4EZPA

Crystal structure of the substrate binding domain of e.coli dnak in complex with a3-apo(residues 1 to 20)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
total genus 59
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezpA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezpA01
4JWEA 4H6HA 1Q5LA 3N8EA 3DPPA 4R5LA 3L3OM 4R5IA 2OP6A 1YUWA 7HSCA 2QXLA 4H6IA 2KHOA 3DPOA 4R5KA 4R5GA 4EZOA 3T4AG 4EZUA 4PO2A 2QFFA 1DKXA 4E81A 2V7YA 5E84A 4R5JA 4JN4A 4JNFA 4EZVA 4EZPA 4EZRA 4EZSA 1CKRA 1U00A 3T49A 4HYBA 3OHXM 3DPQA 3C7NA 4EZNA 3T47A 4EZXA 1DKZA 3D2EA 4HY9A 5TKYA 3T46A 3T48A 2BPRA 4JWCA 3C7NB 3QNJA 4EZWA 4EZQA 4WV5A 1DG4A 3D2FA 3H0XA 1BPRA 4EZZA 2WINM 4JNEA 4FL9A 3DQGA 4F00A 4EZTA 4JWDA 4B9QA 3DOBA 4WV7A 4EZYA 1DKYA 4JWIA 4F01A
chains in the Genus database with same CATH superfamily
3VEAA 1YUWA 1SU8A 2C08A 1WDZA 3DPOA 1Y2OA 3DX1A 4EZOA 2ND0A 3QNIA 3HAJA 3HAIA 2EX3B 4WPEA 1UPXA 3SYVA 3CZNA 4EZSA 5TKYA 4FM3A 3BLBA 3DQGA 1GN9A 3ERCC 2YIVX 4KIKA 3I01A 3KDRA 4KIKB 7HSCA 4UDXX 2O0I1 4R5GA 2YL9A 3KAVA 2D1LA 4UDYX 1U00A 2YL6A 3HAHA 3BUPA 3DOBA 2Q13A 4JWIA 1E9VA 4NPHA 1X04A 3BVWA 2RAJA 3SBSA 3EJSA 3A98A 2JNSA 4EZXA 1I4TA 2EFKA 4DCNC 3ER8C 4I1QA 3DX2A 2YL5A 3EJUA 3M3WA 2F7RA 1O7DC 4HR1B 1I4DA 4H8SA 3RV0A 3Q0KA 3BUBA 3O3OB 1HWWA 3ZEFA 1JQKA 3T49A 1ZWWA 3OHXM 2LXYA 2Z0OA 4JWCA 4WV5A 1DG4A 2PMRA 4IW0A 2GA9D 2WINM 4I43A 1OAOA 1GNTA 5KBPA 2F1BA 2N3KA 3EJPA 3DX3A 2Z0NA 4AZCA 2YI9A 3B51X 2YIAA 2V7YA 2OW7A 5E84A 4BNEA 3D4ZA 1R34A 2Z8YA 2MI7A 3T48A 3QNJA 1BPRA 2OBLA 2Z0VA 1YWMA 2F7PA 1GNLA 2YLLA 4H6HA 3L3PA 1HTYA 4D8JA 3L3OM 3SBTB 4E3CA 1OA1A 3FD9A 4ILHB 4AZ6A 2V0OA 4AZGA 3DDGA 2BPRA 4WPCA 4F00A 3ZEDA 3EJTA 4AKVA 2KHOA 3T4AG 4EZUA 3O3NB 3CZSA 4R5JA 4JNFA 3BUQA 2JNKA 1SU7A 3DPQA 3T46A 1QWNA 3VEBA 1URUA 3D52A 2QKWA 2YI8A 3BVUA 1TQVA 2ZXQA 3OWGA 3Q84A 3BUIA 4AZ5A 1DKYA 3QE6A 2OO2A 3DPPA 3LMFA 1ZYLA 4EZPA 4JN4A 2D4CA 3BUDA 4EZRA 1E2UA 3DX4A 4IWPA 3T47A 2WYIA 