4EZPA

Crystal structure of the substrate binding domain of e.coli dnak in complex with a3-apo(residues 1 to 20)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
total genus 59
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezpA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezpA01
4EZXA 3T47A 4H6IA 4EZNA 4EZZA 1Q5LA 2QFFA 4JN4A 4JWIA 5TKYA 3N8EA 2WINM 3T4AG 3DQGA 4R5GA 4F00A 5E84A 2BPRA 4R5KA 3T49A 1CKRA 2QXLA 4EZUA 4B9QA 3C7NB 1U00A 7HSCA 4EZVA 4EZYA 4JNFA 4EZTA 4PO2A 4F01A 4EZQA 4EZOA 1DKXA 3D2EA 4WV5A 4WV7A 3C7NA 3DPOA 2OP6A 4JWCA 4E81A 2KHOA 3T46A 3D2FA 4EZSA 1DKZA 3DPQA 4R5IA 1BPRA 3H0XA 1DKYA 4HY9A 3T48A 4R5JA 4EZRA 4EZPA 4FL9A 4R5LA 3QNJA 1DG4A 4H6HA 1YUWA 4HYBA 3DPPA 2V7YA 3DOBA 4JWEA 3OHXM 4EZWA 4JWDA 3L3OM 4JNEA
chains in the Genus database with same CATH superfamily
3BLBA 1HXKA 2F7RA 3BUBA 5E84A 2O0I1 2F1AA 2D1LA 3EJPA 1DKXA 4UDYX 2PY6A 3DYTA 2F18A 3DPQA 2GF4A 2OW6A 3BUDA 2X3WA 1SU7A 4AZCA 2C08A 4FZOA 4JNEA 4IW0A 4IM0A 2PMRA 2RAJA 1W9MA 3RV1A 3DDGA 4D8JA 3I04A 4EZSA 1TQSA 3Q84A 3HAIA 4HYBA 2YL6A 4EZZA 1Y2OA 3O3NB 3B51X 4F00A 4JLCA 4EZUA 4FZPA 1QWNA 3EJUA 4F01A 4EZOA 4FM3A 3D4YA 2YL9A 2X5CA 3T48A 3ER9B 1QX1A 3DOBA 3LVTA 4M0MA 3PLTA 2F7QA 4HR1B 1O7DC 3ERCC 4I1QA 1ZWWA 3BUPA 3RPMA 4ILIA 1SUFA 4EZPA 3QNJA 2Z0OA 2Z8YA 2X3VA 4IM2A 3ABHA 3C7NB 2LXYA 4WPCA 3EJRA 2EWFA 3LMFA 4HY9A 1GNTA 3SOGA 3KAWA 5FLEX 3OHXM 2Z0VA 1I4DA 3ER8C 5TKYA 3ACOA 4HR1A 4AZIA 2X3XA 3B53X 2EFLA 4EZQA 4IWQA 3CZNA 3SBSA 3OWGA 1GN9A 4G6QA 3O3OB 3EJTA 3QE6A 4AKVA 4IWPA 1SU8A 3FD9A 4EZXA 2ND1A 2V0OA 2YLLA 1TQTA 2YLAA 3L3PA 3QNIA 3QWEA 3DX2A 3ZEDA 2ALWA 2OBMA 3D51A 3EJQA 1QWUA 4WV5A 3A98A 3C7NA 2YIVX 2RAIA 2F1BA 2ELBA 3DQGA 3DX4A 4EZNA 2F7PA 2YL5A 2QFFA 4JN4A 3CV5A 3HAJA 2GA9D 3T49A 3M3WA 3DDFA 4NQIA 4AZBA 1TQUA 4JNFA 4PO2A 3D2EA 3BVTA 3DX3A 3CVRA 3D50A 4JL9A 4IWOA 3CKDA 4UDXX 4DYLA 3T47A 2N3KA 2QKWA 3KAVA 2YIBA 4R5GA 2NCZA 1E9VA 4AZGA 3CAZA 7HSCA 1JQKA 2GAFD 