4EZRA

Crystal structure of the substrate binding domain of e.coli dnak in complex with the c-terminal part of drosocin (residues 12 to 19)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
218
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
total genus 67
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezrA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezrA01
4WV7A 4EZOA 4EZXA 3C7NB 1DKYA 4EZQA 4EZTA 4EZWA 3DOBA 5TKYA 1Q5LA 3L3OM 4JWDA 4JN4A 3T47A 1DKXA 4JNEA 3T46A 4H6HA 4PO2A 3T49A 2WINM 2QXLA 4HYBA 4EZSA 1DG4A 2V7YA 1BPRA 3DPPA 3N8EA 4B9QA 3D2EA 3DPOA 4JNFA 5E84A 4JWEA 1U00A 4H6IA 4WV5A 1YUWA 3DQGA 4EZRA 3DPQA 4R5IA 4R5GA 4R5LA 3OHXM 2KHOA 3QNJA 4EZVA 4EZZA 4F01A 2BPRA 3C7NA 4JWCA 4EZUA 2QFFA 4HY9A 1DKZA 4R5KA 4EZNA 4EZYA 3H0XA 4FL9A 3T4AG 7HSCA 4EZPA 4JWIA 3T48A 1CKRA 4E81A 3D2FA 2OP6A 4R5JA 4F00A
chains in the Genus database with same CATH superfamily
4HR1B 4JL9A 3T47A 4NQIA 3T46A 3PLTA 3DPPA 3D4ZA 2Z0NA 3OHXM 2N3KA 3VKHA 3OWGA 3VEBA 4DCNC 3ZEFA 4FZSA 3L3PA 3D52A 3UITA 2C08A 2OW6A 2V7YA 4AZ6A 3B52X 3EJRA 2F18A 5C5BA 4EZVA 4EZUA 2LXYA 3EJTA 3H0XA 2YL5A 1GNLA 3ABHA 4IM2A 1LQ7A 2Z0OA 1GNTA 4EZOA 4WPCA 3BUPA 1OA0A 4AZGA 1HTYA 2YIVX 2Q13A 2OZNB 2RAKA 4R5LA 1TQTA 1E9VA 4EZPA 1R5EA 1JQKA 1MJGA 2OP6A 1GN9A 4I43A 4JLCA 1DKYA 3LMFA 1HXKA 3ACOA 3B51X 3EJQA 3EJPA 1E2UA 3BLBA 2GF4A 4H6IA 2YI9A 4F01A 4EZYA 4ILIA 4IM3A 1R34A 4WV7A 2JNKA 3QNIA 3DX1A 3O3NB 3OK8A 2FYVA 1QWNA 4WPEA 2YL9A 4B9QA 1I4DA 3D4YA 2Z0VA 3QA8A 4I1QA 4R5KA 4JWIA 3T48A 2V0OA 2YIAA 2GAFD 3BUIA 3D51A 3CZNA 3VEAA 2OBMA 2X3WA 4HYBA 1X03A 3F7WA 1R33A 4WV5A 2WYHA 4EZRA 4R5IA 3EJUA 1TQSA 2NCZA 4IWOA 1SUFA 2JNSA 3QWEA 1SU7A 4EZQA 3BUDA 1HWWA 1X04A 4JNEA 2RAIA 1O7DB 3DDGA 3BVTA 3BUQA 4E3CA 5FIGA 3QNJA 3ZEDA 3BUBA 1OAOA 4DYLA 4HY9A 2YKTA 2F7OA 4H8SA 2YLLA 2F7RA 4R5JA 4AZ5A 3GI7A 3DX2A 5TKYA 3CKDA 3HAHA 4H6HA 1URUA 4NSWA 1TQUA 3O3MB 4JNFA 1I4TA 1O7DC 4ILGA 4FZOA 1W9MA 3I2WA 2ND1A 1Y2OA 2D4CA 4F00A 