4EZRA

Crystal structure of the substrate binding domain of e.coli dnak in complex with the c-terminal part of drosocin (residues 12 to 19)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
218
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
total genus 67
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezrA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezrA01
4HY9A 4R5JA 4JWEA 4WV5A 3C7NA 3T49A 4JWIA 4EZOA 3DPQA 3N8EA 1DG4A 2V7YA 4EZPA 3C7NB 4EZQA 1DKZA 4JWCA 3DPPA 4R5IA 1Q5LA 4JN4A 4EZYA 3T47A 4H6IA 5TKYA 4HYBA 3T48A 4B9QA 4EZWA 3T4AG 3H0XA 4EZZA 4EZXA 1DKXA 2QXLA 4EZRA 2WINM 4E81A 4EZTA 2BPRA 3DOBA 7HSCA 4R5LA 4JWDA 4R5GA 4EZNA 4F00A 4EZVA 4H6HA 3DQGA 3D2FA 3D2EA 4F01A 4JNFA 4R5KA 2KHOA 1U00A 5E84A 3L3OM 4JNEA 2OP6A 4EZUA 4WV7A 4FL9A 4EZSA 1CKRA 3T46A 1YUWA 1BPRA 1DKYA 4PO2A 3QNJA 3DPOA 2QFFA 3OHXM
chains in the Genus database with same CATH superfamily
4HY9A 2YI9A 2Z8YA 2ND1A 1TQUA 3FD9A 3B52X 2Q13A 4HR1B 3I2WA 2PY6A 3RV1A 3VEBA 4IWQA 4JNFA 2LXYA 3DPPA 4AZIA 4AZBA 2RT6A 4WV5A 3T49A 4AZCA 2X5CA 4ILIA 1DKZA 1HWWA 4E81A 3ZEDA 5C5BA 2EFLA 3L3PA 3D4YA 3BUPA 4IW0A 1SU6A 2FICA 2D1LA 2YI8A 1DKYA 3QNJA 2YKTA 3DPOA 2YL9A 4AVMA 1W9MA 4HR1A 3BVWA 3BUDA 4EZOA 2V7YA 1I4DA 3QE6A 4IWPA 1GN9A 4I1QA 4EZZA 2OBLA 2QXLA 4ATMA 3OWGA 4H8SA 2Q12A 2GAFD 4BNEA 3KDRA 3LLLA 3QA8A 4I43A 1DG4A 4EZPA 1Q5LA 2FYVA 1LQ7A 4HYBA 4B9QA 2WYHA 3T4AG 2BPRA 1R34A 4FM3A 3BVTA 1O7DB 3EJQA 4DYLA 2F7PA 5E84A 1SU7A 2F7OA 4JNEA 3DX4A 1CKRA 3CZSA 3VEAA 4EZUA 4FZOA 1SUFA 4UDYX 3C7NB 1TQWA 4JL9A 2RAKA 1TQVA 3DYTA 1ZYLA 3CKDA 2F18A 3HAIA 4ILGA 3D52A 3DQGA 1QWUA 3SBTB 3F7WA 4MQDA 2JNKA 3BVUA 4KIKB 4EZTA 1QX1A 1GNLA 3EJUA 4JWCA 4R5IA 3D4ZA 3O3NB 3ER9B 3CV5A 2GA9D 4IM3A 4EZNA 2ALWA 1MJGA 3QNIA 1ZWWA 3EJRA 2OZNB 1HTYA 4R5JA 1X03A 3QWEA 4D8JA 3C7NA 3I01A 2Z0OA 3CZNA 1I49A 2EFKA 4JN4A 2EX3B 2PMRA 4R5GA 2QKWA 2NCZA 3O3MB 3D2EA 4F01A 3DDFA 4KIKA 3B51X 1TQTA 3DX1A 3OK8A 3ACOA 1PS3A 5KBPA 2YLAA 2GF4A 