2EFKA 3D52A 2WYIA 3F7WA 1I4TA 3GI7A 3I2WA 3BUIA 3UITA 4R5LA 1UPXA 2LM0A 4E3CA 3DPPA 4DCNC 2V7YA 4I43A 4H6IA 2WINM 3O3MB 3LLLA 1R33A 4WV7A 1TQWA 4ILHB 3H0XA 1DKYA 4H8SA 2JNSA 3BUQA 2ZXQA 3CZSA 3G9GA 2Q13A 3N8EA 1YWMA 4B9QA 5KBPA 1HWWA 1R34A 2OZNB 3T46A 1TQVA 4R5IA 1E1DA 3KDRA 4AZ5A 2ND0A 3OK8A 3SBTB 1I4LA 4AZHA 2Q12A 1ZYLA 4IM3A 1MJGA 4FZSA 3QA8A 3ZEFA 3T4AG 4KIKB 2OBLA 4ATMA 4ILGA 5C5BB 2Z0NA 2FYVA 4EZTA 2FICA 1OA0A 3DPOA 4JWCA 2YI8A 4AZ7A 3I39X 2RT6A 3EJSA 1OA1A 4WPEA 3BVXA 2EX3B 2KHOA 3D4ZA 3BVWA 2RAKA 1CKRA 1HTYA 4EZVA 4MQDA 1OAOA 2OP6A 3D2FA 4FL9A 1DG4A 1LQ7A 2OO2A 4AVMA 1WDZA 2D4CA 1URUA 1R5EA 4R5KA 4NSWA 2QXLA 1U00A 4KIKA 1X03A 3DX1A 3DX0A 5C5BA 3B52X 4R5JA 2F7OA 5FIGA 1X04A 2MI7A 3VEAA 4AZ6A 2WYHA 2BPRA 4EZYA 1GNLA 4E81A 3SYVA 2YL8A 1DKZA 4AZCB 3VKHA 4EZRA 4BNEA 1O7DB 4H6HA 1YUWA 2YI9A 4JWEA 4EZWA 4JWDA 1Q5LA 3BVVA 4JWIA 1E2UA 3BVUA 1I49A 2OW7A 3VEBA 1PS3A 4NPHA 1BPRA 3Q0KA 3RV0A 2YKTA 3HAHA 2YIAA 3I01A 1SU6A 2JNKA 3L3OM
chains in the Genus database with same CATH topology
4IM2A 3T47A 2N3KA 3KAVA 2YIBA 4R5GA 5E84A 2NCZA 1E9VA 1CKRA 3C7NB 7HSCA 4EZVA 4MQDA 1JQKA 2GAFD 1OAOA 1DKXA 4UDYX 2OP6A 2PY6A 3F7WA 2EWFA 3D2FA 3GI7A 3DPQA 3LMFA 4HY9A 1GNTA 4FL9A 3UITA 4R5LA 1DG4A 1UPXA 2LM0A 3DPPA 3KAWA 4E3CA 1SU7A 2V7YA 5FLEX 3OHXM 4I43A 4JNEA 4H6IA 4IW0A 3ER8C 4IM0A 5TKYA 2WINM 1W9MA 4R5KA 3O3MB 2QXLA 1U00A 4HR1A 3B53X 4EZQA 4KIKA 4WV7A 4IWQA 3RV1A 3SBSA 3OWGA 1GN9A 3I04A 4G6QA 4EZSA 3B52X 4D8JA 4ILHB 3O3OB 3H0XA 1DKYA 4R5JA 2JNSA 4IWPA 1SU8A 4HYBA 3FD9A 5FIGA 3VEAA 4EZXA 2ND1A 4EZZA 3O3NB 3N8EA 3B51X 3ZEDA 2OBMA 4F00A 4JLCA 2BPRA 4EZUA 4B9QA 4EZYA 4F01A 4WV5A 4EZOA 3A98A 1GNLA 3C7NA 4E81A 3T46A 4FM3A 1DKZA 4R5IA 2YIVX 1E1DA 2X5CA 3T48A 3VKHA 4EZRA 3ER9B 3KDRA 2ND0A 4H6HA 1YUWA 3SBTB 2YI9A 3DOBA 4M0MA 4JWEA 4EZWA 4JWDA 3DQGA 1ZYLA 4IM3A 1MJGA 4EZNA 1Q5LA 2QFFA 4JN4A 4HR1B 4JWIA 3QA8A 1E2UA 3ZEFA 3T4AG 3ERCC 2GA9D 3T49A 4KIKB 2OBLA 4ILGA 4JNFA 4EZTA 