4EZVA

Crystal structure of the substrate binding domain of e.coli dnak in complex with pr-bombesin in space group p21212
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
219
structure length
219
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural studies of DnaK in complex with proline rich antimicrobial peptides reveal two different peptide binding modes
rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
total genus 65
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezvA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezvA01
4JN4A 3N8EA 1DKYA 4JNFA 4JNEA 4EZWA 4EZXA 5TKYA 2QFFA 4EZPA 4R5IA 3D2FA 3T47A 3QNJA 4R5GA 3DOBA 3H0XA 4B9QA 4R5LA 1DKZA 3T4AG 1Q5LA 2OP6A 4EZTA 1YUWA 3D2EA 4HYBA 4JWCA 4JWEA 4JWIA 4R5JA 4EZQA 4H6HA 3DPOA 3L3OM 4JWDA 4WV5A 3DPPA 4EZZA 3C7NB 4R5KA 4EZOA 4H6IA 5E84A 4EZRA 2KHOA 3OHXM 1DKXA 4E81A 4F00A 4EZSA 4EZYA 4EZUA 2QXLA 4EZNA 1CKRA 4WV7A 2V7YA 3T49A 1DG4A 3C7NA 3DPQA 3T48A 3DQGA 7HSCA 4F01A 4HY9A 1U00A 3T46A 4FL9A 4PO2A 2WINM 1BPRA 4EZVA 2BPRA
chains in the Genus database with same CATH superfamily
3VEBA 4IWQA 4EZWA 3QNJA 3H0XA 3T4AG 1SU6A 2MI7A 4AZCA 4D8JA 2PMRA 3BVXA 4ILIA 4FM3A 2X5CA 7HSCA 3BUDA 2YIBA 3RV1A 3CV5A 1HTYA 2JNKA 4EZPA 2ELBA 4G6QA 2Z0NA 3DOBA 1HXKA 2RAJA 4B9QA 4MQDA 1O7DC 3HAJA 1LQ7A 4ILGA 4I1QA 3M3WA 4BNEA 5FLEX 4JLCA 4AZ5A 2QKWA 1GNLA 1I4LA 2YLAA 4NQIA 2YL5A 3T48A 2YIVX 3LLLA 3O3MB 1DKYA 4AZ7A 4EZXA 1O7DB 2QFFA 1PS3A 1WDZA 4IM2A 2RAIA 5FIGA 4AZHA 3G9GA 1E1DA 4HYBA 4JWIA 1TQSA 3L3PA 3D4ZA 3RV0A 2V7YA 3A98A 4ATMA 2OO2A 3EJPA 3BLBA 4IW0A 2YI9A 2OW7A 4R5GA 4HR1B 3BUPA 1TQVA 2OBLA 3EJTA 4H6IA 3OHXM 1QWUA 1SU8A 1SUFA 1X04A 3EJUA 2F1AA 3T46A 3O3OB 2WYIA 2FYVA 2X3WA 3VKHA 2F1BA 3BVWA 3EJRA 2C08A 3SBTB 3EJQA 4JL9A 2JNSA 3T49A 3ER8C 1R33A 3BVVA 1I49A 4JNFA 4JNEA 2ALWA 4R5IA 4KIKB 1QWNA 4DCNC 3DPPA 4EZZA 1E2UA 4HR1A 3PLTA 1YWMA 3DX2A 2NCZA 3QE6A 1TQUA 1W9MA 2O0I1 3B51X 1U00A 4FL9A 3FD9A 3ERCC 3Q84A 1YUWA 3LMFA 2X3XA 3DDGA 3I39X 4FZOA 4WPCA 