  1VQ5 3;  1VQ4 3;  4EC6 A;  1M1X B;  2OQE A;  4H3U A;  1TUH A;  2CFL A;  1RNT A;  2P0X A;  3BND A;  3F9S A;  1DVC A;  1OHO A;  3Q1C A;  3EN1 B;  4BU4 A;  4EBG A;  1I2E A;  3GRD A;  3HOH A;  1RHL A;  2XSO B;  2YFJ B;  2Y74 A;  5STD A;  2SAR A;  1YVB I;  5EQL A;  1Q81 4;  1JV2 B;  1UCI A;  4STD A;  2ZA4 A;  1STD A;  1IV9 A;  1HU9 A;  1UUG B;  6GSP A;  4L7K A;  1O7H B;  2LYX A;  1K41 A;  2K54 A;  3V99 A;  1BNR A;  2CH9 A;  4NHF A;  3KKG A;  4HAA A;  2MC8 A;  3G8Z A;  5DRE A;  3S27 A;  3A5E A;  5BIR A;  1ZGX A;  3CCJ 3;  3K9M C;  4K61 A;  2CC3 A;  1IDP A;  5M1A A;  3JVC A;  4IPB A;  3G4S 3;  1RLS A;  1UGI A;  4MMZ B;  4EV5 A;  1GMP A;  1RRL A;  2KF6 A;  2J8X B;  3MG1 A;  3CC4 3;  5IG5 A;  3OX9 A;  1MGR A;  3AHW A;  5ELU A;  1UI7 A;  1FA3 A;  3DMC A;  5D82 A;  3DGO A;  2ZDJ A;  1PYL A;  3DH2 A;  4N6N B;  8RNT A;  5KP4 A;  1TP6 A;  4HOH A;  2XGN A;  1Q9E A;  4MMX B;  3LTA A;  3GAX A;  3URP A;  3UNL A;  3F7S A;  1GMR A;  1RGE A;  1AVL A;  7RNT A;  2XF3 A;  3FG3 A;  1HYF A;  1YGW A;  3VSY A;  1YIJ 3;  4GSP A;  6RNT A;  1LQG C;  3NQY A;  3KZT A;  2XRX B;  2F56 A;  1PY3 A;  3MPH A;  5AIH A;  2LQV A;  1KSI A;  1IVV A;  4HM2 B;  1FW7 A;  2PNC A;  1X1X A;  2UUG C;  1FZU A;  4R80 A;  1YGE A;  4OUQ A;  1VQO 3;  3AHS A;  4GL6 A;  1SPU A;  3FSD A;  4RNT A;  1JN5 B;  5HGR A;  1KD1 4;  1RN7 A;  3JUP A;  3LH4 A;  1GD4 A;  4K90 B;  1IK3 A;  3X40 A;  2Z6B A;  3QRD A;  4EXR A;  2WGO A;  2K3D A;  3CNM A;  4WFO A;  4EV2 A;  4JRF A;  2JQ5 A;  2OQE C;  2CFW A;  1V74 A;  3STD A;  2OTL 3;  1YJN 3;  2H0G A;  1KQS 2;  4XM4 A;  5CK6 A;  4XBY A;  5D81 A;  2RSX A;  3ER7 A;  3GZR A;  3HK4 A;  5FW5 A;  4CJN A;  3OWY A;  4N6U A;  1A67 A;  5IG4 A;  1BUJ A;  1QAK A;  4FR9 A;  5LC7 A;  1FUW A;  2D42 A;  4HZ9 B;  2O3O A;  2V1L A;  2C4B A;  4FMB A;  1RSN A;  1BSE A;  1OGX A;  2A15 A;  4RZM A;  4X2H A;  1VQ8 3;  1NNV A;  1X1U A;  3FZW A;  4XBX A;  5ELJ A;  3CCV 3;  3KFQ C;  1DE3 A;  2CW9 A;  1OHP A;  5AYR B;  3NV0 B;  2RFR A;  1UCL A;  3GZY B;  5D83 A;  1LOY A;  3Q2P A;  2O9U X;  1M9G A;  2XH9 A;  4I5Q A;  1OUN A;  3GZX B;  3CCM 3;  3PS8 A;  1UGH I;  1AQZ A;  1G02 A;  2UX0 A;  1QAF A;  3LTB A;  1EEJ A;  4MJD A;  3X3Y A;  2W0Q A;  4HVN A;  1UCK A;  3EC9 A;  3I56 3;  3O8Y A;  1IT8 A;  7STD A;  3CNX A; 
#chains in the Genus database with same CATH homology