4PO2A 3VEBA 3D2EA 1OA0A 3DPOA 4JWCA 2YI8A 3I39X 4NPHA 1BPRA 2RT6A 4ILIA 1SUFA 1OA1A 3RV0A 4EZPA 3QNJA 4JL9A 2YIAA 3I01A 4IWOA 2EX3B 1SU6A 2KHOA 4UDXX 3L3OM 2Z8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZX A;  3T47 A;  4H6I A;  4EZN A;  4EZZ A;  1Q5L A;  2QFF A;  4JN4 A;  4JWI A;  5TKY A;  3N8E A;  2WIN M;  3T4A G;  3DQG A;  4R5G A;  4F00 A;  5E84 A;  2BPR A;  4R5K A;  3T49 A;  1CKR A;  2QXL A;  4EZU A;  4B9Q A;  3C7N B;  1U00 A;  7HSC A;  4EZV A;  4EZY A;  4JNF A;  4EZT A;  4PO2 A;  4F01 A;  4EZQ A;  4EZO A;  1DKX A;  3D2E A;  4WV5 A;  4WV7 A;  3C7N A;  3DPO A;  2OP6 A;  4JWC A;  4E81 A;  2KHO A;  3T46 A;  3D2F A;  4EZS A;  1DKZ A;  3DPQ A;  4R5I A;  1BPR A;  3H0X A;  1DKY A;  4HY9 A;  3T48 A;  4R5J A;  4EZR A;  4EZP A;  4FL9 A;  4R5L A;  3QNJ A;  1DG4 A;  4H6H A;  1YUW A;  4HYB A;  3DPP A;  2V7Y A;  3DOB A;  4JWE A;  3OHX M;  4EZW A;  4JWD A;  3L3O M;  4JNE A; 
#chains in the Genus database with same CATH topology
 3BLB A;  1HXK A;  2F7R A;  3BUB A;  5E84 A;  2O0I 1;  2F1A A;  2D1L A;  3EJP A;  1DKX A;  4UDY X;  2PY6 A;  3DYT A;  2F18 A;  3DPQ A;  2GF4 A;  2OW6 A;  3BUD A;  2X3W A;  1SU7 A;  4AZC A;  2C08 A;  4FZO A;  4JNE A;  4IW0 A;  4IM0 A;  2PMR A;  2RAJ A;  1W9M A;  3RV1 A;  3DDG A;  4D8J A;  3I04 A;  4EZS A;  1TQS A;  3Q84 A;  3HAI A;  4HYB A;  2YL6 A;  4EZZ A;  1Y2O A;  3O3N B;  3B51 X;  4F00 A;  4JLC A;  4EZU A;  4FZP A;  1QWN A;  3EJU A;  4F01 A;  4EZO A;  4FM3 A;  3D4Y A;  2YL9 A;  2X5C A;  3T48 A;  3ER9 B;  1QX1 A;  3DOB A;  3LVT A;  4M0M A;  3PLT A;  2F7Q A;  4HR1 B;  1O7D C;  3ERC C;  4I1Q A;  1ZWW A;  3BUP A;  3RPM A;  4ILI A;  1SUF A;  4EZP A;  3QNJ A;  2Z0O A;  2Z8Y A;  2X3V A;  4IM2 A;  3ABH A;  3C7N B;  2LXY A;  4WPC A;  3EJR A;  2EWF A;  3LMF A;  4HY9 A;  1GNT A;  3SOG A;  3KAW A;  5FLE X;  3OHX M;  2Z0V A;  1I4D A;  3ER8 C;  5TKY A;  3ACO A;  4HR1 A;  4AZI A;  2X3X A;  3B53 X;  2EFL A;  4EZQ A;  4IWQ A;  3CZN A;  3SBS