1DKXA 7HSCA 3O3OB 2F7QA 3LVTA 2MI7A 4WV7A 3I39X 3T46A 1YUWA 3OHXM 4JWIA 2ELBA 4UDXX 5TKYA 1URUA 1O7DC 4AZ5A 4EZSA 3Q0KA 1WDZA 4AKVA 3BVXA 4JWEA 2JNSA 3GI7A 1HXKA 4IM2A 2X3VA 3HAJA 4EZRA 2F7RA 4AZGA 4M0MA 4WPEA 2OBMA 4FL9A 4ILHB 2RAJA 3BUIA 3ZEFA 4AZCB 2OO2A 3T47A 2X3WA 1I4TA 4R5LA 3BUQA 2V0OA 4EZVA 2N3KA 3D51A 3BVVA 4PO2A 2LM0A 3ERCC 4WPCA 1Y2OA 3HAHA 3N8EA 1R5EA 1JQKA 1GNTA 1X04A 4AZ7A 3ER8C 1OA0A 4F00A 3KAWA 1QWNA 4FZPA 3D2FA 2OW7A 2YIBA 3G9GA 5FLEX 2WYIA 2C08A 2OP6A 4E3CA 3DX2A 1SU8A 3EJSA 3Q84A 2QFFA 2D4CA 2OW6A 1E2UA 2Z0NA 3RPMA 3DPQA 2YL8A 2EWFA 4EZYA 2O0I1 1E9VA 3VKHA 4H6HA 3DX3A 3CVRA 4AZHA 4JLCA 4NPHA 3LMFA 2YLLA 3CAZA 3BLBA 2X3XA 3I04A 2YL5A 1E1DA 3BUBA 1R33A 2F1BA 3DDGA 1OAOA 3RV0A 3DX0A 1I4LA 4JWDA 3KAVA 4G6QA 4R5KA 2KHOA 4FZSA 3L3OM 2ZXQA 4DCNC 2ND0A 3EJTA 3SYVA 2F1AA 4AZ6A 4EZQA 3H0XA 4EZWA 2YL6A 3A98A 4EZXA 5FIGA 2WINM 1YWMA 3EJPA 3D50A 4NQIA 2Z0VA 4IM0A 1U00A 3PLTA 1TQSA 1OA1A 2RAIA 1UPXA 3ABHA 2YIVX 4H6IA 3UITA 3T48A 3SBSA 3DOBA 5C5BB 4NSWA 2YIAA 4IWOA 3SOGA 3M3WA 1BPRA 3B53X
chains in the Genus database with same CATH topology
4HY9A 2YI9A 2Z8YA 1E2UA 1SUFA 2ND1A 4UDYX 3FD9A 3B52X 4JWIA 3DPQA 3C7NB 2EWFA 4HR1B 4JL9A 4UDXX 4EZYA 5TKYA 2PY6A 1ZYLA 3RV1A 3VEBA 1E9VA 3VKHA 4ILGA 4IWQA 4H6HA 3DQGA 4JNFA 3SBTB 3F7WA 4EZSA 4MQDA 4JLCA 4NPHA 3LMFA 4KIKB 3DPPA 4EZTA 4JWEA 2RT6A 4WV5A 2JNSA 1GNLA 3T49A 3GI7A 2X5CA 3I04A 4IM2A 4ILIA 1DKZA 4JWCA 4R5IA 3O3NB 1E1DA 3ER9B 4EZRA 4E81A 1OAOA 3RV0A 3ZEDA 4JWDA 2GA9D 4IM3A 4EZNA 3KAVA 1MJGA 4M0MA 4G6QA 4R5KA 2KHOA 3L3OM 2OBMA 4IW0A 1SU6A 4FL9A 2ND0A 4ILHB 2YI8A 1DKYA 3QNJA 3DPOA 4R5JA 4D8JA 1W9MA 3C7NA 4HR1A 3I01A 4EZOA 2V7YA 3ZEFA 4EZQA 4JN4A 3T47A 3H0XA 4IWPA 4EZWA 3A98A 1GN9A 4EZZA 4EZXA 2OBLA 5FIGA 2QXLA 2EX3B 2WINM 4R5LA 4R5GA 3OWGA 2NCZA 4EZVA 2N3KA 3O3MB 3D2EA 4F01A 4IM0A 1U00A 3VEAA 4KIKA 2GAFD 3B51X 3KDRA 3QA8A 1OA1A 4PO2A 2LM0A 1UPXA 4I43A 3ERCC 3N8EA 1DG4A 4EZPA 2YIVX 1Q5LA 1JQKA 4H6IA 3UITA 4HYBA 3T48A 