2OW6A 1R5EA 1PS3A 4FZOA 1TQWA 4JWDA 3I39X 1QWUA 4FZSA 4H6IA 3EJRA 4AZ7A 4NSWA 3RPMA 3D4YA 2GF4A 3G9GA 1MJGA 5FLEX 1QX1A 3I04A 4NQIA 3H0XA 3CVRA 3VKHA 3N8EA 1O7DB 4R5KA 2FYVA 3ER9B 3CAZA 1DKXA 1TQSA 4AZCB 2F1AA 1I4LA 4G6QA 1SU6A 4IWOA 4DYLA 4JL9A 4B9QA 4MQDA 4JWEA 2PY6A 2ALWA 2QXLA 2OBMA 3ACOA 3PLTA 4PO2A 4IM2A 3DDFA 3CV5A 4EZVA 4HYBA 3DYTA 3D2EA 1TQTA 2LM0A 4EZTA 2GAFD 4FZPA 4R5LA 4AZBA 3F7WA 3B52X 1HXKA 2X5CA 2EFLA 5FIGA 4EZWA 4FL9A 3DX0A 4WV7A 4ILGA 1Q5LA 4IWQA 2OP6A 1SUFA 4E81A 4AZHA 2OZNB 2X3XA 2YIBA 3ABHA 3D51A 4AZIA 3LLLA 1CKRA 2EWFA 3UITA 2X3WA 2RT6A 4EZZA 4JNEA 3EJQA 2RAKA 2X3VA 4F01A 4R5IA 1LQ7A 5C5BA 2QFFA 5C5BB 4ILIA 3SOGA 4EZQA 1DKZA 4HY9A 4HR1A 3BVTA 2FICA 4ATMA 2YL8A 1R33A 1I49A 1E1DA 2NCZA 3CKDA 3RV1A 4M0MA 1X03A 3B53X 3O3MB 2ND1A 3OK8A 4IM3A 2RAIA 2Q12A 2F7QA 3D2FA 4EZYA 3LVTA 2YKTA 3BVVA 2F7OA 3D50A 3I2WA 4AVMA 3QA8A 2ELBA 1TQUA 4IM0A 1W9MA 3QWEA 3C7NA 4EZNA 3GI7A 3KAWA 3C7NB 1OA0A 4JLCA 3BVXA 2YLAA 2F18A 2WYHA
chains in the Genus database with same CATH topology
1Q5LA 3VEAA 4IWQA 2OP6A 1YUWA 4H6IA 1SU8A 3DPOA 1SUFA 2YI9A 4EZOA 3B51X 2ND0A 4E81A 2YIAA 2V7YA 5E84A 2YIBA 2EX3B 1UPXA 4EZSA 1CKRA 2EWFA 3UITA 5TKYA 1MJGA 2Z8YA 3T48A 5FLEX 2RT6A 3QNJA 3I04A 4FM3A 3H0XA 1BPRA 4EZZA 4JNEA 3DQGA 2OBLA 1GN9A 3ERCC 2YIVX 4KIKA 1GNLA 4F01A 3I01A 4H6HA 4D8JA 3VKHA 4R5IA 3L3OM 3N8EA 3SBTB 3KDRA 4KIKB 7HSCA 4UDXX 4E3CA 4R5KA 3ER9B 4R5GA 2QFFA 1DKXA 1OA1A 3KAVA 4ILIA 3FD9A 4UDYX 4ILHB 1U00A 4EZQA 1DKZA 4HY9A 4G6QA 2BPRA 4HR1A 1SU6A 4IWOA 4F00A 3ZEDA 4JL9A 1E1DA 4B9QA 3DOBA 4MQDA 4JWIA 4JWEA 2NCZA 1E9VA 4NPHA 2PY6A 3RV1A 2QXLA 2OBMA 2KHOA 4M0MA 3B53X 3O3MB 3T4AG 4EZUA 4PO2A 3O3NB 4IM2A 2ND1A 4R5JA 4EZVA 4JNFA 3SBSA 3A98A 2JNSA 4IM3A 1SU7A 4HYBA 3DPQA 4EZXA 3D2EA 3T46A 3ER8C 3VEBA 2YI8A 3D2FA 3OWGA 2LM0A 4HR1B 4EZTA 4EZYA 2GAFD 1DKYA 3RV0A 3QA8A 3DPPA 4R5LA 3LMFA 1ZYLA 4IM0A 3O3OB 1W9MA 3F7WA 3B52X 4EZPA 4JN4A 4EZRA 2X5CA 3ZEFA 1JQKA 1E2UA 3T49A 