1QX1A 4EZXA 2LM0A 1Q5LA 1I49A 4BNEA 2EX3B 1OA1A 4EZSA 3EJSA 3BVVA 1YWMA 4AZBA 3FD9A 3DQGA 1ZWWA 3CV5A 3LLLA 3KAVA 5KBPA 3DX0A 4FM3A 4JWCA 1E1DA 1CKRA 2ZXQA 3DOBA 3RV1A 2F1BA 2D1LA 1BPRA 3N8EA 3SYVA 2X3VA 2EFLA 4FL9A 4EZNA 4AZHA 2PMRA 4G6QA 3B53X 3I39X 2X5CA 2MI7A 2YL8A 3BVWA 4ILHB 3DX4A 1I4LA 2ND0A 3A98A 2QKWA 3HAJA 4PO2A 4KIKB 3HAIA 1YUWA 2YL6A 2ELBA 4UDXX 2KHOA 3KDRA 2BPRA 4AVMA 3D2FA 4IW0A 2EWFA 3ER9B 4EZWA 2WINM 2QXLA 3KAWA 3Q84A 3BVXA 3BVUA 1TQWA 4R5GA 4AZCB 3SBSA 4UDYX 1SU6A 2ALWA 3Q0KA 2OBLA 4KIKA 4EZTA 2EFKA 4JWDA 1DKXA 2Z8YA 2YLAA 3CZSA 2X3XA 5E84A 4JWEA 4AKVA 4HR1A 4EZZA 7HSCA 2FICA 3CAZA 4D8JA 2OO2A 1UPXA 1ZYLA 3RPMA 4MQDA 3I04A 5FLEX 3DDFA 3O3OB 1TQVA 4AZCA 4AZ7A 3D2EA 4ATMA 1U00A 2YIBA 3QE6A 3LVTA 2OW7A 3ERCC 2RAJA 1DKZA 2PY6A 3T4AG 4E81A 3D50A 2YI8A 3C7NB 4JN4A 4IM0A 1PS3A 1SU8A 3DX3A 4NPHA 1QWUA 3CVRA 4IWPA 1WDZA 1DG4A 3SOGA 2F7QA 3DPQA 4M0MA 3SBTB 3ER8C 2F7PA 4FZPA 2O0I1 3M3WA 2F1AA 3L3OM 3T49A 3DPOA 4IWQA 3G9GA 3RV0A 2WYIA 3DYTA 3C7NA 2QFFA 2RT6A 2Q12A 4AZIA 5C5BB 3I01A 2GA9D
chains in the Genus database with same CATH topology
4HR1B 4WV7A 4KIKA 4EZXA 4JL9A 2LM0A 4EZTA 1Q5LA 3O3NB 4JWDA 3T47A 1DKXA 3T46A 2EX3B 1OA1A 2Z8YA 4EZSA 3DPPA 4B9QA 3FD9A 5E84A 4JWEA 3DQGA 3KAVA 3QA8A 3OHXM 4HR1A 2N3KA 4EZZA 3VKHA 4FM3A 4JWCA 4R5KA 3OWGA 7HSCA 1E1DA 4JWIA 4D8JA 3T48A 3VEBA 1CKRA 3ZEFA 2YIAA 1UPXA 2GAFD 1ZYLA 3DOBA 4MQDA 3UITA 3RV1A 3I04A 5FLEX 3O3OB 3VEAA 2OBMA 4HYBA 2V7YA 1BPRA 3N8EA 3D2EA 3F7WA 1U00A 4WV5A 3B52X 2YIBA 4EZRA 4R5IA 4EZVA 3ERCC 4EZUA 4FL9A 1DKZA 4EZNA 2PY6A 2NCZA 3H0XA 3T4AG 4G6QA 4E81A 1GNLA 4IWOA 3B53X 4IM2A 3I39X 1SUFA 2JNSA 1GNTA 4EZOA 2X5CA 2YI8A 1SU7A 3C7NB 4EZQA 4JN4A 1OA0A 4IM0A 4ILHB 1SU8A 4JNEA 3A98A 2ND0A 4NPHA 4PO2A 4IWPA 2YIVX 4KIKB 1DG4A 1YUWA 3DPQA 4E3CA 4M0MA 4UDXX 5FIGA 4R5LA 2KHOA 3KDRA 3QNJA 3SBTB 3ZEDA 3ER8C 2BPRA 1OAOA 1E9VA 4HY9A 4EZPA 1JQKA 1MJGA 2OP6A 3D2FA 1GN9A 4IW0A 4JLCA 4I43A 2EWFA 4R5JA 3ER9B 3GI7A 1DKYA 3LMFA 