4EZVA

Crystal structure of the substrate binding domain of e.coli dnak in complex with pr-bombesin in space group p21212
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
219
structure length
219
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural studies of DnaK in complex with proline rich antimicrobial peptides reveal two different peptide binding modes
rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
total genus 65
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezvA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezvA01
4EZVA 4R5GA 4EZQA 2WINM 4EZRA 5E84A 4EZSA 2OP6A 3DPPA 3T48A 4E81A 4EZUA 4JN4A 4EZYA 4PO2A 1YUWA 3C7NB 1DKYA 3QNJA 4JNFA 3DPOA 3T47A 4EZPA 3DQGA 2QXLA 4JWEA 4H6IA 4EZWA 4R5IA 4EZOA 1CKRA 4F00A 4EZTA 1DG4A 4R5JA 4R5LA 4JWDA 4EZNA 1DKXA 4EZZA 3T49A 4F01A 4R5KA 3DOBA 2V7YA 2KHOA 1U00A 3T4AG 3D2FA 4HYBA 4H6HA 7HSCA 4B9QA 1DKZA 1Q5LA 4WV7A 3H0XA 4EZXA 3D2EA 2BPRA 4JWCA 4FL9A 4JNEA 4WV5A 3L3OM 2QFFA 3DPQA 3OHXM 3C7NA 1BPRA 3N8EA 3T46A 4JWIA 4HY9A 5TKYA
chains in the Genus database with same CATH superfamily
3BVVA 2Q13A 4NQIA 4FM3A 3QWEA 1TQSA 4HR1A 3CVRA 3D50A 3LMFA 2ZXQA 5KBPA 2EWFA 4EZXA 4I43A 3CKDA 2Z0NA 3VEAA 3L3OM 2GA9D 4EZVA 3BVXA 4EZRA 2PMRA 4IM0A 3EJTA 3UITA 2YI8A 3BUIA 1R33A 1I4LA 3EJRA 2O0I1 1I4DA 5FIGA 1UPXA 1E2UA 2FYVA 3QA8A 4MQDA 3VKHA 4ILHB 1DKYA 1OA1A 1HTYA 2YI9A 1DKXA 3SYVA 1O7DC 3I01A 3T4AG 1MJGA 2ND0A 4FZSA 3G9GA 2GAFD 3I39X 3T46A 3DDGA 2YLAA 5TKYA 3DX4A 3C7NB 4EZWA 4FZPA 4AZHA 4HR1B 3EJSA 3ACOA 1X03A 3GI7A 4AZGA 3PLTA 3BVWA 3SOGA 3O3NB 1LQ7A 3DX3A 2D4CA 4EZPA 4ATMA 4F00A 1X04A 1TQVA 1I49A 3DX2A 2OBMA 2V0OA 4WPCA 2RAJA 4AZBA 1E9VA 3D51A 1HWWA 1BPRA 4JWIA 1O7DB 3KAVA 2YIAA 1SU6A 4FZOA 3BUQA 2PY6A 4KIKA 1GNLA 2RT6A 2EFKA 3I2WA 4WV7A 4M0MA 3D52A 2ND1A 4UDYX 3ABHA 4NPHA 1Y2OA 3LVTA 2YLLA 5E84A 4EZSA 2F18A 1YUWA 2X3WA 3T49A 3BUBA 3LLLA 3ER8C 4JLCA 1SU8A 3D2FA 1WDZA 1R5EA 4IM2A 3DX1A 2YIVX 3DPQA 3OWGA 3Q84A 4R5GA 4H8SA 2OP6A 4PO2A 4AZ6A 3QNJA 4JNFA 1ZWWA 1URUA 4AZCA 2D1LA 4R5KA 4IWQA 4HYBA 