4EXRA

Crystal structure of a putative lipoprotein (cd1622) from clostridium difficile 630 at 1.85 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
152
structure length
152
Chain Sequence
NENLMEQDFKVPYTDAINIFKDKYKDADIVDLSLERDLNKFVYTVEGVDDNNEYKMKIDANTKDVLEDKTEKLDSEDLNGVARKEKLDLNDIMTPQQAMEIALKEQNGIVKEWSLDKDLDVTFYKIRIDKDKNEYDIKVDSKKGTVLKVEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative lipoprotein
publication title Crystal structure of a putative lipoprotein (CD1622) from Clostridium difficile 630 at 1.85 A resolution
rcsb
source organism Clostridium difficile
molecule tags Unknown function
total genus 35
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2012-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03413 PepSY Peptidase propeptide and YPEB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4exrA01
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4exrA02
2CFGA 2OQEC 1WMPA 3ALAA 3T0UA 1SPUA 1WMOA 1A2VA 1IVXA 2WOHA 4KFEA 3SXXA 3SX1A 3AMOA 1DYUA 1QAKA 3X3ZA 1QALA 2W0QA 1AVKA 2ZL8A 1SIIA 2CFWA 1IVVA 2CWUA 3MPHA 2OOVA 1OACA 2CFDA 3NQZA 3X42A 1QAFA 3HIIA 1US1A 3X3XA 1AVLA 2OOVC 4EV5A 2CFLA 1D6ZA 2CWVA 1N9EA 3HIGA 1LVNA 3X3YA 1TU5A 3X40A 2YX9A 4BTWA 1UI7A 3KIIA 2Y73A 1SIHA 2BT3A 3PGBA 2E2TA 1W5ZA 1IQXA 3WA3A 2PNCA 1JRQA 3NQYA 4EXRA 1W6GA 3KN4A 1W6CA 1IQYA 1AV4A 2CFKA 2WO0A 1EKMA 2K0MA 1W2ZA 2D1WA 3HI7A 3NBJA 3N9HA 4BTXA 4BTYA 2WGQA 2E2VA 2IA7A 3LOYA 4KFDA 2C11A 1IVWA 1IVUA 1IU7A 1W7CA 1D6YA 4EV2A 5IW9A 2CWTA 2C10A 1WMNA 3AMOB 2CG0A 2CG1A 1RJOA 3WA2X 1D6UA 2WOFA 1UI8A 1W4NA 2Y74A 3X41A 2OQEA 1KSIA 1PU4A 3K5TA 3NBBA 1RKYA 4KFFA 2E2UA 2GU3A
chains in the Genus database with same CATH superfamily
4LZIA 1TRQA 2IY2A 3IJEB 3CCM3 1GOUA 1FGRA 1I8VA 1M9GA 1B2SA 1MNLA 2BMQB 2HOHA 3EQQB 4NPBA 3DGYA 4N6MA 3S5CA 3FG4A 3CCS3 3B8LA 1JV2B 3JUNA 1QJGA 2P0XA 3CC23 2MC8A 1GY6A 1Q9EA 2WOHA 1OH0A 3AHSA 3SXXA 2HMLB 3F8XA 1C7HA 3CPOA 2H0HA 2F4YA 3WDGB 1B3SA 3EC9A 2KCDA 3G16A 2FXTA 5FW5A 4N6LA 3CCL3 1JB5A 3PCRA 2ZL8A 1LXEA 5KP3A 1SIIA 4FCJA 1MOLA 1CYVA 3B7CA 1JZOA 1RGEA 3D5GA 3Q2PA 4AEQA 5IERA 1R4YA 1SJWA 1FW7A 2GXFA 5EQLA 3OWSA 1OACA 2OWPA 3FG3A 1N5PA 3X42A 1FGQA 3BIRA 1TFOA 1QAFA 1TIJA 3EJVA 2IUKA 1CH0A 2RBIA 1OGZA 2KAAA 1TP6A 3Q90A 4HYZA 2YFJB 2CHCA 2R4IA 4J5KA 5IG0A 1BRSA 1BNEA 3F7SA 4FMAA 4XB5A 2IUJA 1N9EA 4XDVA 1YJN3 3PS8A 2RGQA 4XBXA 1LVNA 1T3BA 1TU5A 3X40A 1K734 1UI7A 3G6E3 1WTHA 1RGKA 2BMOB 2K54A 4N6NB 2KRTA 1M1K4 1LOWA 1X1YA 2F98A 1WNHA 1W5ZA 1WQLB 3AGOA 1IQXA 4WYKB 1VZZA 2SBLA 1JRQA 2BMRB 2O9UX 3DGMA 3ROBA 4WHAA 1E97A 3KFQC 5JPUA 3CXC2 1HZ1A 1E3VA 1RGCA 1CEWI 1LQGC 4K61A 1JN5A 7STDA 1W6YA 2CFKA 4XDWA 2CX0A 3LTCA 4HJLB 1RMSA 4HM7B 3GZYB 1RN4A 1ZGXA 1BUJA 5FGOA 2K0MA 5IEOA 1A2KA 2XFSA 3NBRA 3DM8A 3OV4A 2CK3H 1CYUA 2OTJ3 3RDEA 1T2HA 3LMLA 2QIYA 2W56B 4HKVB 2XSOB 1SQWA 2C11A 4LYLB 3FSDA 2GU1A 4GHOA 1IVUA 2XGNA 3M8CA 4IT7A 3NX0A 4KVHA 2BNGA 3D79A 5HOHA 3DMCA 1BNRA 4O3VA 5GSPA 3CPW2 1TRPA 1YGWA 3GAXA 3SLUA 3TDGA 4K1VA 1O7NB 3D9RA 7GSPA 3D4AA 1PFPA 1TUHA 3STDA 4BL2A 1RDSA 1U5OA 3KCHA 2CG1A 1QMAA 3NV0B 5LC6A 4HM4B 3K0ZA 1O7MB 1B2MA 3EB8A 2WOFA 4ILFA 3DGNA 2D42A 1T2IA 2P09A 2Y74A 3X41A 1FA3A 1KSIA 1N9JA 3V99A 2CKFB 5CF2A 1BSCA 2ML6A 3ZG5A 3OW22 1NB3I 1BRHA 4MMYB 3WMDA 4R1KA 4FMDA 3RGAA 1KD14 3NBBA 3MYTA 4IPBA 8RNTA 2JQ5A 2E2UA 2GU3A 1BSBA 3FKAA 3GRDA 3LTDA 2RFRA 1DVDA 3VF1A 1BNJA 2L4VA 1Q814 2OQEC 3OWYA 5JPPA 1UUWB 3O8YA 2W9PA 3CNMA 3GWRA 3DXOA 3RNTA 3H51A 1BAOA 1HU9A 3FF0A 3CCJ3 4HAAA 1I0VA 1IVXA 1GD3A 3K63A 4KFEA 3BU4A 7RNTA 3U1WA 4R9KA 1YVBI 1X1WA 3D3LA 3CU3A 3GZRA 4K90B 2V1LA 1W02A 2GEYA 3D5IA 3U97A 4Q53A 4WWUC 1UDII 4O02B 1BNSA 1RLSA 3MG2A 3FGYA 2ZDJA 2MF7A 1I70A 2UX0A 1JBRA 2JDIH 3H3HA 3G0KA 3SOAA 2P05A 3MPHA 1STDA 1N8QA 2L1SA 1YJ93 1BRJA 3F9SA 8CHOA 2BU4A 2CFDA 5DRVA 3NQZA 3UNLA 5STDA 4JRFA 1TJDA 4R80A 2YFIB 1YGEA 1DE3A 5AEUB 1JBTA 3X3XA 1FZUA 