 1IQY A;  5IEP A;  2CFK A;  1K28 A;  1ROA A;  1R4C A;  2F86 B;  1W6C A;  4XDV A;  1A2K A;  2QGU A;  3LT9 A;  3G71 3;  2E2U A;  3CXC 2;  2W2C A;  1EG9 B;  4MMY B;  2GEY A;  1WQL B;  2IUJ A;  1OHS A;  3HI7 A;  4HBR A;  3I55 3;  1CEW I;  2P0M A;  1O7M B;  2YX9 A;  3PGB A;  4HM4 B;  5JPU A;  1NB5 I;  2HMJ B;  3DGM A;  4HM1 B;  2WOH A;  1OF5 B;  1UUW B;  1W7C A;  1GYB A;  2W56 B;  5A0O B;  4ZM8 A;  1FGQ A;  1JB5 A;  3FKA A;  2BMO B;  5FGO A;  1M1K 4;  1VQ9 3;  2R4I A;  4TX4 A;  4FMA A;  3BNC A;  3S28 A;  3EB8 A;  2QEX 3;  3F40 A;  3B7C A;  4KVH A;  1RKY A;  4O2H A;  2HMN B;  1UUV B;  1W4N A;  1OCV A;  2CFD A;  3SOA A;  3CCE 3;  4IT7 A;  2WO0 A;  1GD3 A;  4LMI A;  5JBS A;  1E3R A;  4AKY A;  1E97 A;  1QMA A;  3PCR A;  2BMQ B;  2W03 A;  5KP3 A;  3DXO A;  1FGM A;  1O7N B;  4MEI A;  5AEU B;  4K1U A;  1SII A;  1NB3 I;  4N6V 0;  3JUQ A;  1VQ6 3;  4U13 A;  3DUK A;  1W2B 2;  1PFP A;  3T8N A;  1NJI 4;  2YFI B;  4G1M B;  4O3V A;  3OWS A;  1JKG B;  4XDW A;  1IT7 A;  3U97 A;  2QIY A;  3JUO A;  1ZO2 A;  5IEO A;  2XSH B;  4HM7 B;  3B4O A;  1SIH A;  3HII A;  1DMM A;  1TIJ A;  4PEJ A;  2BT3 A;  4BTX A;  1CYV A;  1JB2 A;  1QVF 2;  1QJG A;  4FMC A;  1A90 A;  2HMO B;  3FF2 A;  3L0R A;  1PU4 A;  5IG3 A;  2MF7 A;  1G96 A;  1K73 4;  2OOV A;  2CIU A;  1UI8 A;  3DZL A;  3N54 B;  1ZX2 A;  3AMO B;  2P38 A;  1JJ2 2;  1LOX A;  2CWV A;  2XFS A;  3NXJ A;  3S29 A;  4LZI A;  1LXE A;  3F14 A;  3DGN A;  1STF I;  1FGR A;  3NHX A;  2INX A;  1D6Y A;  1WNH A;  2Z76 A;  3WOF B;  3D9R A;  1JN5 A;  4Q53 A;  1JRQ A;  3RGR A;  1NWW A;  1N9J A;  2FGT A;  3IPT A;  4FMD A;  4J8T A;  3D3L A;  1VQK 3;  4RNZ A;  3OWU A;  2KRT A;  3LZA A;  1WMO A;  3JUN A;  2FXT A;  4R9L A;  1Z1S A;  2XR8 B;  3VF1 A;  4HYZ A;  3CC7 3;  2HML B;  5CF1 A;  3LT8 A;  3PCS A;  2CKF B;  3MKI A;  1K9M 4;  3RGA A;  5BXQ A;  2OTJ 3;  3FG1 A;  3MG2 A;  2QA4 3;  1ASK A;  2B1X B;  3TDG A;  3H3H A;  3FCS B;  1U5O A;  2XEP A;  4L8O A;  2E2T A;  2ML5 A;  3CD6 3;  1CYU A;  1NU3 A;  3NUV A;  5DRV A;  3S5C A;  1Q86 4;  3F8X A;  5AII A;  1EQK A;  4WYK B;  4N6L A;  1TU5 A;  2I9W A;  4L8P A;  2GXF A;  3EHC A;  3EQQ B;  3ECF A;  4KZ1 A;  2GU3 A;  3G6E 3;  3X41 A;  3EBT A;  3WA2 X;  1D6Z A;  3NV0 A;  4WYK A;  1DMQ A;  1IVU A;  1KWI A;  1RRH A;  2IA7 A;  3M8C A;  3PYJ A;  5AIG A;  5AIF A;  1W02 A;  3V98 A;  3NM2 A;  1IVW A;  2BO9 B;  3SOY A;  4IIA A;  1SJW A;  5IW9 A;  1IVX A;  2YFL B;  3KII A;  4NRE A;  4HZB B;  4R9K A;  1FGT A;  2CK3 H;  