A;  3OWG A;  1GN9 A;  4G6Q A;  3O3O B;  3EJT A;  3QE6 A;  4AKV A;  4IWP A;  1SU8 A;  3FD9 A;  4EZX A;  2ND1 A;  2V0O A;  2YLL A;  1TQT A;  2YLA A;  3L3P A;  3QNI A;  3QWE A;  3DX2 A;  3ZED A;  2ALW A;  2OBM A;  3D51 A;  3EJQ A;  1QWU A;  4WV5 A;  3A98 A;  3C7N A;  2YIV X;  2RAI A;  2F1B A;  2ELB A;  3DQG A;  3DX4 A;  4EZN A;  2F7P A;  2YL5 A;  2QFF A;  4JN4 A;  3CV5 A;  3HAJ A;  2GA9 D;  3T49 A;  3M3W A;  3DDF A;  4NQI A;  4AZB A;  1TQU A;  4JNF A;  4PO2 A;  3D2E A;  3BVT A;  3DX3 A;  3CVR A;  3D50 A;  4JL9 A;  4IWO A;  3CKD A;  4UDX X;  4DYL A;  3T47 A;  2N3K A;  2QKW A;  3KAV A;  2YIB A;  4R5G A;  2NCZ A;  1E9V A;  4AZG A;  3CAZ A;  7HSC A;  1JQK A;  2GAF D;  2EFK A;  3D52 A;  2WYI A;  3F7W A;  1I4T A;  3GI7 A;  3I2W A;  3BUI A;  3UIT A;  4R5L A;  1UPX A;  2LM0 A;  4E3C A;  3DPP A;  4DCN C;  2V7Y A;  4I43 A;  4H6I A;  2WIN M;  3O3M B;  3LLL A;  1R33 A;  4WV7 A;  1TQW A;  4ILH B;  3H0X A;  1DKY A;  4H8S A;  2JNS A;  3BUQ A;  2ZXQ A;  3CZS A;  3G9G A;  2Q13 A;  3N8E A;  1YWM A;  4B9Q A;  5KBP A;  1HWW A;  1R34 A;  2OZN B;  3T46 A;  1TQV A;  4R5I A;  1E1D A;  3KDR A;  4AZ5 A;  2ND0 A;  3OK8 A;  3SBT B;  1I4L A;  4AZH A;  2Q12 A;  1ZYL A;  4IM3 A;  1MJG A;  4FZS A;  3QA8 A;  3ZEF A;  3T4A G;  4KIK B;  2OBL A;  4ATM A;  4ILG A;  5C5B B;  2Z0N A;  2FYV A;  4EZT A;  2FIC A;  1OA0 A;  3DPO A;  4JWC A;  2YI8 A;  4AZ7 A;  3I39 X;  2RT6 A;  3EJS A;  1OA1 A;  4WPE A;  3BVX A;  2EX3 B;  2KHO A;  3D4Z A;  3BVW A;  2RAK A;  1CKR A;  1HTY A;  4EZV A;  4MQD A;  1OAO A;  2OP6 A;  3D2F A;  4FL9 A;  1DG4 A;  1LQ7 A;  2OO2 A;  4AVM A;  1WDZ A;  2D4C A;  1URU A;  1R5E A;  4R5K A;  4NSW A;  2QXL A;  1U00 A;  4KIK A;  1X03 A;  3DX1 A;  3DX0 A;  5C5B A;  3B52 X;  4R5J A;  2F7O A;  5FIG A;  1X04 A;  2MI7 A;  3VEA A;  4AZ6 A;  2WYH A;  2BPR A;  4EZY A;  1GNL A;  4E81 A;  3SYV A;  2YL8 A;  1DKZ A;  4AZC B;  3VKH A;  4EZR A;  4BNE A;  1O7D B;  4H6H A;  1YUW A;  2YI9 A;  4JWE A;  4EZW A;  4JWD A;  1Q5L A;  3BVV A;  4JWI A;  1E2U A;  3BVU A;  1I49 A;  2OW7 A;  3VEB A;  1PS3 A;  4NPH A;  1BPR A;  3Q0K A;  3RV0 A;  2YKT A;  3HAH A;  2YIA A;  3I01 A;  1SU6 A;  2JNK A;  3L3O M; 