4EZWA 5TKYA 3L3OM 3B51X 4H6HA 3T49A 2WINM 2QXLA 1E2UA 3KAWA 3O3MB 3DPOA 4JNFA 4H6IA 4IWQA 4R5GA 3RV0A 2YI9A 4F01A 3C7NA 4ILGA 2QFFA 1W9MA 4EZYA 4ILIA 3SBSA 4IM3A 2RT6A 4UDYX 1SU6A 2ND1A 3I01A 2GA9D 2OBLA 4F00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WV7 A;  4EZO A;  4EZX A;  3C7N B;  1DKY A;  4EZQ A;  4EZT A;  4EZW A;  3DOB A;  5TKY A;  1Q5L A;  3L3O M;  4JWD A;  4JN4 A;  3T47 A;  1DKX A;  4JNE A;  3T46 A;  4H6H A;  4PO2 A;  3T49 A;  2WIN M;  2QXL A;  4HYB A;  4EZS A;  1DG4 A;  2V7Y A;  1BPR A;  3DPP A;  3N8E A;  4B9Q A;  3D2E A;  3DPO A;  4JNF A;  5E84 A;  4JWE A;  1U00 A;  4H6I A;  4WV5 A;  1YUW A;  3DQG A;  4EZR A;  3DPQ A;  4R5I A;  4R5G A;  4R5L A;  3OHX M;  2KHO A;  3QNJ A;  4EZV A;  4EZZ A;  4F01 A;  2BPR A;  3C7N A;  4JWC A;  4EZU A;  2QFF A;  4HY9 A;  1DKZ A;  4R5K A;  4EZN A;  4EZY A;  3H0X A;  4FL9 A;  3T4A G;  7HSC A;  4EZP A;  4JWI A;  3T48 A;  1CKR A;  4E81 A;  3D2F A;  2OP6 A;  4R5J A;  4F00 A; 
#chains in the Genus database with same CATH topology
 4HR1 B;  4JL9 A;  3T47 A;  4NQI A;  3T46 A;  3PLT A;  3DPP A;  3D4Z A;  2Z0N A;  3OHX M;  2N3K A;  3VKH A;  3OWG A;  3VEB A;  4DCN C;  3ZEF A;  4FZS A;  3L3P A;  3D52 A;  3UIT A;  2C08 A;  2OW6 A;  2V7Y A;  4AZ6 A;  3B52 X;  3EJR A;  2F18 A;  5C5B A;  4EZV A;  4EZU A;  2LXY A;  3EJT A;  3H0X A;  2YL5 A;  1GNL A;  3ABH A;  4IM2 A;  1LQ7 A;  2Z0O A;  1GNT A;  4EZO A;  4WPC A;  3BUP A;  1OA0 A;  4AZG A;  1HTY A;  2YIV X;  2Q13 A;  2OZN B;  2RAK A;  4R5L A;  1TQT A;  1E9V A;  4EZP A;  1R5E A;  1JQK A;  1MJG A;  2OP6 A;  1GN9 A;  4I43 A;  4JLC A;  1DKY A;  3LMF A;  1HXK A;  3ACO A;  3B51 X;  3EJQ A;  3EJP A;  1E2U A;  3BLB A;  2GF4 A;  4H6I A;  2YI9 A;  4F01 A;  4EZY A;  4ILI A;  4IM3 A;  1R34 A;  4WV7 A;  2JNK A;  3QNI A;  3DX1 A;  3O3N B;  3OK8 A;  2FYV A;  1QWN A;  4WPE A;  2YL9 A;  4B9Q A;  1I4D A;  3D4Y A;  2Z0V A;  3QA8 A;  4I1Q A;  4R5K A;  4JWI A;  3T48 A;  2V0O A;  2YIA A;  2GAF D;  3BUI