3OHXM 3C7NA 4IWPA 3T47A 4EZNA 3GI7A 3KAWA 4JWCA 3C7NB 4WV5A 5FIGA 4EZWA 1DG4A 1OA0A 2GA9D 4IW0A 4FL9A 2WINM 4JLCA 4I43A 1OAOA 1GNTA 4JWDA 4WV7A 4ILGA 3I39X 2N3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JWE A;  4H6H A;  1Q5L A;  3N8E A;  3DPP A;  4R5L A;  3L3O M;  4R5I A;  2OP6 A;  1YUW A;  7HSC A;  2QXL A;  4H6I A;  2KHO A;  3DPO A;  4R5K A;  4R5G A;  4EZO A;  3T4A G;  4EZU A;  4PO2 A;  2QFF A;  1DKX A;  4E81 A;  2V7Y A;  5E84 A;  4R5J A;  4JN4 A;  4JNF A;  4EZV A;  4EZP A;  4EZR A;  4EZS A;  1CKR A;  1U00 A;  3T49 A;  4HYB A;  3OHX M;  3DPQ A;  3C7N A;  4EZN A;  3T47 A;  4EZX A;  1DKZ A;  3D2E A;  4HY9 A;  5TKY A;  3T46 A;  3T48 A;  2BPR A;  4JWC A;  3C7N B;  3QNJ A;  4EZW A;  4EZQ A;  4WV5 A;  1DG4 A;  3D2F A;  3H0X A;  1BPR A;  4EZZ A;  2WIN M;  4JNE A;  4FL9 A;  3DQG A;  4F00 A;  4EZT A;  4JWD A;  4B9Q A;  3DOB A;  4WV7 A;  4EZY A;  1DKY A;  4JWI A;  4F01 A; 
#chains in the Genus database with same CATH topology
 3VEA A;  1YUW A;  1SU8 A;  2C08 A;  1WDZ A;  3DPO A;  1Y2O A;  3DX1 A;  4EZO A;  2ND0 A;  3QNI A;  3HAJ A;  3HAI A;  2EX3 B;  4WPE A;  1UPX A;  3SYV A;  3CZN A;  4EZS A;  5TKY A;  4FM3 A;  3BLB A;  3DQG A;  1GN9 A;  3ERC C;  2YIV X;  4KIK A;  3I01 A;  3KDR A;  4KIK B;  7HSC A;  4UDX X;  2O0I 1;  4R5G A;  2YL9 A;  3KAV A;  2D1L A;  4UDY X;  1U00 A;  2YL6 A;  3HAH A;  3BUP A;  3DOB A;  2Q13 A;  4JWI A;  1E9V A;  4NPH A;  1X04 A;  3BVW A;  2RAJ A;  3SBS A;  3EJS A;  3A98 A;  2JNS A;  4EZX A;  1I4T A;  2EFK A;  4DCN C;  3ER8 C;  4I1Q A;  3DX2 A;  2YL5 A;  3EJU A;  3M3W A;  2F7R A;  1O7D C;  4HR1 B;  1I4D A;  4H8S A;  3RV0 A;  3Q0K A;  3BUB A;  3O3O B;  1HWW A;  3ZEF A;  1JQK A;  3T49 A;  1ZWW A;  3OHX M;  2LXY A;  2Z0O A;  4JWC A;  4WV5 A;  1DG4 A;  2PMR A;  4IW0 A;  2GA9 D;  2WIN M;  4I43 A;  1OAO A;  1GNT A;  5KBP A;  2F1B A;  2N3K A;  3EJP A;  3DX3 A;  2Z0N A;  4AZC A;  2YI9 A;  3B51 X;  2YIA A;  2V7Y A;  2OW7 A;  5E84 A;  4BNE