1IQ8A 1AVLA 2OOVC 4R9LA 1Q40A 4LGQA 4EV5A 2CFLA 1O7HB 1D6ZA 1I0XA 4XBTA 1B27A 4RBNA 4FR9A 3T8UA 1KQS2 3NM2A 1LQMB 1LRAA 3HIGA 1UUGB 4K1UA 3UL6A 1G02A 1JJ22 1UCJA 1LOVA 4NHFA 2Y73A 1SIHA 1Y4KA 5M18A 1BU4A 5AIIA 1ASKA 1BSDA 1JBSA 1O7GB 3E99A 2E2TA 3G8ZA 3SOYA 2F56A 3PXMA 1FUSA 2BO9B 1KWIA 4FCZA 3S27A 2PZVA 6GSPA 4HM8B 3CCQ3 1STFI 2W03A 4BL3A 2RNTA 3HX8A 3LT8A 1YI23 2Z6BA 1BNIA 1IQYA 1JN5B 1BOXA 1PYLA 2BHMA 3EBTA 4O2HA 1VQL3 3CCE3 1BVIA 3L0RA 1BSAA 1DMMA 5BVBA 4KFFA 1DETA 1W2ZA 4HM0B 3N9HA 5D83A 3FLJA 4HZBB 3ZFZA 2AAEA 1Q864 4HZ9B 2E2VA 4G1MB 5D81A 2IA7A 3LTBA 3LOYA 4KFDA 3CCU3 1LOYA 5IG4A 4CDLA 2B24B 3GZBA 3BNBA 2FGTA 4GL6A 1GY7A 3LT9A 2XRXB 5EVHA 1OGXA 1RCLA 5AIGA 2XF3A 3CCR3 3LYGA 3BNEA 4HM3B 3WOFB 2W9QA 3V98A 9RNTA 4ORLA 2RCDA 3EX9A 3AGNA 2CWTA 2C10A 4J5GA 3FG1A 3JUOA 1F8NA 2CIUA 3AMOB 2CG0A 3IPTA 2YFLB 5BU4A 1RRHA 1I2FA 3NUVA 3RGRA 3S28A 1G0TA 4X2HA 1OHPA 2O3OA 1UI8A 1RCKA 1W4NA 4LEHA 4CCVA 4LSOA 1GSPA 1HKXA 5KP4A 3QK9A 5TGNA 1GMPA 1JKGB 4KT3B 1RKYA 1VQ43 3A76A 1QVF2 1ROVA 1DVCA 2CH9A 2CFGA 2F5WA 4EYCA 1YVSA 1DMNA 1IV9A 1WMPA 4BIRA 5BXQA 3LXUX 3WR2A 3CCV3 4WP5A 2C4BA 1ISKA 4X2OA 3UB1A 3K9MC 2A15A 1SARA 1VQN3 1LNIA 4RNYA 5KP1A 1UGHI 2P0MA 1JZDA 2CC3A 1ULIB 1FGOA 5AIFA 2F86B 3AMOA 5RNTA 4HOHA 3UJMA 1DYUA 1N5HA 2F5MA 1AVKA 1BRIA 2B1XB 1O7WB 2ZA4A 3BNDA 2AADA 6RNTA 1NJI4 2CFWA 1BSEA 1ULJB 5M1AA 3EBYA 1YHQ3 1JKGA 2CWUA 1B2UA 2XR8B 1RGHA 1NDOB 1FYSA 1GOVA 1GS3A 1RGFA 3BB9A 1U8CB 3WOEB 5IG5A 3QRDA 2QGUA 5IEPA 1IDPA 2XEPA 1K41A 3DGOA 2LQVA 1KC84 1RGGA 1GMQA 1Q40B 2Z7AA 1FUTA 3BNCA 2RSXA 1FUWA 1RNBA 1RN7A 1UCIA 2SARA 1L5GB 1N8R4 2KF4A 4FCMA 1V58A 3X3YA 1S5AA 2XSHB 3CNXA 5HGRA 3KIIA 3OX9A 3BLZA 2Q07A 2GEXA 3EE1A 3N8BA 4OUQA 1OCVA 1UCLA 2I9WA 1VQ83 1MWRA 1UW1A 1EEJA 3ECFA 4MJDA 2K3DA 4HM6B 1I2EA 1V57A 3PGBA 1YIJ3 2XFTA 2OTL3 2GSPA 1MGRA 2IMJA 3PZWA 1M1XB 1RN1A 3FCSB 2PNCA 3EN8A 4N6TA 1GOYA 3OXAA 3S29A 1NU3A 1W6GA 4RZMA 1GD4A 3ZG0A 1V74A 5IG3A 3NXJA 3VSYA 1NO3A 3KN4A 3F40A 1AV4A 1VQ53 3DY5A 1AY7A 4FMCA 1EKMA 4ZM8A 3JUMA 1ZO2A 3HI7A 3JUQA 3NBJA 4BTXA 4BTYA 4L8PA 5ELUA 3EHCA 2ML5A 4GSPA 3JUPA 1J2BA 1RGAA 1TTOA 2M7OA 2STDA 5CF1A 2QEX3 1EQKA 3K7CA 2F99A 3CC43 1LOXA 1IU7A 2XH9A 3KZTA 4EBGA 3KKGA 1D6YA 4STDA 4RNTA 5IW9A 1A90A 1JNQA 3T8NA 4IIAA 5A0OB 1UUVB 2W2CA 3SEDA 3PYJA 2UUGC 1GMRA 1RJOA 1D6UA 1GY5A 1I3IA 3F14A 4GB5A 1LNHA 1Q824 3HZPA 2OQEA 1PY3A 2H0GA 4EC6A 6STDA 1PU4A 1NNVA 1BRKA 3K5TA 3FH1A 3I0YA 4I5QA 1BIRA 1IT8A 3ER7A 5D82A 3UL5A 4XBYA 1B20A 1BRGA 2P38A 1W2B2 3WHOA 2J8XB 1BNGA 1I2GA 1IV7A 3ALAA 1W00A 2INXA 3T0UA 1SPUA 1BNFA 1WMOA 1Z1SA 3B4OA 1A2VA 3VGNA 1VQM3 1UCKA 4H61A 4L8OA 1S723 5I97A 5DREA 1UGIA 1OPYA 2KF5A 4XM4A 1RTUA 3SX1A 1I3FA 1Q42A 4CJNA 1JB4A 4JF8A 1QAKA 3X3ZA 1VQO3 1QALA 2W0QA 3URPA 5AYSC 5BIRA 2Z76A 4FMBA 1QVG2 3KE7A 1TFKA 1MWSA 1EUIC 1VQ73 2KF6A 1IVVA 3A5EA 3MHEA 3V92A 1OHOA 4N6V0 4DKIA 5AIHA 4H3UA 4CPKA 1Q7Y4 2OOVA 1DMQA 2OCTA 1MWTA 1VQQA 3S67A 4KZ1A 2ZHXB 3EN1B 3GSPA 1EA2A 4N3VA 2XGLA 3KSPA 3KSED 2H0IA 3G713 3HIIA 2LYXA 1US1A 3MWZA 4OK0A 2GBXB 1VQ63 3CME3 1FGTA 4MMZB 5AI1A 1YJW3 5G1LA 1BGSA 2GBWB 4L7KA 1M904 2HMJB 4OVMA 1NWWA 3HK4A 2HMMB 5AYRB 3FZWA 2CWVA 1RSNA 4O8SA 1IYYA 2CX1A 1T5YA 3F7XA 5JBSA 3DH2A 3MG3A 2YX9A 4BTWA 1B2XA 5EEOA 2UGIA 3EF8A 4BU4A 2QA43 4HM1B 2BT3A 1MGWA 1ZX2A 1X1XA 5AEWB 1VQ93 2WGOA 2HMOB 1FGMA 2IYJA 1VQP3 4J8TA 1OF5B 5CK6A 3I553 1OHSA 1RNTA 3IMAB 4WYKA 3WA3A 5IF6A 1A67A 3NQYA 4PEJA 1IK3A 1ZS7A 2Z77A 5LC7A 4EXRA 4MEIA 3JVCA 4TX4A 5IENA 4N6UA 5CLKA 3HOHA 1W6CA 1IT7A 4MMXB 1B2ZA 1EG9B 3LZAA 5M19A 2WO0A 1YIT3 4N6OB 5CXOA 3Q3FA 4HVNA 1AR0A 4R4KA 4HM5B 3DZLA 2D1WA 3N54B 4I4KA 1GYBA 4EW5A 2W04A 1RHLA 2WGQA 3MSOA 3Q1CA 3NHXA 2W6JH 1OUNA 1BUQA 2KF3A 2W56A 3GZXB 5ELJA 3CC73 2CW9A 3AHWA 1IVWA 3FF2A 5G1KA 1K9M4 1B21A 1OF5A 1X1UA 2HMKB 1RGLA 1O7PB 1NB5I 3CD63 1ROAA 1W7CA 4J9AA 4U13A 1MWUA 3LTAA 3J7Yd 2BIRA 3SYUA 4EV2A 2KXGA 3B4PA 3SVAA 3DGLA 2HMNB 1K8A4 1K28A 1RRLA 3WODG 1VQK3 1WMNA 4HM2B 1E3RA 4HBRA 1BANA 1W01A 3G4S3 3WA2X 3NV0A 3CMA3 4NREA 3NM7A 4RNZA 3LH4A 1BRNL 5G2GA 3OWUA 1AQZA 2FNQA 4AKZA 1JB2A 2R41A 1G96A 4WFOA 3PCSA 1HYFA 1Q7HA 4QWTA 4AKYA 1CQSA 3MG1A 3MKIA 3DUKA 3I563 1YNVX 1C54A 1R4CA 1A2PA 4LMIA 3F8HA