A;  3D51 A;  3CZN A;  3VEA A;  2OBM A;  2X3W A;  4HYB A;  1X03 A;  3F7W A;  1R33 A;  4WV5 A;  2WYH A;  4EZR A;  4R5I A;  3EJU A;  1TQS A;  2NCZ A;  4IWO A;  1SUF A;  2JNS A;  3QWE A;  1SU7 A;  4EZQ A;  3BUD A;  1HWW A;  1X04 A;  4JNE A;  2RAI A;  1O7D B;  3DDG A;  3BVT A;  3BUQ A;  4E3C A;  5FIG A;  3QNJ A;  3ZED A;  3BUB A;  1OAO A;  4DYL A;  4HY9 A;  2YKT A;  2F7O A;  4H8S A;  2YLL A;  2F7R A;  4R5J A;  4AZ5 A;  3GI7 A;  3DX2 A;  5TKY A;  3CKD A;  3HAH A;  4H6H A;  1URU A;  4NSW A;  1TQU A;  3O3M B;  4JNF A;  1I4T A;  1O7D C;  4ILG A;  4FZO A;  1W9M A;  3I2W A;  2ND1 A;  1Y2O A;  2D4C A;  4F00 A;  1QX1 A;  4EZX A;  2LM0 A;  1Q5L A;  1I49 A;  4BNE A;  2EX3 B;  1OA1 A;  4EZS A;  3EJS A;  3BVV A;  1YWM A;  4AZB A;  3FD9 A;  3DQG A;  1ZWW A;  3CV5 A;  3LLL A;  3KAV A;  5KBP A;  3DX0 A;  4FM3 A;  4JWC A;  1E1D A;  1CKR A;  2ZXQ A;  3DOB A;  3RV1 A;  2F1B A;  2D1L A;  1BPR A;  3N8E A;  3SYV A;  2X3V A;  2EFL A;  4FL9 A;  4EZN A;  4AZH A;  2PMR A;  4G6Q A;  3B53 X;  3I39 X;  2X5C A;  2MI7 A;  2YL8 A;  3BVW A;  4ILH B;  3DX4 A;  1I4L A;  2ND0 A;  3A98 A;  2QKW A;  3HAJ A;  4PO2 A;  4KIK B;  3HAI A;  1YUW A;  2YL6 A;  2ELB A;  4UDX X;  2KHO A;  3KDR A;  2BPR A;  4AVM A;  3D2F A;  4IW0 A;  2EWF A;  3ER9 B;  4EZW A;  2WIN M;  2QXL A;  3KAW A;  3Q84 A;  3BVX A;  3BVU A;  1TQW A;  4R5G A;  4AZC B;  3SBS A;  4UDY X;  1SU6 A;  2ALW A;  3Q0K A;  2OBL A;  4KIK A;  4EZT A;  2EFK A;  4JWD A;  1DKX A;  2Z8Y A;  2YLA A;  3CZS A;  2X3X A;  5E84 A;  4JWE A;  4AKV A;  4HR1 A;  4EZZ A;  7HSC A;  2FIC A;  3CAZ A;  4D8J A;  2OO2 A;  1UPX A;  1ZYL A;  3RPM A;  4MQD A;  3I04 A;  5FLE X;  3DDF A;  3O3O B;  1TQV A;  4AZC A;  4AZ7 A;  3D2E A;  4ATM A;  1U00 A;  2YIB A;  3QE6 A;  3LVT A;  2OW7 A;  3ERC C;  2RAJ A;  1DKZ A;  2PY6 A;  3T4A G;  4E81 A;  3D50 A;  2YI8 A;  3C7N B;  4JN4 A;  4IM0 A;  1PS3 A;  1SU8 A;  3DX3 A;  4NPH A;  1QWU A;  3CVR A;  4IWP A;  1WDZ A;  1DG4 A;  3SOG A;  2F7Q A;  3DPQ A;  4M0M A;  3SBT B;  3ER8 C;  2F7P A;  4FZP A;  2O0I 1;  3M3W A;  2F1A A;  3L3O M;  3T49 A;  3DPO A;  4IWQ A;  3G9G A;  3RV0 A;  2WYI A;  3DYT A;  3C7N A;  2QFF A;  2RT6 A;  2Q12 A;  4AZI A;  5C5B B;  3I01 A;  2GA9 D; 