4AZGA 3HAIA 2Z0VA 4F01A 3Q0KA 3N8EA 4EZVA 2FICA 1I4TA 3GI7A 3F7WA 4IM0A 2OZNB 3O3NB 2OP6A 3RPMA 1R34A 2ZXQA 4H6HA 4AZIA 4KIKA 4WV5A 3DYTA 4IWPA 3C7NB 3DX3A 3SOGA 4WV7A 1JQKA 2V0OA 3DPQA 3DDFA 4PO2A 1BPRA 3EJSA 4NPHA 3ZEDA 2F7OA 1OA1A 4AZ6A 3CZSA 4UDXX 3HAHA 2ND1A 1SU7A 4E81A 2QXLA 2YKTA 2YL9A 1GN9A 3I2WA 3BVTA 4R5LA 5C5BB 4I43A 3D50A 5KBPA 4EZTA 3ACOA 1X03A 4EZQA 1TQWA 3ABHA 2D1LA 5E84A 1TQTA 2F7RA 4F00A 2Q13A 1CKRA 2RT6A 2X3VA 3C7NA 1E9VA 4JN4A 3D4YA 2GF4A 3DX1A 4AVMA 1URUA 2Z0OA 5TKYA 3D51A 1DKZA 3D52A 3QA8A 4R5JA 3CKDA 4DYLA 3KDRA 3KAVA 2OW6A 4EZNA 1DG4A 4AKVA 1QX1A 3SYVA 4FZPA 3CAZA 2EX3B 4E3CA 3DX0A 1I4DA 3B53X 4JWCA 3QWEA 3L3OM 2RAKA 5C5BA 4R5KA 2EWFA 4EZSA 4EZUA 3I01A 2YLLA 2OBMA 3BUIA 2D4CA 2KHOA 4EZYA 2N3KA 1R5EA 4AZBA 4IWOA 2Q12A 3SBSA 2WYHA 3CZNA 3BUQA 3OWGA 4H8SA 2ND0A 1UPXA 3ER9B 2YI8A 3ZEFA 3D2FA 1ZYLA 1Q5LA 2YIAA 1ZWWA 3UITA 4EZOA 1HWWA 3B52X 4UDYX 2Z8YA 1GNTA 3CVRA 4AZCB 3QNIA 2PY6A 1OA0A 2F7PA 4ILHB 3OK8A 4JWEA 3DPOA 2EFKA 2EFLA 2LXYA 1DKXA 2F18A 2GA9D 4HY9A 2YL6A 4M0MA 2F7QA 3T47A 3KAWA 3D2EA 2YL8A 4JWDA 4WPEA 2GAFD 3LVTA 4IM3A 3I04A 4EZRA 3BUBA 4FZSA 2LM0A 3DX4A 1MJGA 1OAOA 3DQGA 4NSWA 1Y2OA 3VEAA 2WINM 3BVUA 2BPRA
chains in the Genus database with same CATH topology
2N3KA 3VEBA 4IWQA 4EZWA 4IWOA 3VKHA 4NPHA 3QNJA 3H0XA 3ZEDA 3T4AG 1SU6A 3SBSA 4D8JA 1OA1A 4UDXX 4ILIA 3SBTB 2ND1A 1SU7A 4FM3A 3OWGA 4JL9A 4E81A 2JNSA 2ND0A 2QXLA 3T49A 1UPXA 2X5CA 7HSCA 3ER9B 3ER8C 2YIBA 3RV1A 1GN9A 4JNFA 4JNEA 2YI8A 4EZPA 3ZEFA 4R5IA 4G6QA 3D2FA 4KIKB 1ZYLA 3DOBA 4B9QA 4R5LA 4I43A 1Q5LA 4MQDA 4EZTA 4EZQA 2YIAA 4ILGA 3DPPA 4EZZA 1E2UA 4HR1A 3UITA 4EZOA 5FLEX 4JLCA 5E84A 1GNLA 2KHOA 2NCZA 4F00A 1CKRA 1W9MA 3B52X 2RT6A 3C7NA 3T48A 3B51X 2YIVX 4UDYX 1U00A 1E9VA 3O3MB 4FL9A 2Z8YA 1GNTA 4JN4A 1DKYA 2PY6A 4EZXA 3FD9A 5TKYA 2QFFA 4IM2A 1OA0A 3ERCC 5FIGA 1DKZA 4ILHB 1YUWA 1E1DA 3LMFA 4HYBA 3O3OB 3QA8A 4JWEA 4JWIA 4R5JA 3DPOA 3I39X 3KDRA 3KAVA 1DKXA 3RV0A 4EZNA 2V7YA 1DG4A 2GA9D 4F01A 4HY9A 3A98A 3N8EA 4EZVA 