8CHO A;  3DY5 A;  1W2Z A;  3CC2 3;  3FLJ A;  3V92 A;  2OOV C;  3EF8 A;  2P09 A;  3BB9 A;  3OW2 2;  3CCR 3;  1Q40 B;  1LVN A;  3KSP A;  2ML6 A;  2E2V A;  1LNH A;  1D6U A;  5JPP A;  1SQW A;  3X3Z A;  4KFD A;  4XBT A;  3X3X A;  1N8R 4;  1Q40 A;  3CCQ 3;  1VQM 3;  1IQ8 A;  3WOE B;  3BNB A;  4JF8 A;  3F8H A;  3T8U A;  1ULI B;  2WGQ A;  1YI2 3;  2CWU A;  4J9A A;  1OF5 A;  2CWT A;  1O7W B;  4EYC A;  1ULJ B;  2W56 A;  3MYT A;  1EKM A;  3I0Y A;  3KN4 A;  4N6T A;  2K0M A;  1MOL A;  3EX9 A;  1TFK A;  3WMD A;  1Q42 A;  4WWU C;  3K7C A;  2GU1 A;  1N9E A;  4RBN A;  3ALA A;  1L5G B;  2FNQ A;  2M7O A;  3GZB A;  3N9H A;  2F99 A;  4BTW A;  3Q90 A;  2WOF A;  1O7G B;  2PZV A;  2Z7A A;  2JDI H;  3U1W A;  3B4P A;  3SX1 A;  2ZL8 A;  1QAL A;  3MHE A;  4CDL A;  2IUK A;  3E99 A;  3KE7 A;  4OK0 A;  1VQ7 3;  3UB1 A;  1NO3 A;  3H51 A;  5AYS C;  5I97 A;  3FF0 A;  4RNY A;  3K5T A;  1JB4 A;  3CPO A;  1JKG A;  2BHM A;  1Y4K A;  4O8S A;  5AI1 A;  3CME 3;  1KC8 4;  5LC6 A;  5CF2 A;  5EEO A;  3DGL A;  3NBJ A;  3DM8 A;  3LTC A;  2D1W A;  3EN8 A;  3IMA B;  5EVH A;  5TGN A;  2GEX A;  3WDG B;  3NQZ A;  1QVG 2;  1GY7 A;  4HM3 B;  1FGO A;  3NX0 A;  1YJW 3;  3A76 A;  4FCZ A;  3SXX A;  3RDE A;  3S67 A;  3UL6 A;  2IMJ A;  3B8L A;  1VQN 3;  1IU7 A;  1F8N A;  1NDO B;  2W04 A;  1WMN A;  2L4V A;  3FG4 A;  4LGQ A;  2CG1 A;  3AMO A;  3UJM A;  1YJ9 3;  1O7P B;  3EJV A;  4OVM A;  2P05 A;  5BVB A;  4XB5 A;  3F7X A;  2KXG A;  1S5A A;  2XGL A;  4KFF A;  3HX8 A;  4WP5 A;  5IEN A;  2HMM B;  1W00 A;  3EBY A;  5AEW B;  4HM8 B;  2BMR B;  1TFO A;  3LTD A;  2RCD A;  1WTH A;  3NBR A;  3OXA A;  1OPY A;  5IER A;  1UW1 A;  1C7H A;  3SED A;  1U8C B;  3EE1 A;  5CLK A;  1JNQ A;  1GY5 A;  3X42 A;  1S72 3;  4N6O B;  3MG3 A;  2OWP A;  3LXU X;  2XFT A;  4K1V A;  4WHA A;  1N5P A;  1AVK A;  1OAC A;  2KCD A;  4CCV A;  1J2B A;  1A2V A;  3LYG A;  1Q82 4;  3SVA A;  4HM5 B;  1IQX A;  4KFE A;  1DYU A;  2HMK B;  1MNL A;  1ISK A;  1DMN A;  3UL5 A;  3OV4 A;  1YIT 3;  4HM6 B;  2B24 B;  1W6Y A;  2Y73 A;  1OGZ A;  1VQP 3;  3HZP A;  3JUM A;  3CMA 3;  1W5Z A;  2C10 A;  2CFG A;  2RGQ A;  3FH1 A;  1GY6 A;  2W9P A;  2F98 A;  3GWR A;  4ORL A;  3PZW A;  4O02 B;  5CXO A;  4BTY A;  3VGN A;  1ROV A;  2OCT A;  2W6J H;  3LML A;  1DVD A;  3BNE A;  3CU3 A;  5IG0 A;  3LOY A;  1AV4 A;  1CQS A;  3CCU 3;  3N8B A;  3MWZ A;  4HM0 B;  4FCM A;  1W01 A;  2SBL A;  3K63 A;  3NM7 A;  4R4K A;  