4B9QA 3T4AG 3SBSA 1GNTA 1DKXA 3ER8C 1OA0A 3DOBA 2BPRA 7HSCA 3O3OB 4FM3A 4F00A 3KAWA 3D2FA 2YIBA 5E84A 1SU7A 2YIAA 5FLEX 4JNEA 4IWOA 2OP6A 4E3CA 4WV7A 1CKRA 3I39X 3T46A 1YUWA 1BPRA 1SU8A 4EZUA 3B53X 2QFFA 3OHXM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HY9 A;  4R5J A;  4JWE A;  4WV5 A;  3C7N A;  3T49 A;  4JWI A;  4EZO A;  3DPQ A;  3N8E A;  1DG4 A;  2V7Y A;  4EZP A;  3C7N B;  4EZQ A;  1DKZ A;  4JWC A;  3DPP A;  4R5I A;  1Q5L A;  4JN4 A;  4EZY A;  3T47 A;  4H6I A;  5TKY A;  4HYB A;  3T48 A;  4B9Q A;  4EZW A;  3T4A G;  3H0X A;  4EZZ A;  4EZX A;  1DKX A;  2QXL A;  4EZR A;  2WIN M;  4E81 A;  4EZT A;  2BPR A;  3DOB A;  7HSC A;  4R5L A;  4JWD A;  4R5G A;  4EZN A;  4F00 A;  4EZV A;  4H6H A;  3DQG A;  3D2F A;  3D2E A;  4F01 A;  4JNF A;  4R5K A;  2KHO A;  1U00 A;  5E84 A;  3L3O M;  4JNE A;  2OP6 A;  4EZU A;  4WV7 A;  4FL9 A;  4EZS A;  1CKR A;  3T46 A;  1YUW A;  1BPR A;  1DKY A;  4PO2 A;  3QNJ A;  3DPO A;  2QFF A;  3OHX M; 
#chains in the Genus database with same CATH topology
 4HY9 A;  2YI9 A;  2Z8Y A;  2ND1 A;  1TQU A;  3FD9 A;  3B52 X;  2Q13 A;  4HR1 B;  3I2W A;  2PY6 A;  3RV1 A;  3VEB A;  4IWQ A;  4JNF A;  2LXY A;  3DPP A;  4AZI A;  4AZB A;  2RT6 A;  4WV5 A;  3T49 A;  4AZC A;  2X5C A;  4ILI A;  1DKZ A;  1HWW A;  4E81 A;  3ZED A;  5C5B A;  2EFL A;  3L3P A;  3D4Y A;  3BUP A;  4IW0 A;  1SU6 A;  2FIC A;  2D1L A;  2YI8 A;  1DKY A;  3QNJ A;  2YKT A;  3DPO A;  2YL9 A;  4AVM A;  1W9M A;  4HR1 A;  3BVW A;  3BUD A;  4EZO A;  2V7Y A;  1I4D A;  3QE6 A;  4IWP A;  1GN9 A;  4I1Q A;  4EZZ A;  2OBL A;  2QXL A;  4ATM A;  3OWG A;  4H8S A;  2Q12 A;  2GAF D;  4BNE A;  3KDR A;  3LLL A;  3QA8 A;  4I43 A;  1DG4 A;  4EZP A;  1Q5L A;  2FYV A;  1LQ7 A;  4HYB A;  4B9Q A;  2WYH A;  3T4A G;  2BPR A;  1R34 A;  4FM3 A;  3BVT A;  1O7D B;  3EJQ A;  4DYL A;  2F7P A;  5E84 A;  1SU7 A;  2F7O A;  4JNE A;  3DX4 A;  1CKR A;  3CZS A;  3VEA A;  4EZU A;  4FZO A;  1SUF A;  4UDY X;  3C7N B;  1TQW A;  4JL9 