4M0MA 2EX3B 4E3CA 3GI7A 3F7WA 4IW0A 2YI9A 3T47A 4IM0A 4R5GA 3KAWA 4HR1B 3O3NB 2OP6A 3B53X 3D2EA 4JWCA 4H6HA 3L3OM 2OBLA 4JWDA 4KIKA 4WV5A 2GAFD 4IWPA 4R5KA 3C7NB 2EWFA 4H6IA 4IM3A 3I04A 4EZRA 3OHXM 4EZSA 2LM0A 4EZUA 3I01A 1SU8A 4WV7A 1JQKA 1MJGA 1OAOA 1SUFA 3DPQA 3DQGA 2OBMA 3T46A 3VEAA 4PO2A 2WINM 1BPRA 4EZYA 2BPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JN4 A;  3N8E A;  1DKY A;  4JNF A;  4JNE A;  4EZW A;  4EZX A;  5TKY A;  2QFF A;  4EZP A;  4R5I A;  3D2F A;  3T47 A;  3QNJ A;  4R5G A;  3DOB A;  3H0X A;  4B9Q A;  4R5L A;  1DKZ A;  3T4A G;  1Q5L A;  2OP6 A;  4EZT A;  1YUW A;  3D2E A;  4HYB A;  4JWC A;  4JWE A;  4JWI A;  4R5J A;  4EZQ A;  4H6H A;  3DPO A;  3L3O M;  4JWD A;  4WV5 A;  3DPP A;  4EZZ A;  3C7N B;  4R5K A;  4EZO A;  4H6I A;  5E84 A;  4EZR A;  2KHO A;  3OHX M;  1DKX A;  4E81 A;  4F00 A;  4EZS A;  4EZY A;  4EZU A;  2QXL A;  4EZN A;  1CKR A;  4WV7 A;  2V7Y A;  3T49 A;  1DG4 A;  3C7N A;  3DPQ A;  3T48 A;  3DQG A;  7HSC A;  4F01 A;  4HY9 A;  1U00 A;  3T46 A;  4FL9 A;  4PO2 A;  2WIN M;  1BPR A;  4EZV A;  2BPR A; 
#chains in the Genus database with same CATH topology
 3VEB A;  4IWQ A;  4EZW A;  3QNJ A;  3H0X A;  3T4A G;  1SU6 A;  2MI7 A;  4AZC A;  4D8J A;  2PMR A;  3BVX A;  4ILI A;  4FM3 A;  2X5C A;  7HSC A;  3BUD A;  2YIB A;  3RV1 A;  3CV5 A;  1HTY A;  2JNK A;  4EZP A;  2ELB A;  4G6Q A;  2Z0N A;  3DOB A;  1HXK A;  2RAJ A;  4B9Q A;  4MQD A;  1O7D C;  3HAJ A;  1LQ7 A;  4ILG A;  4I1Q A;  3M3W A;  4BNE A;  5FLE X;  4JLC A;  4AZ5 A;  2QKW A;  1GNL A;  1I4L A;  2YLA A;  4NQI A;  2YL5 A;  3T48 A;  2YIV X;  3LLL A;  3O3M B;  1DKY A;  4AZ7 A;  4EZX A;  1O7D B;  2QFF A;  1PS3 A;  1WDZ A;  4IM2 A;  2RAI A;  5FIG A;  4AZH A;  3G9G A;  1E1D A;  4HYB A;  4JWI A;  1TQS A;  3L3P A;  3D4Z A;  3RV0 A;  2V7Y A;  3A98 A;  4ATM A;  2OO2 A;  3EJP A;  3BLB A;  4IW0 A;  2YI9 A;  2OW7 A;  4R5G A;  4HR1 B;  3BUP A;  1TQV A;  2OBL A;  3EJT A;  4H6I A;  3OHX M;  1QWU A;  1SU8 A;  1SUF A;  1X04 A;  3EJU A;  2F1A