A;  3D4Z A;  1R34 A;  2Z8Y A;  2MI7 A;  3T48 A;  3QNJ A;  1BPR A;  2OBL A;  2Z0V A;  1YWM A;  2F7P A;  1GNL A;  2YLL A;  4H6H A;  3L3P A;  1HTY A;  4D8J A;  3L3O M;  3SBT B;  4E3C A;  1OA1 A;  3FD9 A;  4ILH B;  4AZ6 A;  2V0O A;  4AZG A;  3DDG A;  2BPR A;  4WPC A;  4F00 A;  3ZED A;  3EJT A;  4AKV A;  2KHO A;  3T4A G;  4EZU A;  3O3N B;  3CZS A;  4R5J A;  4JNF A;  3BUQ A;  2JNK A;  1SU7 A;  3DPQ A;  3T46 A;  1QWN A;  3VEB A;  1URU A;  3D52 A;  2QKW A;  2YI8 A;  3BVU A;  1TQV A;  2ZXQ A;  3OWG A;  3Q84 A;  3BUI A;  4AZ5 A;  1DKY A;  3QE6 A;  2OO2 A;  3DPP A;  3LMF A;  1ZYL A;  4EZP A;  4JN4 A;  2D4C A;  3BUD A;  4EZR A;  1E2U A;  3DX4 A;  4IWP A;  3T47 A;  2WYI A;  2OW6 A;  1R5E A;  1PS3 A;  4FZO A;  1TQW A;  4JWD A;  3I39 X;  1QWU A;  4FZS A;  4H6I A;  3EJR A;  4AZ7 A;  4NSW A;  3RPM A;  3D4Y A;  2GF4 A;  3G9G A;  1MJG A;  5FLE X;  1QX1 A;  3I04 A;  4NQI A;  3H0X A;  3CVR A;  3VKH A;  3N8E A;  1O7D B;  4R5K A;  2FYV A;  3ER9 B;  3CAZ A;  1DKX A;  1TQS A;  4AZC B;  2F1A A;  1I4L A;  4G6Q A;  1SU6 A;  4IWO A;  4DYL A;  4JL9 A;  4B9Q A;  4MQD A;  4JWE A;  2PY6 A;  2ALW A;  2QXL A;  2OBM A;  3ACO A;  3PLT A;  4PO2 A;  4IM2 A;  3DDF A;  3CV5 A;  4EZV A;  4HYB A;  3DYT A;  3D2E A;  1TQT A;  2LM0 A;  4EZT A;  2GAF D;  4FZP A;  4R5L A;  4AZB A;  3F7W A;  3B52 X;  1HXK A;  2X5C A;  2EFL A;  5FIG A;  4EZW A;  4FL9 A;  3DX0 A;  4WV7 A;  4ILG A;  1Q5L A;  4IWQ A;  2OP6 A;  1SUF A;  4E81 A;  4AZH A;  2OZN B;  2X3X A;  2YIB A;  3ABH A;  3D51 A;  4AZI A;  3LLL A;  1CKR A;  2EWF A;  3UIT A;  2X3W A;  2RT6 A;  4EZZ A;  4JNE A;  3EJQ A;  2RAK A;  2X3V A;  4F01 A;  4R5I A;  1LQ7 A;  5C5B A;  2QFF A;  5C5B B;  4ILI A;  3SOG A;  4EZQ A;  1DKZ A;  4HY9 A;  4HR1 A;  3BVT A;  2FIC A;  4ATM A;  2YL8 A;  1R33 A;  1I49 A;  1E1D A;  2NCZ A;  3CKD A;  3RV1 A;  4M0M A;  1X03 A;  3B53 X;  3O3M B;  2ND1 A;  3OK8 A;  4IM3 A;  2RAI A;  2Q12 A;  2F7Q A;  3D2F A;  4EZY A;  3LVT A;  2YKT A;  3BVV A;  2F7O A;  3D50 A;  3I2W A;  4AVM A;  3QA8 A;  2ELB A;  1TQU A;  4IM0 A;  1W9M A;  3QWE A;  3C7N A;  4EZN A;  3GI7 A;  3KAW A;  3C7N B;  1OA0 A;  4JLC A;  3BVX A;  2YLA A;  2F18 A;  2WYH A; 