chains in the Genus database with same CATH topology
4LZIA 3IJEB 3CCM3 1MNLA 1FGRA 1M9GA 2BMQB 3EQQB 1KQS2 3CCS3 3S5CA 4N6MA 3FG4A 3B8LA 1JV2B 3JUNA 1QJGA 2P0XA 3CC23 2MC8A 1GY6A 2WOHA 1OH0A 3SXXA 2HMLB 3F8XA 1C7HA 3CPOA 3WDGB 3EC9A 2KCDA 3G16A 2FXTA 5FW5A 4N6LA 3CCL3 1JB5A 3PCRA 2ZL8A 1LXEA 5KP3A 1SIIA 4FCJA 1MOLA 1CYVA 3B7CA 4AEQA 3Q2PA 5IERA 1SJWA 2GXFA 5EQLA 3OWSA 1OACA 2OWPA 3FG3A 1N5PA 3X42A 1FGQA 1TFOA 1QAFA 1TIJA 3EJVA 2IUKA 1OGZA 1TP6A 3Q90A 4HYZA 2YFJB 2CHCA 2R4IA 5IG0A 3F7SA 4FMAA 4XB5A 2IUJA 1N9EA 4XDVA 1YJN3 3PS8A 2RGQA 4XBXA 1LVNA 1TU5A 1K734 3X40A 1UI7A 3G6E3 1WTHA 2BMOB 2K54A 4N6NB 2KRTA 1M1K4 2F98A 1WNHA 1W5ZA 1WQLB 1IQXA 4WYKB 1VZZA 2SBLA 1JRQA 2BMRB 2O9UX 3DGMA 3ROBA 4WHAA 1E97A 3KFQC 5JPUA 3CXC2 1E3VA 1CEWI 4K61A 1JN5A 7STDA 1W6YA 2CFKA 4XDWA 3LTCA 4HJLB 4HM7B 3GZYB 5FGOA 2K0MA 5IEOA 1A2KA 2XFSA 3NBRA 3DM8A 3OV4A 2CK3H 2OTJ3 3RDEA 3LMLA 2QIYA 2W56B 4HKVB 2XSOB 1SQWA 2C11A 3FSDA 2GU1A 1IVUA 2XGNA 3M8CA 4IT7A 3NX0A 4KVHA 2BNGA 3DMCA 4O3VA 3CPW2 3GAXA 3SLUA 3TDGA 4K1VA 1O7NB 3D9RA 1PFPA 1TUHA 3STDA 1U5OA 2CG1A 1QMAA 3NV0B 5LC6A 4HM4B 3K0ZA 1O7MB 3EB8A 2WOFA 3DGNA 2D42A 2P09A 2Y74A 3X41A 1FA3A 1KSIA 1N9JA 3V99A 2CKFB 5CF2A 2ML6A 3OW22 1NB3I 4MMYB 3WMDA 4R1KA 4FMDA 3RGAA 1KD14 3NBBA 3MYTA 4IPBA 2JQ5A 2E2UA 2GU3A 3GRDA 3FKAA 3LTDA 1DVDA 2RFRA 3VF1A 2L4VA 1Q814 2OQEC 3OWYA 5JPPA 1UUWB 3O8YA 2W9PA 3CNMA 3GWRA 3DXOA 3H51A 1HU9A 3FF0A 3CCJ3 1IVXA 1GD3A 3K63A 4KFEA 3U1WA 4R9KA 1YVBI 3D3LA 3CU3A 3GZRA 4K90B 2V1LA 1W02A 2GEYA 3U97A 4Q53A 4WWUC 4O02B 3MG2A 3FGYA 2ZDJA 2MF7A 2UX0A 2JDIH 3H3HA 3G0KA 3SOAA 2P05A 3MPHA 1STDA 1N8QA 1YJ93 3F9SA 8CHOA 2CFDA 5DRVA 3NQZA 3UNLA 5STDA 4JRFA 4R80A 2YFIB 1YGEA 5AEUB 3X3XA 1IQ8A 1AVLA 2OOVC 4R9LA 1Q40A 4LGQA 4EV5A 2CFLA 1O7HB 1D6ZA 4XBTA 4RBNA 4FR9A 3T8UA 3NM2A 3HIGA 4K1UA 3UL6A 1JJ22 4NHFA 2Y73A 1SIHA 1Y4KA 5AIIA 1ASKA 1O7GB 3E99A 2E2TA 3G8ZA 3SOYA 3PXMA 2BO9B 1KWIA 4FCZA 3S27A 2PZVA 4HM8B 3CCQ3 1STFI 2W03A 3HX8A 3LT8A 1YI23 2Z6BA 1VQL3 1IQYA 1JN5B 3EBTA 4O2HA 2BHMA 3CCE3 3L0RA 1DMMA 5BVBA 4KFFA 1W2ZA 4HM0B 3N9HA 5D83A 3FLJA 4HZBB 1Q864 4HZ9B 2E2VA 4G1MB 5D81A 2IA7A 3LTBA 3LOYA 4KFDA 3CCU3 5IG4A 4CDLA 2B24B 3GZBA 3BNBA 2FGTA 4GL6A 1GY7A 3LT9A 2XRXB 5EVHA 1OGXA 5AIGA 2XF3A 3CCR3 3LYGA 3BNEA 4HM3B 3WOFB 2W9QA 3V98A 4ORLA 2RCDA 3EX9A 2CWTA 2C10A 3FG1A 3JUOA 1F8NA 2CIUA 3AMOB 2CG0A 3IPTA 2YFLB 1RRHA 3NUVA 3RGRA 3S28A 4X2HA 1OHPA 2O3OA 1UI8A 1W4NA 4LEHA 4CCVA 4LSOA 1HKXA 5KP4A 3QK9A 5TGNA 1JKGB 1RKYA 1VQ43 3A76A 1QVF2 1ROVA 1DVCA 2CH9A 2CFGA 4EYCA 1DMNA 1IV9A 1WMPA 5BXQA 3CCV3 3LXUX 4WP5A 1ISKA 4X2OA 3UB1A 3K9MC 2A15A 1VQN3 4RNYA 5KP1A 2P0MA 2CC3A 1ULIB 1FGOA 5AIFA 2F86B 3AMOA 3UJMA 1DYUA 1N5HA 1AVKA 2B1XB 1O7WB 3BNDA 1NJI4 2CFWA 1ULJB 3EBYA 1YHQ3 1JKGA 2CWUA 2XR8B 1NDOB 1GS3A 3BB9A 1U8CB 3WOEB 5IG5A 3QRDA 2QGUA 5IEPA 1IDPA 2XEPA 1K41A 3DGOA 2LQVA 1KC84 1Q40B 2Z7AA 1FUWA 3BNCA 2RSXA 1RN7A 1L5GB 1N8R4 4FCMA 3X3YA 1S5AA 2XSHB 3CNXA 5HGRA 3KIIA 3OX9A 3BLZA 2Q07A 2GEXA 3EE1A 3N8BA 4OUQA 1OCVA 1VQ83 2I9WA 1UW1A 3ECFA 4MJDA 4HM6B 3PGBA 1YIJ3 2OTL3 2XFTA 2IMJA 3PZWA 1M1XB 4N6TA 3FCSB 2PNCA 3EN8A 3OXAA 3S29A 1NU3A 1W6GA 4RZMA 1GD4A 1V74A 5IG3A 3NXJA 3VSYA 1NO3A 3KN4A 3F40A 1AV4A 1VQ53 3DY5A 4FMCA 1EKMA 4ZM8A 3JUMA 1ZO2A 3HI7A 3JUQA 3NBJA 4BTXA 4BTYA 4L8PA 5ELUA 3EHCA 2ML5A 3JUPA 1J2BA 5CF1A 2M7OA 2STDA 1EQKA 2QEX3 3K7CA 2F99A 3CC43 1LOXA 1IU7A 2XH9A 3KZTA 4EBGA 3KKGA 1D6YA 4STDA 5IW9A 1A90A 1JNQA 3T8NA 4IIAA 5A0OB 1UUVB 2W2CA 3SEDA 3PYJA 1RJOA 1D6UA 1GY5A 3F14A 4GB5A 1LNHA 1Q824 3HZPA 2OQEA 4EC6A 6STDA 1PU4A 3K5TA 3FH1A 3I0YA 1IT8A 3ER7A 5D82A 