#chains in the Genus database with same CATH homology
 4HR1 B;  4WV7 A;  4KIK A;  4EZX A;  4JL9 A;  2LM0 A;  4EZT A;  1Q5L A;  3O3N B;  4JWD A;  3T47 A;  1DKX A;  3T46 A;  2EX3 B;  1OA1 A;  2Z8Y A;  4EZS A;  3DPP A;  4B9Q A;  3FD9 A;  5E84 A;  4JWE A;  3DQG A;  3KAV A;  3QA8 A;  3OHX M;  4HR1 A;  2N3K A;  4EZZ A;  3VKH A;  4FM3 A;  4JWC A;  4R5K A;  3OWG A;  7HSC A;  1E1D A;  4JWI A;  4D8J A;  3T48 A;  3VEB A;  1CKR A;  3ZEF A;  2YIA A;  1UPX A;  2GAF D;  1ZYL A;  3DOB A;  4MQD A;  3UIT A;  3RV1 A;  3I04 A;  5FLE X;  3O3O B;  3VEA A;  2OBM A;  4HYB A;  2V7Y A;  1BPR A;  3N8E A;  3D2E A;  3F7W A;  1U00 A;  4WV5 A;  3B52 X;  2YIB A;  4EZR A;  4R5I A;  4EZV A;  3ERC C;  4EZU A;  4FL9 A;  1DKZ A;  4EZN A;  2PY6 A;  2NCZ A;  3H0X A;  3T4A G;  4G6Q A;  4E81 A;  1GNL A;  4IWO A;  3B53 X;  4IM2 A;  3I39 X;  1SUF A;  2JNS A;  1GNT A;  4EZO A;  2X5C A;  2YI8 A;  1SU7 A;  3C7N B;  4EZQ A;  4JN4 A;  1OA0 A;  4IM0 A;  4ILH B;  1SU8 A;  4JNE A;  3A98 A;  2ND0 A;  4NPH A;  4PO2 A;  4IWP A;  2YIV X;  4KIK B;  1DG4 A;  1YUW A;  3DPQ A;  4E3C A;  4M0M A;  4UDX X;  5FIG A;  4R5L A;  2KHO A;  3KDR A;  3QNJ A;  3SBT B;  3ZED A;  3ER8 C;  2BPR A;  1OAO A;  1E9V A;  4HY9 A;  4EZP A;  1JQK A;  1MJG A;  2OP6 A;  3D2F A;  1GN9 A;  4IW0 A;  4JLC A;  4I43 A;  2EWF A;  4R5J A;  3ER9 B;  3GI7 A;  1DKY A;  3LMF A;  4EZW A;  5TKY A;  3L3O M;  3B51 X;  4H6H A;  3T49 A;  2WIN M;  2QXL A;  1E2U A;  3KAW A;  3O3M B;  3DPO A;  4JNF A;  4H6I A;  4IWQ A;  4R5G A;  3RV0 A;  2YI9 A;  4F01 A;  3C7N A;  4ILG A;  2QFF A;  1W9M A;  4EZY A;  4ILI A;  3SBS A;  4IM3 A;  2RT6 A;  4UDY X;  1SU6 A;  2ND1 A;  3I01 A;  2GA9 D;  2OBL A;  4F00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...