#chains in the Genus database with same CATH homology
 1Q5L A;  3VEA A;  4IWQ A;  2OP6 A;  1YUW A;  4H6I A;  1SU8 A;  3DPO A;  1SUF A;  2YI9 A;  4EZO A;  3B51 X;  2ND0 A;  4E81 A;  2YIA A;  2V7Y A;  5E84 A;  2YIB A;  2EX3 B;  1UPX A;  4EZS A;  1CKR A;  2EWF A;  3UIT A;  5TKY A;  1MJG A;  2Z8Y A;  3T48 A;  5FLE X;  2RT6 A;  3QNJ A;  3I04 A;  4FM3 A;  3H0X A;  1BPR A;  4EZZ A;  4JNE A;  3DQG A;  2OBL A;  1GN9 A;  3ERC C;  2YIV X;  4KIK A;  1GNL A;  4F01 A;  3I01 A;  4H6H A;  4D8J A;  3VKH A;  4R5I A;  3L3O M;  3N8E A;  3SBT B;  3KDR A;  4KIK B;  7HSC A;  4UDX X;  4E3C A;  4R5K A;  3ER9 B;  4R5G A;  2QFF A;  1DKX A;  1OA1 A;  3KAV A;  4ILI A;  3FD9 A;  4UDY X;  4ILH B;  1U00 A;  4EZQ A;  1DKZ A;  4HY9 A;  4G6Q A;  2BPR A;  4HR1 A;  1SU6 A;  4IWO A;  4F00 A;  3ZED A;  4JL9 A;  1E1D A;  4B9Q A;  3DOB A;  4MQD A;  4JWI A;  4JWE A;  2NCZ A;  1E9V A;  4NPH A;  2PY6 A;  3RV1 A;  2QXL A;  2OBM A;  2KHO A;  4M0M A;  3B53 X;  3O3M B;  3T4A G;  4EZU A;  4PO2 A;  3O3N B;  4IM2 A;  2ND1 A;  4R5J A;  4EZV A;  4JNF A;  3SBS A;  3A98 A;  2JNS A;  4IM3 A;  1SU7 A;  4HYB A;  3DPQ A;  4EZX A;  3D2E A;  3T46 A;  3ER8 C;  3VEB A;  2YI8 A;  3D2F A;  3OWG A;  2LM0 A;  4HR1 B;  4EZT A;  4EZY A;  2GAF D;  1DKY A;  3RV0 A;  3QA8 A;  3DPP A;  4R5L A;  3LMF A;  1ZYL A;  4IM0 A;  3O3O B;  1W9M A;  3F7W A;  3B52 X;  4EZP A;  4JN4 A;  4EZR A;  2X5C A;  3ZEF A;  1JQK A;  1E2U A;  3T49 A;  3OHX M;  3C7N A;  4IWP A;  3T47 A;  4EZN A;  3GI7 A;  3KAW A;  4JWC A;  3C7N B;  4WV5 A;  5FIG A;  4EZW A;  1DG4 A;  1OA0 A;  2GA9 D;  4IW0 A;  4FL9 A;  2WIN M;  4JLC A;  4I43 A;  1OAO A;  1GNT A;  4JWD A;  4WV7 A;  4ILG A;  3I39 X;  2N3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...