3UL5A 4XBYA 2P38A 1W2B2 1IV7A 3ALAA 1W00A 2INXA 3T0UA 1SPUA 1WMOA 1Z1SA 3B4OA 1A2VA 3VGNA 1VQM3 4H61A 4L8OA 1S723 5I97A 5DREA 1OPYA 4XM4A 3SX1A 1Q42A 1JB4A 4JF8A 1QAKA 3X3ZA 1VQO3 1QALA 2W0QA 5AYSC 2Z76A 4FMBA 1QVG2 3KE7A 1TFKA 1VQ73 1IVVA 3MHEA 3V92A 1OHOA 4N6V0 5AIHA 4H3UA 1Q7Y4 2OOVA 1DMQA 2OCTA 3S67A 4KZ1A 3EN1B 1EA2A 4N3VA 2XGLA 3KSPA 3KSED 3G713 3HIIA 2LYXA 1US1A 3MWZA 4OK0A 2GBXB 1VQ63 3CME3 1FGTA 4MMZB 5AI1A 1YJW3 1M904 2GBWB 4L7KA 2HMJB 4OVMA 1NWWA 3HK4A 2HMMB 5AYRB 3FZWA 2CWVA 4O8SA 1T5YA 3F7XA 5JBSA 3MG3A 2YX9A 4BTWA 5EEOA 3EF8A 2QA43 4HM1B 2BT3A 1ZX2A 5AEWB 1VQ93 2WGOA 2HMOB 1FGMA 1VQP3 4J8TA 1OF5B 5CK6A 3I553 1OHSA 3IMAB 4WYKA 3WA3A 5IF6A 1A67A 3NQYA 4PEJA 1IK3A 4EXRA 2Z77A 5LC7A 4MEIA 3JVCA 4TX4A 5IENA 4N6UA 5CLKA 1W6CA 1IT7A 4MMXB 1EG9B 3LZAA 2WO0A 1YIT3 4N6OB 5CXOA 4HVNA 1AR0A 4R4KA 4HM5B 3DZLA 2D1WA 3N54B 4I4KA 1GYBA 2W04A 2WGQA 3MSOA 3Q1CA 3NHXA 2W6JH 1OUNA 1BUQA 2W56A 3GZXB 5ELJA 3CC73 2CW9A 3FF2A 1IVWA 1K9M4 1OF5A 2HMKB 1O7PB 1NB5I 3CD63 1ROAA 1W7CA 4J9AA 4U13A 3LTAA 3J7Yd 4EV2A 2KXGA 3B4PA 3SVAA 3DGLA 2HMNB 1K8A4 1K28A 1RRLA 3WODG 1VQK3 1WMNA 4HM2B 1E3RA 4HBRA 1W01A 3G4S3 3WA2X 3NV0A 3CMA3 4NREA 3NM7A 4RNZA 3LH4A 5G2GA 3OWUA 2FNQA 4AKZA 1JB2A 1G96A 4WFOA 3PCSA 4QWTA 4AKYA 1CQSA 3MG1A 3MKIA 3DUKA 3I563 1R4CA 1CYUA 4LMIA 3F8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CFG A;  2OQE C;  1WMP A;  3ALA A;  3T0U A;  1SPU A;  1WMO A;  1A2V A;  1IVX A;  2WOH A;  4KFE A;  3SXX A;  3SX1 A;  3AMO A;  1DYU A;  1QAK A;  3X3Z A;  1QAL A;  2W0Q A;  1AVK A;  2ZL8 A;  1SII A;  2CFW A;  1IVV A;  2CWU A;  3MPH A;  2OOV A;  1OAC A;  2CFD A;  3NQZ A;  3X42 A;  1QAF A;  3HII A;  1US1 A;  3X3X A;  1AVL A;  2OOV C;  4EV5 A;  2CFL A;  1D6Z A;  2CWV A;  1N9E A;  3HIG A;  1LVN A;  3X3Y A;  1TU5 A;  3X40 A;  2YX9 A;  4BTW A;  1UI7 A;  3KII A;  2Y73 A;  1SIH A;  2BT3 A;  3PGB A;  2E2T A;  1W5Z A;  1IQX A;  3WA3 A;  2PNC A;  1JRQ A;  3NQY A;  4EXR A;  1W6G A;  3KN4 A;  1W6C A;  1IQY A;  1AV4 A;  2CFK A;  2WO0 A;  1EKM A;  2K0M A;  1W2Z A;  2D1W A;  3HI7 A;  3NBJ A;  3N9H A;  4BTX A;  4BTY A;  2WGQ A;  2E2V A;  2IA7 A;  3LOY A;  4KFD A;  2C11 A;  1IVW A;  1IVU A;  1IU7 A;  1W7C A;  1D6Y A;  4EV2 A;  5IW9 A;  2CWT A;  2C10 A;  1WMN A;  3AMO B;  2CG0 A;  2CG1 A;  1RJO A;  3WA2 X;  1D6U A;  2WOF A;  1UI8 A;  1W4N A;  2Y74 A;  3X41 A;  2OQE A;  1KSI A;  1PU4 A;  3K5T A;  3NBB A;  1RKY A;  4KFF A;  2E2U A;  2GU3 A; 
#chains in the Genus database with same CATH topology
 4LZI A;  1TRQ A;  2IY2 A;  3IJE B;  3CCM 3;  1GOU A;  1FGR A;  1I8V A;  1M9G A;  1B2S A;  1MNL A;  2BMQ B;  2HOH A;  3EQQ B;  4NPB A;  3DGY A;  4N6M A;  3S5C A;  3FG4 A;  3CCS 3;  3B8L A;  1JV2 B;  3JUN A;  1QJG A;  2P0X A;  3CC2 3;  2MC8 A;  1GY6 A;  1Q9E A;  2WOH A;  1OH0 A;  3AHS A;  3SXX A;  2HML B;  3F8X A;  1C7H A;  3CPO A;  2H0H A;  2F4Y A;  3WDG B;  1B3S A;  3EC9 A;  2KCD A;  3G16 A;  2FXT A;  5FW5 A;  4N6L A;  3CCL 3;  1JB5 A;  3PCR A;  2ZL8 A;  1LXE A;  5KP3 A;  1SII A;  4FCJ A;  1MOL A;  1CYV A;  3B7C A;  1JZO A;  1RGE A;  3D5G A;  3Q2P A;  4AEQ A;  5IER A;  1R4Y A;  1SJW A;  1FW7 A;  2GXF A;  5EQL A;  3OWS A;  1OAC A;  2OWP A;  3FG3 A;  1N5P A;  3X42 A;  1FGQ A;  3BIR A;  1TFO A;  1QAF A;  1TIJ A;  3EJV A;  2IUK A;  1CH0 A;  2RBI A;  1OGZ A;  2KAA A;  1TP6 A;  3Q90 A;  4HYZ A;  2YFJ B;  2CHC A;  2R4I A;  4J5K A;  5IG0 A;  1BRS A;  1BNE A;  3F7S A;  4FMA A;  4XB5 A;  2IUJ A;  1N9E A;  4XDV A;  1YJN 3;  3PS8 A;  2RGQ A;  4XBX A;  1LVN A;  1T3B A;  1TU5 A;  3X40 A;  1K73 4;  1UI7 A;  3G6E 3;  1WTH A;  1RGK A;  2BMO B;  2K54 A;  4N6N B;  2KRT A;  1M1K 4;  1LOW A;  1X1Y A;  2F98 A;  1WNH A;  1W5Z A;  1WQL B;  3AGO A;  1IQX A;  4WYK B;  1VZZ A;  2SBL A;  1JRQ A;  2BMR B;  2O9U X;  3DGM A;  3ROB A;  4WHA A;  1E97 A;  3KFQ C;  5JPU A;  3CXC 2;  1HZ1 A;  1E3V A;  1RGC A;  1CEW I;  1LQG C;  