A;  3T46 A;  3O3O B;  2WYI A;  2FYV A;  2X3W A;  3VKH A;  2F1B A;  3BVW A;  3EJR A;  2C08 A;  3SBT B;  3EJQ A;  4JL9 A;  2JNS A;  3T49 A;  3ER8 C;  1R33 A;  3BVV A;  1I49 A;  4JNF A;  4JNE A;  2ALW A;  4R5I A;  4KIK B;  1QWN A;  4DCN C;  3DPP A;  4EZZ A;  1E2U A;  4HR1 A;  3PLT A;  1YWM A;  3DX2 A;  2NCZ A;  3QE6 A;  1TQU A;  1W9M A;  2O0I 1;  3B51 X;  1U00 A;  4FL9 A;  3FD9 A;  3ERC C;  3Q84 A;  1YUW A;  3LMF A;  2X3X A;  3DDG A;  3I39 X;  4FZO A;  4WPC A;  4AZG A;  3HAI A;  2Z0V A;  4F01 A;  3Q0K A;  3N8E A;  4EZV A;  2FIC A;  1I4T A;  3GI7 A;  3F7W A;  4IM0 A;  2OZN B;  3O3N B;  2OP6 A;  3RPM A;  1R34 A;  2ZXQ A;  4H6H A;  4AZI A;  4KIK A;  4WV5 A;  3DYT A;  4IWP A;  3C7N B;  3DX3 A;  3SOG A;  4WV7 A;  1JQK A;  2V0O A;  3DPQ A;  3DDF A;  4PO2 A;  1BPR A;  3EJS A;  4NPH A;  3ZED A;  2F7O A;  1OA1 A;  4AZ6 A;  3CZS A;  4UDX X;  3HAH A;  2ND1 A;  1SU7 A;  4E81 A;  2QXL A;  2YKT A;  2YL9 A;  1GN9 A;  3I2W A;  3BVT A;  4R5L A;  5C5B B;  4I43 A;  3D50 A;  5KBP A;  4EZT A;  3ACO A;  1X03 A;  4EZQ A;  1TQW A;  3ABH A;  2D1L A;  5E84 A;  1TQT A;  2F7R A;  4F00 A;  2Q13 A;  1CKR A;  2RT6 A;  2X3V A;  3C7N A;  1E9V A;  4JN4 A;  3D4Y A;  2GF4 A;  3DX1 A;  4AVM A;  1URU A;  2Z0O A;  5TKY A;  3D51 A;  1DKZ A;  3D52 A;  3QA8 A;  4R5J A;  3CKD A;  4DYL A;  3KDR A;  3KAV A;  2OW6 A;  4EZN A;  1DG4 A;  4AKV A;  1QX1 A;  3SYV A;  4FZP A;  3CAZ A;  2EX3 B;  4E3C A;  3DX0 A;  1I4D A;  3B53 X;  4JWC A;  3QWE A;  3L3O M;  2RAK A;  5C5B A;  4R5K A;  2EWF A;  4EZS A;  4EZU A;  3I01 A;  2YLL A;  2OBM A;  3BUI A;  2D4C A;  2KHO A;  4EZY A;  2N3K A;  1R5E A;  4AZB A;  4IWO A;  2Q12 A;  3SBS A;  2WYH A;  3CZN A;  3BUQ A;  3OWG A;  4H8S A;  2ND0 A;  1UPX A;  3ER9 B;  2YI8 A;  3ZEF A;  3D2F A;  1ZYL A;  1Q5L A;  2YIA A;  1ZWW A;  3UIT A;  4EZO A;  1HWW A;  3B52 X;  4UDY X;  2Z8Y A;  1GNT A;  3CVR A;  4AZC B;  3QNI A;  2PY6 A;  1OA0 A;  2F7P A;  4ILH B;  3OK8 A;  4JWE A;  3DPO A;  2EFK A;  2EFL A;  2LXY A;  1DKX A;  2F18 A;  2GA9 D;  4HY9 A;  2YL6 A;  4M0M A;  2F7Q A;  3T47 A;  3KAW A;  3D2E A;  2YL8 A;  4JWD A;  4WPE A;  2GAF D;  3LVT A;  4IM3 A;  3I04 A;  4EZR A;  3BUB A;  4FZS A;  2LM0 A;  3DX4 A;  1MJG A;  1OAO A;  3DQG A;  4NSW A;  1Y2O A;  3VEA A;  2WIN M;  3BVU A;  2BPR A; 