7HSCA 4B9QA 3O3OB 3OK8A 2YIBA 1GN9A 3D4ZA 3QNIA 2OW6A 3I04A 1SUFA 1HXKA 3EJPA 4AKVA 4JN4A 2YL9A 2RAIA 4G6QA 4JWDA 3KAWA 3VEBA 3BVTA 4I1QA 2V7YA 3KDRA 4H6HA 3ERCC 2LM0A 3OHXM 4UDXX 4EZQA 2F7RA 2EX3B 3ZEDA 1OA0A 1YWMA 2F1BA 4IW0A 3DPOA 3CAZA 2NCZA 1SU7A 2JNSA 2YL5A 3B52X 2WYHA 2OBLA 1OAOA 2RAKA 2OZNB 1R34A 4E3CA 3SBSA 1TQUA 3BLBA 1QX1A 4EZUA 2X5CA 3FD9A 2C08A 4JWEA 4EZTA 3A98A 2YL6A 2KHOA 1U00A 3B53X 4AZCB 4D8JA 1TQTA 1E1DA 3DYTA 4WPEA 1CKRA 2WYIA 4IWPA 4BNEA 3DX0A 3DQGA 2F7QA 4DCNC 1DG4A 2F7OA 2ELBA 3BUDA 4AVMA 3DOBA 4DYLA 4IWOA 4JWCA 2JNKA 4JNEA 3SBTB 1TQWA 2OW7A 3EJQA 4HY9A 2X3VA 1ZYLA 3DPPA 4E81A 2QXLA 4AZ5A 1I4TA 2X3XA 4H6IA 2F1AA 5C5BA 1QWNA 3L3PA 1DKZA 3H0XA 1W9MA 4FL9A 3B51X 2Z0VA 2FICA 2EFLA 4IM3A 2MI7A 2YL8A 5FLEX 3HAIA 4EZNA 3BVUA 3M3WA 3ER9B 2N3KA 4KIKB 3O3MB 3Q0KA 4JL9A 2QKWA 3HAJA 2BPRA 3ZEFA 4ILIA 3D4YA 3N8EA 2YKTA 3BUPA 2GF4A 3RV0A 2WINM 4AZIA 1GNTA 3RPMA 3T47A 4R5IA 4R5LA 3CV5A 4EZZA 1Q5LA 3D2EA 1JQKA 2Z0OA 1QWUA 2QFFA 3EJUA 3QE6A 3T48A 4EZYA 1PS3A 3F7WA 4NSWA 3RV1A 3DDFA 2F7PA 2ALWA 4EZOA 2LXYA 3CZSA 4R5JA 4F01A 3CZNA 4ILGA 2Q12A 2Z8YA 4AZ7A 5C5BB 2OO2A 4WV5A 3C7NA 3HAHA
chains in the Genus database with same CATH topology
1ZYLA 3DPPA 4E81A 4JN4A 4FM3A 4EZPA 2QXLA 4H6IA 4G6QA 4F00A 4HR1A 4JWDA 3KAWA 3LMFA 3VEBA 2V7YA 3KDRA 2EWFA 2OBMA 4H6HA 3ERCC 1DKZA 3H0XA 4EZXA 2LM0A 4I43A 1W9MA 4FL9A 1E9VA 3VEAA 3L3OM 1BPRA 3OHXM 3B51X 4JWIA 2GA9D 4UDXX 4EZVA 4IM3A 4EZQA 3KAVA 2EX3B 2YIAA 3ZEDA 1OA0A 4EZRA 1SU6A 4IM0A 4IW0A 3DPOA 5FLEX 3UITA 2PY6A 4KIKA 2YI8A 1GNLA 4EZNA 2RT6A 2NCZA 1SU7A 2JNSA 3ER9B 2N3KA 3B52X 4KIKB 3O3MB 4WV7A 4JL9A 4M0MA 2BPRA 3ZEFA 2OBLA 4ILIA 5FIGA 2ND1A 1OAOA 1UPXA 3N8EA 1E2UA 4UDYX 4NPHA 4E3CA 3SBSA 3QA8A 4MQDA 3RV0A 2WINM 5E84A 4EZSA 4EZUA 1YUWA 3VKHA 2X5CA 4ILHB 1GNTA 1DKYA 3FD9A 3T47A 4JWEA 4R5IA 1OA1A 4EZTA 2YI9A 4R5LA 1DKXA 4EZZA 3T49A 3A98A 3ER8C 4JLCA 3I01A 2KHOA 1U00A 3B53X 1SU8A 3D2FA 3T4AG 1MJGA 2ND0A 4D8JA 1Q5LA 1E1DA 3D2EA 1JQKA 4IM2A 3OWGA 2QFFA 2GAFD 2YIVX 3DPQA 3I39X 3T46A 5TKYA 1CKRA 4R5GA 2OP6A 