4K61 A;  1JN5 A;  7STD A;  1W6Y A;  2CFK A;  4XDW A;  2CX0 A;  3LTC A;  4HJL B;  1RMS A;  4HM7 B;  3GZY B;  1RN4 A;  1ZGX A;  1BUJ A;  5FGO A;  2K0M A;  5IEO A;  1A2K A;  2XFS A;  3NBR A;  3DM8 A;  3OV4 A;  2CK3 H;  1CYU A;  2OTJ 3;  3RDE A;  1T2H A;  3LML A;  2QIY A;  2W56 B;  4HKV B;  2XSO B;  1SQW A;  2C11 A;  4LYL B;  3FSD A;  2GU1 A;  4GHO A;  1IVU A;  2XGN A;  3M8C A;  4IT7 A;  3NX0 A;  4KVH A;  2BNG A;  3D79 A;  5HOH A;  3DMC A;  1BNR A;  4O3V A;  5GSP A;  3CPW 2;  1TRP A;  1YGW A;  3GAX A;  3SLU A;  3TDG A;  4K1V A;  1O7N B;  3D9R A;  7GSP A;  3D4A A;  1PFP A;  1TUH A;  3STD A;  4BL2 A;  1RDS A;  1U5O A;  3KCH A;  2CG1 A;  1QMA A;  3NV0 B;  5LC6 A;  4HM4 B;  3K0Z A;  1O7M B;  1B2M A;  3EB8 A;  2WOF A;  4ILF A;  3DGN A;  2D42 A;  1T2I A;  2P09 A;  2Y74 A;  3X41 A;  1FA3 A;  1KSI A;  1N9J A;  3V99 A;  2CKF B;  5CF2 A;  1BSC A;  2ML6 A;  3ZG5 A;  3OW2 2;  1NB3 I;  1BRH A;  4MMY B;  3WMD A;  4R1K A;  4FMD A;  3RGA A;  1KD1 4;  3NBB A;  3MYT A;  4IPB A;  8RNT A;  2JQ5 A;  2E2U A;  2GU3 A;  1BSB A;  3FKA A;  3GRD A;  3LTD A;  2RFR A;  1DVD A;  3VF1 A;  1BNJ A;  2L4V A;  1Q81 4;  2OQE C;  3OWY A;  5JPP A;  1UUW B;  3O8Y A;  2W9P A;  3CNM A;  3GWR A;  3DXO A;  3RNT A;  3H51 A;  1BAO A;  1HU9 A;  3FF0 A;  3CCJ 3;  4HAA A;  1I0V A;  1IVX A;  1GD3 A;  3K63 A;  4KFE A;  3BU4 A;  7RNT A;  3U1W A;  4R9K A;  1YVB I;  1X1W A;  3D3L A;  3CU3 A;  3GZR A;  4K90 B;  2V1L A;  1W02 A;  2GEY A;  3D5I A;  3U97 A;  4Q53 A;  4WWU C;  1UDI I;  4O02 B;  1BNS A;  1RLS A;  3MG2 A;  3FGY A;  2ZDJ A;  2MF7 A;  1I70 A;  2UX0 A;  1JBR A;  2JDI H;  3H3H A;  3G0K A;  3SOA A;  2P05 A;  3MPH A;  1STD A;  1N8Q A;  2L1S A;  1YJ9 3;  1BRJ A;  3F9S A;  8CHO A;  2BU4 A;  2CFD A;  5DRV A;  3NQZ A;  3UNL A;  5STD A;  4JRF A;  1TJD A;  4R80 A;  2YFI B;  1YGE A;  1DE3 A;  5AEU B;  1JBT A;  3X3X A;  1FZU A;  1IQ8 A;  1AVL A;  2OOV C;  4R9L A;  1Q40 A;  4LGQ A;  4EV5 A;  2CFL A;  1O7H B;  1D6Z A;  1I0X A;  4XBT A;  1B27 A;  4RBN A;  4FR9 A;  3T8U A;  1KQS 2;  3NM2 A;  1LQM B;  1LRA A;  3HIG A;  1UUG B;  4K1U A;  3UL6 A;  1G02 A;  1JJ2 2;  1UCJ A;  1LOV A;  4NHF A;  2Y73 A;  1SIH A;  1Y4K A;  5M18 A;  1BU4 A;  5AII A;  1ASK A;  1BSD A;  1JBS A;  1O7G B;  3E99 A;  2E2T A;  3G8Z A;  3SOY A;  2F56 A;  3PXM A;  1FUS A;  2BO9 B;  1KWI A;  4FCZ A;  3S27 A;  2PZV A;  6GSP A;  4HM8 B;  3CCQ 3;  1STF I;  2W03 A;  4BL3 A;  2RNT A;  3HX8 A;  3LT8 A;  1YI2 3;  2Z6B A;  1BNI A;  1IQY A;  1JN5 B;  1BOX A;  1PYL A;  2BHM A;  3EBT A;  4O2H A;  1VQL 3;  3CCE 3;  1BVI A;  3L0R A;  1BSA A;  1DMM A;  5BVB A;  4KFF A;  1DET A;  1W2Z A;  4HM0 B;  3N9H A;  5D83 A;  3FLJ A;  4HZB B;  3ZFZ A;  2AAE A;  1Q86 4;  4HZ9 B;  2E2V A;  4G1M B;  5D81 A;  2IA7 A;  3LTB A;  3LOY A;  4KFD A;  3CCU 3;  1LOY A;  5IG4 A;  4CDL A;  2B24 B;  3GZB A;  3BNB A;  2FGT A;  4GL6 A;  1GY7 A;  3LT9 A;  2XRX B;  5EVH A;  1OGX A;  1RCL A;  5AIG A;  2XF3 A;  3CCR 3;  3LYG A;  3BNE A;  4HM3 B;  3WOF B;  2W9Q A;  3V98 A;  9RNT A;  4ORL A;  2RCD A;  3EX9 A;  3AGN A;  2CWT A;  2C10 A;  4J5G A;  3FG1 A;  3JUO A;  1F8N A;  2CIU A;  3AMO B;  2CG0 A;  3IPT A;  2YFL B;  5BU4 A;  1RRH A;  1I2F A;  3NUV A;  3RGR A;  3S28 A;  1G0T A;  4X2H A;  1OHP A;  2O3O A;  1UI8 A;  1RCK A;  1W4N A;  4LEH A;  4CCV A;  4LSO A;  1GSP A;  1HKX A;  5KP4 A;  3QK9 A;  5TGN A;  1GMP A;  1JKG B;  4KT3 B;  1RKY A;  1VQ4 3;  3A76 A;  1QVF 2;  1ROV A;  1DVC A;  2CH9 A;  2CFG A;  2F5W A;  4EYC A;  1YVS A;  1DMN A;  1IV9 A;  1WMP A;  4BIR A;  5BXQ A;  3LXU X;  3WR2 A;  3CCV 3;  4WP5 A;  2C4B A;  1ISK A;  4X2O A;  3UB1 A;  3K9M C;  2A15 A;  1SAR A;  1VQN 3;  1LNI A;  4RNY A;  5KP1 A;  1UGH I;  2P0M A;  1JZD A;  2CC3 A;  1ULI B;  1FGO A;  5AIF A;  2F86 B;  3AMO A;  5RNT A;  4HOH A;  3UJM A;  1DYU A;  1N5H A;  2F5M A;  1AVK A;  1BRI A;  2B1X B;  1O7W B;  2ZA4 A;  3BND A;  2AAD A;  6RNT