#chains in the Genus database with same CATH homology
 2N3K A;  3VEB A;  4IWQ A;  4EZW A;  4IWO A;  3VKH A;  4NPH A;  3QNJ A;  3H0X A;  3ZED A;  3T4A G;  1SU6 A;  3SBS A;  4D8J A;  1OA1 A;  4UDX X;  4ILI A;  3SBT B;  2ND1 A;  1SU7 A;  4FM3 A;  3OWG A;  4JL9 A;  4E81 A;  2JNS A;  2ND0 A;  2QXL A;  3T49 A;  1UPX A;  2X5C A;  7HSC A;  3ER9 B;  3ER8 C;  2YIB A;  3RV1 A;  1GN9 A;  4JNF A;  4JNE A;  2YI8 A;  4EZP A;  3ZEF A;  4R5I A;  4G6Q A;  3D2F A;  4KIK B;  1ZYL A;  3DOB A;  4B9Q A;  4R5L A;  4I43 A;  1Q5L A;  4MQD A;  4EZT A;  4EZQ A;  2YIA A;  4ILG A;  3DPP A;  4EZZ A;  1E2U A;  4HR1 A;  3UIT A;  4EZO A;  5FLE X;  4JLC A;  5E84 A;  1GNL A;  2KHO A;  2NCZ A;  4F00 A;  1CKR A;  1W9M A;  3B52 X;  2RT6 A;  3C7N A;  3T48 A;  3B51 X;  2YIV X;  4UDY X;  1U00 A;  1E9V A;  3O3M B;  4FL9 A;  2Z8Y A;  1GNT A;  4JN4 A;  1DKY A;  2PY6 A;  4EZX A;  3FD9 A;  5TKY A;  2QFF A;  4IM2 A;  1OA0 A;  3ERC C;  5FIG A;  1DKZ A;  4ILH B;  1YUW A;  1E1D A;  3LMF A;  4HYB A;  3O3O B;  3QA8 A;  4JWE A;  4JWI A;  4R5J A;  3DPO A;  3I39 X;  3KDR A;  3KAV A;  1DKX A;  3RV0 A;  4EZN A;  2V7Y A;  1DG4 A;  2GA9 D;  4F01 A;  4HY9 A;  3A98 A;  3N8E A;  4EZV A;  4M0M A;  2EX3 B;  4E3C A;  3GI7 A;  3F7W A;  4IW0 A;  2YI9 A;  3T47 A;  4IM0 A;  4R5G A;  3KAW A;  4HR1 B;  3O3N B;  2OP6 A;  3B53 X;  3D2E A;  4JWC A;  4H6H A;  3L3O M;  2OBL A;  4JWD A;  4KIK A;  4WV5 A;  2GAF D;  4IWP A;  4R5K A;  3C7N B;  2EWF A;  4H6I A;  4IM3 A;  3I04 A;  4EZR A;  3OHX M;  4EZS A;  2LM0 A;  4EZU A;  3I01 A;  1SU8 A;  4WV7 A;  1JQK A;  1MJG A;  1OAO A;  1SUF A;  3DPQ A;  3DQG A;  2OBM A;  3T46 A;  3VEA A;  4PO2 A;  2WIN M;  1BPR A;  4EZY A;  2BPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...