#chains in the Genus database with same CATH homology
 4IM2 A;  3T47 A;  2N3K A;  3KAV A;  2YIB A;  4R5G A;  5E84 A;  2NCZ A;  1E9V A;  1CKR A;  3C7N B;  7HSC A;  4EZV A;  4MQD A;  1JQK A;  2GAF D;  1OAO A;  1DKX A;  4UDY X;  2OP6 A;  2PY6 A;  3F7W A;  2EWF A;  3D2F A;  3GI7 A;  3DPQ A;  3LMF A;  4HY9 A;  1GNT A;  4FL9 A;  3UIT A;  4R5L A;  1DG4 A;  1UPX A;  2LM0 A;  3DPP A;  3KAW A;  4E3C A;  1SU7 A;  2V7Y A;  5FLE X;  3OHX M;  4I43 A;  4JNE A;  4H6I A;  4IW0 A;  3ER8 C;  4IM0 A;  5TKY A;  2WIN M;  1W9M A;  4R5K A;  3O3M B;  2QXL A;  1U00 A;  4HR1 A;  3B53 X;  4EZQ A;  4KIK A;  4WV7 A;  4IWQ A;  3RV1 A;  3SBS A;  3OWG A;  1GN9 A;  3I04 A;  4G6Q A;  4EZS A;  3B52 X;  4D8J A;  4ILH B;  3O3O B;  3H0X A;  1DKY A;  4R5J A;  2JNS A;  4IWP A;  1SU8 A;  4HYB A;  3FD9 A;  5FIG A;  3VEA A;  4EZX A;  2ND1 A;  4EZZ A;  3O3N B;  3N8E A;  3B51 X;  3ZED A;  2OBM A;  4F00 A;  4JLC A;  2BPR A;  4EZU A;  4B9Q A;  4EZY A;  4F01 A;  4WV5 A;  4EZO A;  3A98 A;  1GNL A;  3C7N A;  4E81 A;  3T46 A;  4FM3 A;  1DKZ A;  4R5I A;  2YIV X;  1E1D A;  2X5C A;  3T48 A;  3VKH A;  4EZR A;  3ER9 B;  3KDR A;  2ND0 A;  4H6H A;  1YUW A;  3SBT B;  2YI9 A;  3DOB A;  4M0M A;  4JWE A;  4EZW A;  4JWD A;  3DQG A;  1ZYL A;  4IM3 A;  1MJG A;  4EZN A;  1Q5L A;  2QFF A;  4JN4 A;  4HR1 B;  4JWI A;  3QA8 A;  1E2U A;  3ZEF A;  3T4A G;  3ERC C;  2GA9 D;  3T49 A;  4KIK B;  2OBL A;  4ILG A;  4JNF A;  4EZT A;  4PO2 A;  3VEB A;  3D2E A;  1OA0 A;  3DPO A;  4JWC A;  2YI8 A;  3I39 X;  4NPH A;  1BPR A;  2RT6 A;  4ILI A;  1SUF A;  1OA1 A;  3RV0 A;  4EZP A;  3QNJ A;  4JL9 A;  2YIA A;  3I01 A;  4IWO A;  2EX3 B;  1SU6 A;  2KHO A;  4UDX X;  3L3O M;  2Z8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...