A;  1NJI 4;  2CFW A;  1BSE A;  1ULJ B;  5M1A A;  3EBY A;  1YHQ 3;  1JKG A;  2CWU A;  1B2U A;  2XR8 B;  1RGH A;  1NDO B;  1FYS A;  1GOV A;  1GS3 A;  1RGF A;  3BB9 A;  1U8C B;  3WOE B;  5IG5 A;  3QRD A;  2QGU A;  5IEP A;  1IDP A;  2XEP A;  1K41 A;  3DGO A;  2LQV A;  1KC8 4;  1RGG A;  1GMQ A;  1Q40 B;  2Z7A A;  1FUT A;  3BNC A;  2RSX A;  1FUW A;  1RNB A;  1RN7 A;  1UCI A;  2SAR A;  1L5G B;  1N8R 4;  2KF4 A;  4FCM A;  1V58 A;  3X3Y A;  1S5A A;  2XSH B;  3CNX A;  5HGR A;  3KII A;  3OX9 A;  3BLZ A;  2Q07 A;  2GEX A;  3EE1 A;  3N8B A;  4OUQ A;  1OCV A;  1UCL A;  2I9W A;  1VQ8 3;  1MWR A;  1UW1 A;  1EEJ A;  3ECF A;  4MJD A;  2K3D A;  4HM6 B;  1I2E A;  1V57 A;  3PGB A;  1YIJ 3;  2XFT A;  2OTL 3;  2GSP A;  1MGR A;  2IMJ A;  3PZW A;  1M1X B;  1RN1 A;  3FCS B;  2PNC A;  3EN8 A;  4N6T A;  1GOY A;  3OXA A;  3S29 A;  1NU3 A;  1W6G A;  4RZM A;  1GD4 A;  3ZG0 A;  1V74 A;  5IG3 A;  3NXJ A;  3VSY A;  1NO3 A;  3KN4 A;  3F40 A;  1AV4 A;  1VQ5 3;  3DY5 A;  1AY7 A;  4FMC A;  1EKM A;  4ZM8 A;  3JUM A;  1ZO2 A;  3HI7 A;  3JUQ A;  3NBJ A;  4BTX A;  4BTY A;  4L8P A;  5ELU A;  3EHC A;  2ML5 A;  4GSP A;  3JUP A;  1J2B A;  1RGA A;  1TTO A;  2M7O A;  2STD A;  5CF1 A;  2QEX 3;  1EQK A;  3K7C A;  2F99 A;  3CC4 3;  1LOX A;  1IU7 A;  2XH9 A;  3KZT A;  4EBG A;  3KKG A;  1D6Y A;  4STD A;  4RNT A;  5IW9 A;  1A90 A;  1JNQ A;  3T8N A;  4IIA A;  5A0O B;  1UUV B;  2W2C A;  3SED A;  3PYJ A;  2UUG C;  1GMR A;  1RJO A;  1D6U A;  1GY5 A;  1I3I A;  3F14 A;  4GB5 A;  1LNH A;  1Q82 4;  3HZP A;  2OQE A;  1PY3 A;  2H0G A;  4EC6 A;  6STD A;  1PU4 A;  1NNV A;  1BRK A;  3K5T A;  3FH1 A;  3I0Y A;  4I5Q A;  1BIR A;  1IT8 A;  3ER7 A;  5D82 A;  3UL5 A;  4XBY A;  1B20 A;  1BRG A;  2P38 A;  1W2B 2;  3WHO A;  2J8X B;  1BNG A;  1I2G A;  1IV7 A;  3ALA A;  1W00 A;  2INX A;  3T0U A;  1SPU A;  1BNF A;  1WMO A;  1Z1S A;  3B4O A;  1A2V A;  3VGN A;  1VQM 3;  1UCK A;  4H61 A;  4L8O A;  1S72 3;  5I97 A;  5DRE A;  1UGI A;  1OPY A;  2KF5 A;  4XM4 A;  1RTU A;  3SX1 A;  1I3F A;  1Q42 A;  4CJN A;  1JB4 A;  4JF8 A;  1QAK A;  3X3Z A;  1VQO 3;  1QAL A;  2W0Q A;  3URP A;  5AYS C;  5BIR A;  2Z76 A;  4FMB A;  1QVG 2;  3KE7 A;  1TFK A;  1MWS A;  1EUI C;  1VQ7 3;  2KF6 A;  1IVV A;  3A5E A;  3MHE A;  3V92 A;  1OHO A;  4N6V 0;  4DKI A;  5AIH A;  4H3U A;  4CPK A;  1Q7Y 4;  2OOV A;  1DMQ A;  2OCT A;  1MWT A;  1VQQ A;  3S67 A;  4KZ1 A;  2ZHX B;  3EN1 B;  3GSP A;  1EA2 A;  4N3V A;  2XGL A;  3KSP A;  3KSE D;  2H0I A;  3G71 3;  3HII A;  2LYX A;  1US1 A;  3MWZ A;  4OK0 A;  2GBX B;  1VQ6 3;  3CME 3;  1FGT A;  4MMZ B;  5AI1 A;  1YJW 3;  5G1L A;  1BGS A;  2GBW B;  4L7K A;  1M90 4;  2HMJ B;  4OVM A;  1NWW A;  3HK4 A;  2HMM B;  5AYR B;  3FZW A;  2CWV A;  1RSN A;  4O8S A;  1IYY A;  2CX1 A;  1T5Y A;  3F7X A;  5JBS A;  3DH2 A;  3MG3 A;  2YX9 A;  4BTW A;  1B2X A;  5EEO A;  2UGI A;  3EF8 A;  4BU4 A;  2QA4 3;  4HM1 B;  2BT3 A;  1MGW A;  1ZX2 A;  1X1X A;  5AEW B;  1VQ9 3;  2WGO A;  2HMO B;  1FGM A;  2IYJ A;  1VQP 3;  4J8T A;  1OF5 B;  5CK6 A;  3I55 3;  1OHS A;  1RNT A;  3IMA B;  4WYK A;  3WA3 A;  5IF6 A;  1A67 A;  3NQY A;  4PEJ A;  1IK3 A;  1ZS7 A;  2Z77 A;  5LC7 A;  4EXR A;  4MEI A;  3JVC A;  4TX4 A;  5IEN A;  4N6U A;  5CLK A;  3HOH A;  1W6C A;  1IT7 A;  4MMX B;  1B2Z A;  1EG9 B;  3LZA A;  5M19 A;  2WO0 A;  1YIT 3;  4N6O B;  5CXO A;  3Q3F A;  4HVN A;  1AR0 A;  4R4K A;  4HM5 B;  3DZL A;  2D1W A;  3N54 B;  4I4K A;  1GYB A;  4EW5 A;  2W04 A;  1RHL A;  2WGQ A;  3MSO A;  3Q1C A;  3NHX A;  2W6J H;  1OUN A;  1BUQ A;  2KF3 A;  2W56 A;  3GZX B;  5ELJ A;  3CC7 3;  2CW9 A;  3AHW A;  1IVW A;  3FF2 A;  5G1K A;  1K9M 4;  1B21 A;  1OF5 A;  1X1U A;  2HMK B;  1RGL A;  1O7P B;  1NB5 I;  3CD6 3;  1ROA A;  1W7C A;  4J9A A;  4U13 A;  1MWU A;  3LTA A;  3J7Y d;  2BIR A;  3SYU A;  4EV2 A;  2KXG A;  3B4P A;  3SVA A;  3DGL A;  2HMN B;  1K8A 4;  1K28 A;  1RRL A;  3WOD G;  1VQK 3;  1WMN A;  4HM2 B;  1E3R A;  4HBR A;  1BAN A;  1W01 A;  3G4S 3;  3WA2 X;  3NV0 A;  3CMA 3;  4NRE A;  3NM7 A;  4RNZ A;  3LH4 A;  1BRN L;  5G2G A;  3OWU A;  1AQZ A;  2FNQ A;  4AKZ A;  1JB2 A;  2R41 A;  1G96 A;  4WFO A;  3PCS A;  1HYF A;  1Q7H A;  4QWT A;  4AKY A;  1CQS A;  3MG1 A;  3MKI A;  3DUK A;  3I56 3;  1YNV X;  1C54 A;  1R4C A;  1A2P A;  4LMI A;  3F8H A; 