4PO2A 3T48A 4EZYA 3F7WA 3RV1A 3C7NB 4IWPA 3QNJA 4JNFA 3DQGA 4EZWA 4EZOA 1DG4A 4R5JA 4F01A 4R5KA 4IWQA 3DOBA 4HR1B 4HYBA 7HSCA 4IWOA 4ILGA 4B9QA 3O3OB 2Z8YA 2YIBA 1GN9A 4JWCA 3GI7A 4JNEA 4WV5A 3SBTB 3I04A 1SUFA 3C7NA 3O3NB 4HY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZV A;  4R5G A;  4EZQ A;  2WIN M;  4EZR A;  5E84 A;  4EZS A;  2OP6 A;  3DPP A;  3T48 A;  4E81 A;  4EZU A;  4JN4 A;  4EZY A;  4PO2 A;  1YUW A;  3C7N B;  1DKY A;  3QNJ A;  4JNF A;  3DPO A;  3T47 A;  4EZP A;  3DQG A;  2QXL A;  4JWE A;  4H6I A;  4EZW A;  4R5I A;  4EZO A;  1CKR A;  4F00 A;  4EZT A;  1DG4 A;  4R5J A;  4R5L A;  4JWD A;  4EZN A;  1DKX A;  4EZZ A;  3T49 A;  4F01 A;  4R5K A;  3DOB A;  2V7Y A;  2KHO A;  1U00 A;  3T4A G;  3D2F A;  4HYB A;  4H6H A;  7HSC A;  4B9Q A;  1DKZ A;  1Q5L A;  4WV7 A;  3H0X A;  4EZX A;  3D2E A;  2BPR A;  4JWC A;  4FL9 A;  4JNE A;  4WV5 A;  3L3O M;  2QFF A;  3DPQ A;  3OHX M;  3C7N A;  1BPR A;  3N8E A;  3T46 A;  4JWI A;  4HY9 A;  5TKY A; 
#chains in the Genus database with same CATH topology
 3BVV A;  2Q13 A;  4NQI A;  4FM3 A;  3QWE A;  1TQS A;  4HR1 A;  3CVR A;  3D50 A;  3LMF A;  2ZXQ A;  5KBP A;  2EWF A;  4EZX A;  4I43 A;  3CKD A;  2Z0N A;  3VEA A;  3L3O M;  2GA9 D;  4EZV A;  3BVX A;  4EZR A;  2PMR A;  4IM0 A;  3EJT A;  3UIT A;  2YI8 A;  3BUI A;  1R33 A;  1I4L A;  3EJR A;  2O0I 1;  1I4D A;  5FIG A;  1UPX A;  1E2U A;  2FYV A;  3QA8 A;  4MQD A;  3VKH A;  4ILH B;  1DKY A;  1OA1 A;  1HTY A;  2YI9 A;  1DKX A;  3SYV A;  1O7D C;  3I01 A;  3T4A G;  1MJG A;  2ND0 A;  4FZS A;  3G9G A;  2GAF D;  3I39 X;  3T46 A;  3DDG A;  2YLA A;  5TKY A;  3DX4 A;  3C7N B;  4EZW A;  4FZP A;  4AZH A;  4HR1 B;  3EJS A;  3ACO A;  1X03 A;  3GI7 A;  4AZG A;  3PLT A;  3BVW A;  3SOG A;  3O3N B;  1LQ7 A;  3DX3 A;  2D4C A;  4EZP A;  4ATM A;  4F00 A;  1X04 A;  1TQV A;  1I49 A;  3DX2 A;  2OBM A;  2V0O A;  4WPC A;  2RAJ A;  4AZB A;  1E9V A;  3D51 A;  1HWW A;  1BPR A;  4JWI A;  1O7D B;  3KAV A;  2YIA A;  1SU6 A;  4FZO A;  3BUQ A;  2PY6 A;  4KIK A;  1GNL A;  2RT6 A;  2EFK A;  3I2W A;  