A;  2RAK A;  1TQV A;  3DYT A;  1ZYL A;  3CKD A;  2F18 A;  3HAI A;  4ILG A;  3D52 A;  3DQG A;  1QWU A;  3SBT B;  3F7W A;  4MQD A;  2JNK A;  3BVU A;  4KIK B;  4EZT A;  1QX1 A;  1GNL A;  3EJU A;  4JWC A;  4R5I A;  3D4Z A;  3O3N B;  3ER9 B;  3CV5 A;  2GA9 D;  4IM3 A;  4EZN A;  2ALW A;  1MJG A;  3QNI A;  1ZWW A;  3EJR A;  2OZN B;  1HTY A;  4R5J A;  1X03 A;  3QWE A;  4D8J A;  3C7N A;  3I01 A;  2Z0O A;  3CZN A;  1I49 A;  2EFK A;  4JN4 A;  2EX3 B;  2PMR A;  4R5G A;  2QKW A;  2NCZ A;  3O3M B;  3D2E A;  4F01 A;  3DDF A;  4KIK A;  3B51 X;  1TQT A;  3DX1 A;  3OK8 A;  3ACO A;  1PS3 A;  5KBP A;  2YLA A;  2GF4 A;  1DKX A;  7HSC A;  3O3O B;  2F7Q A;  3LVT A;  2MI7 A;  4WV7 A;  3I39 X;  3T46 A;  1YUW A;  3OHX M;  4JWI A;  2ELB A;  4UDX X;  5TKY A;  1URU A;  1O7D C;  4AZ5 A;  4EZS A;  3Q0K A;  1WDZ A;  4AKV A;  3BVX A;  4JWE A;  2JNS A;  3GI7 A;  1HXK A;  4IM2 A;  2X3V A;  3HAJ A;  4EZR A;  2F7R A;  4AZG A;  4M0M A;  4WPE A;  2OBM A;  4FL9 A;  4ILH B;  2RAJ A;  3BUI A;  3ZEF A;  4AZC B;  2OO2 A;  3T47 A;  2X3W A;  1I4T A;  4R5L A;  3BUQ A;  2V0O A;  4EZV A;  2N3K A;  3D51 A;  3BVV A;  4PO2 A;  2LM0 A;  3ERC C;  4WPC A;  1Y2O A;  3HAH A;  3N8E A;  1R5E A;  1JQK A;  1GNT A;  1X04 A;  4AZ7 A;  3ER8 C;  1OA0 A;  4F00 A;  3KAW A;  1QWN A;  4FZP A;  3D2F A;  2OW7 A;  2YIB A;  3G9G A;  5FLE X;  2WYI A;  2C08 A;  2OP6 A;  4E3C A;  3DX2 A;  1SU8 A;  3EJS A;  3Q84 A;  2QFF A;  2D4C A;  2OW6 A;  1E2U A;  2Z0N A;  3RPM A;  3DPQ A;  2YL8 A;  2EWF A;  4EZY A;  2O0I 1;  1E9V A;  3VKH A;  4H6H A;  3DX3 A;  3CVR A;  4AZH A;  4JLC A;  4NPH A;  3LMF A;  2YLL A;  3CAZ A;  3BLB A;  2X3X A;  3I04 A;  2YL5 A;  1E1D A;  3BUB A;  1R33 A;  2F1B A;  3DDG A;  1OAO A;  3RV0 A;  3DX0 A;  1I4L A;  4JWD A;  3KAV A;  4G6Q A;  4R5K A;  2KHO A;  4FZS A;  3L3O M;  2ZXQ A;  4DCN C;  2ND0 A;  3EJT A;  3SYV A;  2F1A A;  4AZ6 A;  4EZQ A;  3H0X A;  4EZW A;  2YL6 A;  3A98 A;  4EZX A;  5FIG A;  2WIN M;  1YWM A;  3EJP A;  3D50 A;  4NQI A;  2Z0V A;  4IM0 A;  1U00 A;  3PLT A;  1TQS A;  1OA1 A;  2RAI A;  1UPX A;  3ABH A;  2YIV X;  4H6I A;  3UIT A;  3T48 A;  3SBS A;  3DOB A;  5C5B B;  4NSW A;  2YIA A;  4IWO A;  3SOG A;  3M3W A;  1BPR A;  3B53 X; 