#chains in the Genus database with same CATH homology
 4LZI A;  3IJE B;  3CCM 3;  1MNL A;  1FGR A;  1M9G A;  2BMQ B;  3EQQ B;  1KQS 2;  3CCS 3;  3S5C A;  4N6M A;  3FG4 A;  3B8L A;  1JV2 B;  3JUN A;  1QJG A;  2P0X A;  3CC2 3;  2MC8 A;  1GY6 A;  2WOH A;  1OH0 A;  3SXX A;  2HML B;  3F8X A;  1C7H A;  3CPO A;  3WDG B;  3EC9 A;  2KCD A;  3G16 A;  2FXT A;  5FW5 A;  4N6L A;  3CCL 3;  1JB5 A;  3PCR A;  2ZL8 A;  1LXE A;  5KP3 A;  1SII A;  4FCJ A;  1MOL A;  1CYV A;  3B7C A;  4AEQ A;  3Q2P A;  5IER A;  1SJW A;  2GXF A;  5EQL A;  3OWS A;  1OAC A;  2OWP A;  3FG3 A;  1N5P A;  3X42 A;  1FGQ A;  1TFO A;  1QAF A;  1TIJ A;  3EJV A;  2IUK A;  1OGZ A;  1TP6 A;  3Q90 A;  4HYZ A;  2YFJ B;  2CHC A;  2R4I A;  5IG0 A;  3F7S A;  4FMA A;  4XB5 A;  2IUJ A;  1N9E A;  4XDV A;  1YJN 3;  3PS8 A;  2RGQ A;  4XBX A;  1LVN A;  1TU5 A;  1K73 4;  3X40 A;  1UI7 A;  3G6E 3;  1WTH A;  2BMO B;  2K54 A;  4N6N B;  2KRT A;  1M1K 4;  2F98 A;  1WNH A;  1W5Z A;  1WQL B;  1IQX A;  4WYK B;  1VZZ A;  2SBL A;  1JRQ A;  2BMR B;  2O9U X;  3DGM A;  3ROB A;  4WHA A;  1E97 A;  3KFQ C;  5JPU A;  3CXC 2;  1E3V A;  1CEW I;  4K61 A;  1JN5 A;  7STD A;  1W6Y A;  2CFK A;  4XDW A;  3LTC A;  4HJL B;  4HM7 B;  3GZY B;  5FGO A;  2K0M A;  5IEO A;  1A2K A;  2XFS A;  3NBR A;  3DM8 A;  3OV4 A;  2CK3 H;  2OTJ 3;  3RDE A;  3LML A;  2QIY A;  2W56 B;  4HKV B;  2XSO B;  1SQW A;  2C11 A;  3FSD A;  2GU1 A;  1IVU A;  2XGN A;  3M8C A;  4IT7 A;  3NX0 A;  4KVH A;  2BNG A;  3DMC A;  4O3V A;  3CPW 2;  3GAX A;  3SLU A;  3TDG A;  4K1V A;  1O7N B;  3D9R A;  1PFP A;  1TUH A;  3STD A;  1U5O A;  2CG1 A;  1QMA A;  3NV0 B;  5LC6 A;  4HM4 B;  3K0Z A;  1O7M B;  3EB8 A;  2WOF A;  3DGN A;  2D42 A;  2P09 A;  2Y74 A;  3X41 A;  1FA3 A;  1KSI A;  1N9J A;  3V99 A;  2CKF B;  5CF2 A;  2ML6 A;  3OW2 2;  1NB3 I;  4MMY B;  3WMD A;  4R1K A;  4FMD A;  3RGA A;  1KD1 4;  3NBB A;  3MYT A;  4IPB A;  2JQ5 A;  2E2U A;  2GU3 A;  3GRD A;  3FKA A;  3LTD A;  1DVD A;  2RFR A;  3VF1 A;  2L4V A;  1Q81 4;  2OQE C;  3OWY A;  5JPP A;  1UUW B;  3O8Y A;  2W9P A;  3CNM A;  3GWR A;  3DXO A;  3H51 A;  1HU9 A;  3FF0 A;  3CCJ 3;  1IVX A;  1GD3 A;  3K63 A;  4KFE A;  3U1W A;  4R9K A;  1YVB I;  3D3L A;  3CU3 A;  3GZR A;  4K90 B;  2V1L A;  1W02 A;  2GEY A;  3U97 A;  4Q53 A;  4WWU C;  4O02 B;  3MG2 A;  3FGY A;  2ZDJ A;  2MF7 A;  2UX0 A;  2JDI H;  3H3H A;  3G0K A;  3SOA A;  2P05 A;  3MPH A;  1STD A;  1N8Q A;  1YJ9 3;  3F9S A;  8CHO A;  2CFD A;  5DRV A;  3NQZ A;  3UNL A;  5STD A;  4JRF A;  4R80 A;  2YFI B;  1YGE A;  5AEU B;  3X3X A;  1IQ8 A;  1AVL A;  2OOV C;  4R9L A;  1Q40 A;  4LGQ A;  4EV5 A;  2CFL A;  1O7H B;  1D6Z A;  4XBT A;  4RBN A;  4FR9 A;  3T8U A;  3NM2 A;  3HIG A;  4K1U A;  3UL6 A;  1JJ2 2;  4NHF A;  2Y73 A;  1SIH A;  1Y4K A;  5AII A;  1ASK A;  1O7G B;  3E99 A;  2E2T A;  3G8Z A;  3SOY A;  3PXM A;  2BO9 B;  1KWI A;  4FCZ A;  3S27 A;  2PZV A;  4HM8 B;  3CCQ 3;  1STF I;  2W03 A;  3HX8 A;  3LT8 A;  1YI2 3;  2Z6B A;  1VQL 3;  1IQY A;  1JN5 B;  3EBT A;  4O2H A;  2BHM A;  3CCE 3;  3L0R A;  1DMM A;  5BVB A;  4KFF A;  1W2Z A;  4HM0 B;  3N9H A;  5D83 A;  3FLJ A;  4HZB B;  1Q86 4;  4HZ9 B;  2E2V A;  4G1M B;  5D81 A;  2IA7 A;  3LTB A;  3LOY A;  4KFD A;  3CCU 3;  5IG4 A;  4CDL A;  2B24 B;  3GZB A;  3BNB A;  2FGT A;  4GL6 A;  1GY7 A;  3LT9 A;  2XRX B;  5EVH A;  1OGX A;  5AIG A;  2XF3 A;  3CCR 3;  3LYG A;  3BNE A;  4HM3 B;  3WOF B;  2W9Q A;  3V98 A;  4ORL A;  2RCD A;  3EX9 A;  2CWT A;  2C10 A;  3FG1 A;  3JUO A;  1F8N A;  2CIU A;  3AMO B;  