1US1 A;  2GBX B;  4QWT A;  1K8A 4;  3G0K A;  4H61 A;  3CCS 3;  3SLU A;  4AEQ A;  1AR0 A;  3WA3 A;  3G16 A;  4X2O A;  1W6G A;  1IV7 A;  1N8Q A;  4R1K A;  3ROB A;  3BLZ A;  3HIG A;  2W9Q A;  2Q07 A;  2CHC A;  5IF6 A;  1T5Y A;  3WOD G;  3CPW 2;  5KP1 A;  3K0Z A;  1EA2 A;  2STD A;  1RJO A;  3IJE B;  3MSO A;  4HJL B;  3NBB A;  4K61 A;  4FCJ A;  1WMP A;  2CG0 A;  1HKX A;  3FGY A;  1E3V A;  3J7Y d;  1VQL 3;  1BUQ A;  1YHQ 3;  1OH0 A;  6STD A;  5G2G A;  3KSE D;  4LEH A;  4HKV B;  3QK9 A;  4N6M A;  4GB5 A;  2BNG A;  1VZZ A;  3T0U A;  2Z77 A;  4I4K A;  2C11 A;  3CCL 3;  4N3V A;  3PXM A;  1N5H A;  2GBW B;  1GS3 A;  1Q7Y 4;  4LSO A;  4AKZ A;  1VQ5 3;  1VQ4 3;  4EC6 A;  1M1X B;  2OQE A;  4H3U A;  1TUH A;  2CFL A;  2P0X A;  3BND A;  3F9S A;  1DVC A;  1OHO A;  3Q1C A;  3EN1 B;  4EBG A;  1M90 4;  3GRD A;  2XSO B;  2YFJ B;  2Y74 A;  5STD A;  5EQL A;  1YVB I;  1Q81 4;  1JV2 B;  4STD A;  1STD A;  1IV9 A;  1HU9 A;  4L7K A;  1O7H B;  2LYX A;  1K41 A;  2K54 A;  3V99 A;  2CH9 A;  4NHF A;  3KKG A;  2MC8 A;  3G8Z A;  5DRE A;  3S27 A;  3CCJ 3;  3K9M C;  2CC3 A;  1IDP A;  3JVC A;  4IPB A;  3G4S 3;  4MMZ B;  4EV5 A;  3CC4 3;  1RRL A;  3MG1 A;  5IG5 A;  3OX9 A;  5ELU A;  1UI7 A;  1FA3 A;  3DMC A;  5D82 A;  3DGO A;  2ZDJ A;  4N6N B;  5KP4 A;  1TP6 A;  2XGN A;  4MMX B;  3LTA A;  3GAX A;  3UNL A;  3F7S A;  1AVL A;  2XF3 A;  3FG3 A;  1YIJ 3;  3VSY A;  3NQY A;  3KZT A;  2XRX B;  3MPH A;  5AIH A;  2LQV A;  1KSI A;  1IVV A;  4HM2 B;  2PNC A;  4R80 A;  1YGE A;  4OUQ A;  1VQO 3;  4GL6 A;  1SPU A;  3FSD A;  5HGR A;  1JN5 B;  1KD1 4;  1RN7 A;  3JUP A;  3LH4 A;  1GD4 A;  4K90 B;  1IK3 A;  3X40 A;  2Z6B A;  3QRD A;  4EXR A;  2WGO A;  3CNM A;  4WFO A;  4EV2 A;  4JRF A;  2JQ5 A;  2OQE C;  2CFW A;  1V74 A;  3STD A;  2OTL 3;  1YJN 3;  1KQS 2;  4XM4 A;  5CK6 A;  4XBY A;  5D81 A;  2RSX A;  3ER7 A;  3GZR A;  3HK4 A;  5FW5 A;  3OWY A;  4N6U A;  1A67 A;  5IG4 A;  1QAK A;  4FR9 A;  5LC7 A;  1FUW A;  2D42 A;  4HZ9 B;  2O3O A;  2V1L A;  4FMB A;  1OGX A;  2A15 A;  4RZM A;  4X2H A;  1VQ8 3;  3FZW A;  4XBX A;  5ELJ A;  3CCV 3;  3KFQ C;  2CW9 A;  1OHP A;  5AYR B;  3NV0 B;  2RFR A;  3GZY B;  5D83 A;  3Q2P A;  2O9U X;  1M9G A;  2XH9 A;  1OUN A;  3GZX B;  3CCM 3;  3PS8 A;  2UX0 A;  1QAF A;  3LTB A;  4MJD A;  3X3Y A;  2W0Q A;  4HVN A;  3EC9 A;  3I56 3;  3O8Y A;  1IT8 A;  7STD A;  3CNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...