#chains in the Genus database with same CATH homology
 4HY9 A;  2YI9 A;  2Z8Y A;  1E2U A;  1SUF A;  2ND1 A;  4UDY X;  3FD9 A;  3B52 X;  4JWI A;  3DPQ A;  3C7N B;  2EWF A;  4HR1 B;  4JL9 A;  4UDX X;  4EZY A;  5TKY A;  2PY6 A;  1ZYL A;  3RV1 A;  3VEB A;  1E9V A;  3VKH A;  4ILG A;  4IWQ A;  4H6H A;  3DQG A;  4JNF A;  3SBT B;  3F7W A;  4EZS A;  4MQD A;  4JLC A;  4NPH A;  3LMF A;  4KIK B;  3DPP A;  4EZT A;  4JWE A;  2RT6 A;  4WV5 A;  2JNS A;  1GNL A;  3T49 A;  3GI7 A;  2X5C A;  3I04 A;  4IM2 A;  4ILI A;  1DKZ A;  4JWC A;  4R5I A;  3O3N B;  1E1D A;  3ER9 B;  4EZR A;  4E81 A;  1OAO A;  3RV0 A;  3ZED A;  4JWD A;  2GA9 D;  4IM3 A;  4EZN A;  3KAV A;  1MJG A;  4M0M A;  4G6Q A;  4R5K A;  2KHO A;  3L3O M;  2OBM A;  4IW0 A;  1SU6 A;  4FL9 A;  2ND0 A;  4ILH B;  2YI8 A;  1DKY A;  3QNJ A;  3DPO A;  4R5J A;  4D8J A;  1W9M A;  3C7N A;  4HR1 A;  3I01 A;  4EZO A;  2V7Y A;  3ZEF A;  4EZQ A;  4JN4 A;  3T47 A;  3H0X A;  4IWP A;  4EZW A;  3A98 A;  1GN9 A;  4EZZ A;  4EZX A;  2OBL A;  5FIG A;  2QXL A;  2EX3 B;  2WIN M;  4R5L A;  4R5G A;  3OWG A;  2NCZ A;  4EZV A;  2N3K A;  3O3M B;  3D2E A;  4F01 A;  4IM0 A;  1U00 A;  3VEA A;  4KIK A;  2GAF D;  3B51 X;  3KDR A;  3QA8 A;  1OA1 A;  4PO2 A;  2LM0 A;  1UPX A;  4I43 A;  3ERC C;  3N8E A;  1DG4 A;  4EZP A;  2YIV X;  1Q5L A;  1JQK A;  4H6I A;  3UIT A;  4HYB A;  3T48 A;  4B9Q A;  3T4A G;  3SBS A;  1GNT A;  1DKX A;  3ER8 C;  1OA0 A;  3DOB A;  2BPR A;  7HSC A;  3O3O B;  4FM3 A;  4F00 A;  3KAW A;  3D2F A;  2YIB A;  5E84 A;  1SU7 A;  2YIA A;  5FLE X;  4JNE A;  4IWO A;  2OP6 A;  4E3C A;  4WV7 A;  1CKR A;  3I39 X;  3T46 A;  1YUW A;  1BPR A;  1SU8 A;  4EZU A;  3B53 X;  2QFF A;  3OHX M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...