2CG0 A;  3IPT A;  2YFL B;  1RRH A;  3NUV A;  3RGR A;  3S28 A;  4X2H A;  1OHP A;  2O3O A;  1UI8 A;  1W4N A;  4LEH A;  4CCV A;  4LSO A;  1HKX A;  5KP4 A;  3QK9 A;  5TGN A;  1JKG B;  1RKY A;  1VQ4 3;  3A76 A;  1QVF 2;  1ROV A;  1DVC A;  2CH9 A;  2CFG A;  4EYC A;  1DMN A;  1IV9 A;  1WMP A;  5BXQ A;  3CCV 3;  3LXU X;  4WP5 A;  1ISK A;  4X2O A;  3UB1 A;  3K9M C;  2A15 A;  1VQN 3;  4RNY A;  5KP1 A;  2P0M A;  2CC3 A;  1ULI B;  1FGO A;  5AIF A;  2F86 B;  3AMO A;  3UJM A;  1DYU A;  1N5H A;  1AVK A;  2B1X B;  1O7W B;  3BND A;  1NJI 4;  2CFW A;  1ULJ B;  3EBY A;  1YHQ 3;  1JKG A;  2CWU A;  2XR8 B;  1NDO B;  1GS3 A;  3BB9 A;  1U8C B;  3WOE B;  5IG5 A;  3QRD A;  2QGU A;  5IEP A;  1IDP A;  2XEP A;  1K41 A;  3DGO A;  2LQV A;  1KC8 4;  1Q40 B;  2Z7A A;  1FUW A;  3BNC A;  2RSX A;  1RN7 A;  1L5G B;  1N8R 4;  4FCM A;  3X3Y A;  1S5A A;  2XSH B;  3CNX A;  5HGR A;  3KII A;  3OX9 A;  3BLZ A;  2Q07 A;  2GEX A;  3EE1 A;  3N8B A;  4OUQ A;  1OCV A;  1VQ8 3;  2I9W A;  1UW1 A;  3ECF A;  4MJD A;  4HM6 B;  3PGB A;  1YIJ 3;  2OTL 3;  2XFT A;  2IMJ A;  3PZW A;  1M1X B;  4N6T A;  3FCS B;  2PNC A;  3EN8 A;  3OXA A;  3S29 A;  1NU3 A;  1W6G A;  4RZM A;  1GD4 A;  1V74 A;  5IG3 A;  3NXJ A;  3VSY A;  1NO3 A;  3KN4 A;  3F40 A;  1AV4 A;  1VQ5 3;  3DY5 A;  4FMC A;  1EKM A;  4ZM8 A;  3JUM A;  1ZO2 A;  3HI7 A;  3JUQ A;  3NBJ A;  4BTX A;  4BTY A;  4L8P A;  5ELU A;  3EHC A;  2ML5 A;  3JUP A;  1J2B A;  5CF1 A;  2M7O A;  2STD A;  1EQK A;  2QEX 3;  3K7C A;  2F99 A;  3CC4 3;  1LOX A;  1IU7 A;  2XH9 A;  3KZT A;  4EBG A;  3KKG A;  1D6Y A;  4STD A;  5IW9 A;  1A90 A;  1JNQ A;  3T8N A;  4IIA A;  5A0O B;  1UUV B;  2W2C A;  3SED A;  3PYJ A;  1RJO A;  1D6U A;  1GY5 A;  3F14 A;  4GB5 A;  1LNH A;  1Q82 4;  3HZP A;  2OQE A;  4EC6 A;  6STD A;  1PU4 A;  3K5T A;  3FH1 A;  3I0Y A;  1IT8 A;  3ER7 A;  5D82 A;  3UL5 A;  4XBY A;  2P38 A;  1W2B 2;  1IV7 A;  3ALA A;  1W00 A;  2INX A;  3T0U A;  1SPU A;  1WMO A;  1Z1S A;  3B4O A;  1A2V A;  3VGN A;  1VQM 3;  4H61 A;  4L8O A;  1S72 3;  5I97 A;  5DRE A;  1OPY A;  4XM4 A;  3SX1 A;  1Q42 A;  1JB4 A;  4JF8 A;  1QAK A;  3X3Z A;  1VQO 3;  1QAL A;  2W0Q A;  5AYS C;  2Z76 A;  4FMB A;  1QVG 2;  3KE7 A;  1TFK A;  1VQ7 3;  1IVV A;  3MHE A;  3V92 A;  1OHO A;  4N6V 0;  5AIH A;  4H3U A;  1Q7Y 4;  2OOV A;  1DMQ A;  2OCT A;  3S67 A;  4KZ1 A;  3EN1 B;  1EA2 A;  4N3V A;  2XGL A;  3KSP A;  3KSE D;  3G71 3;  3HII A;  2LYX A;  1US1 A;  3MWZ A;  4OK0 A;  2GBX B;  1VQ6 3;  3CME 3;  1FGT A;  4MMZ B;  5AI1 A;  1YJW 3;  1M90 4;  2GBW B;  4L7K A;  2HMJ B;  4OVM A;  1NWW A;  3HK4 A;  2HMM B;  5AYR B;  3FZW A;  2CWV A;  4O8S A;  1T5Y A;  3F7X A;  5JBS A;  3MG3 A;  2YX9 A;  4BTW A;  5EEO A;  3EF8 A;  2QA4 3;  4HM1 B;  2BT3 A;  1ZX2 A;  5AEW B;  1VQ9 3;  2WGO A;  2HMO B;  1FGM A;  1VQP 3;  4J8T A;  1OF5 B;  5CK6 A;  3I55 3;  1OHS A;  3IMA B;  4WYK A;  3WA3 A;  5IF6 A;  1A67 A;  3NQY A;  4PEJ A;  1IK3 A;  4EXR A;  2Z77 A;  5LC7 A;  4MEI A;  3JVC A;  4TX4 A;  5IEN A;  4N6U A;  5CLK A;  1W6C A;  1IT7 A;  4MMX B;  1EG9 B;  3LZA A;  2WO0 A;  1YIT 3;  4N6O B;  5CXO A;  4HVN A;  1AR0 A;  4R4K A;  4HM5 B;  3DZL A;  2D1W A;  3N54 B;  4I4K A;  1GYB A;  2W04 A;  2WGQ A;  3MSO A;  3Q1C A;  3NHX A;  2W6J H;  1OUN A;  1BUQ A;  2W56 A;  3GZX B;  5ELJ A;  3CC7 3;  2CW9 A;  3FF2 A;  1IVW A;  1K9M 4;  1OF5 A;  2HMK B;  1O7P B;  1NB5 I;  3CD6 3;  1ROA A;  1W7C A;  4J9A A;  4U13 A;  3LTA A;  3J7Y d;  4EV2 A;  2KXG A;  3B4P A;  3SVA A;  3DGL A;  2HMN B;  1K8A 4;  1K28 A;  1RRL A;  3WOD G;  1VQK 3;  1WMN A;  4HM2 B;  1E3R A;  4HBR A;  1W01 A;  3G4S 3;  3WA2 X;  3NV0 A;  3CMA 3;  4NRE A;  3NM7 A;  4RNZ A;  3LH4 A;  5G2G A;  3OWU A;  2FNQ A;  4AKZ A;  1JB2 A;  1G96 A;  4WFO A;  3PCS A;  4QWT A;  4AKY A;  1CQS A;  3MG1 A;  3MKI A;  3DUK A;  3I56 3;  1R4C A;  1CYU A;  4LMI A;  3F8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...