4WV7 A;  4M0M A;  3D52 A;  2ND1 A;  4UDY X;  3ABH A;  4NPH A;  1Y2O A;  3LVT A;  2YLL A;  5E84 A;  4EZS A;  2F18 A;  1YUW A;  2X3W A;  3T49 A;  3BUB A;  3LLL A;  3ER8 C;  4JLC A;  1SU8 A;  3D2F A;  1WDZ A;  1R5E A;  4IM2 A;  3DX1 A;  2YIV X;  3DPQ A;  3OWG A;  3Q84 A;  4R5G A;  4H8S A;  2OP6 A;  4PO2 A;  4AZ6 A;  3QNJ A;  4JNF A;  1ZWW A;  1URU A;  4AZC A;  2D1L A;  4R5K A;  4IWQ A;  4HYB A;  7HSC A;  4B9Q A;  3O3O B;  3OK8 A;  2YIB A;  1GN9 A;  3D4Z A;  3QNI A;  2OW6 A;  3I04 A;  1SUF A;  1HXK A;  3EJP A;  4AKV A;  4JN4 A;  2YL9 A;  2RAI A;  4G6Q A;  4JWD A;  3KAW A;  3VEB A;  3BVT A;  4I1Q A;  2V7Y A;  3KDR A;  4H6H A;  3ERC C;  2LM0 A;  3OHX M;  4UDX X;  4EZQ A;  2F7R A;  2EX3 B;  3ZED A;  1OA0 A;  1YWM A;  2F1B A;  4IW0 A;  3DPO A;  3CAZ A;  2NCZ A;  1SU7 A;  2JNS A;  2YL5 A;  3B52 X;  2WYH A;  2OBL A;  1OAO A;  2RAK A;  2OZN B;  1R34 A;  4E3C A;  3SBS A;  1TQU A;  3BLB A;  1QX1 A;  4EZU A;  2X5C A;  3FD9 A;  2C08 A;  4JWE A;  4EZT A;  3A98 A;  2YL6 A;  2KHO A;  1U00 A;  3B53 X;  4AZC B;  4D8J A;  1TQT A;  1E1D A;  3DYT A;  4WPE A;  1CKR A;  2WYI A;  4IWP A;  4BNE A;  3DX0 A;  3DQG A;  2F7Q A;  4DCN C;  1DG4 A;  2F7O A;  2ELB A;  3BUD A;  4AVM A;  3DOB A;  4DYL A;  4IWO A;  4JWC A;  2JNK A;  4JNE A;  3SBT B;  1TQW A;  2OW7 A;  3EJQ A;  4HY9 A;  2X3V A;  1ZYL A;  3DPP A;  4E81 A;  2QXL A;  4AZ5 A;  1I4T A;  2X3X A;  4H6I A;  2F1A A;  5C5B A;  1QWN A;  3L3P A;  1DKZ A;  3H0X A;  1W9M A;  4FL9 A;  3B51 X;  2Z0V A;  2FIC A;  2EFL A;  4IM3 A;  2MI7 A;  2YL8 A;  5FLE X;  3HAI A;  4EZN A;  3BVU A;  3M3W A;  3ER9 B;  2N3K A;  4KIK B;  3O3M B;  3Q0K A;  4JL9 A;  2QKW A;  3HAJ A;  2BPR A;  3ZEF A;  4ILI A;  3D4Y A;  3N8E A;  2YKT A;  3BUP A;  2GF4 A;  3RV0 A;  2WIN M;  4AZI A;  1GNT A;  3RPM A;  3T47 A;  4R5I A;  4R5L A;  3CV5 A;  4EZZ A;  1Q5L A;  3D2E A;  1JQK A;  2Z0O A;  1QWU A;  2QFF A;  3EJU A;  3QE6 A;  3T48 A;  4EZY A;  1PS3 A;  3F7W A;  4NSW A;  3RV1 A;  3DDF A;  2F7P A;  2ALW A;  4EZO A;  2LXY A;  3CZS A;  4R5J A;  4F01 A;  3CZN A;  4ILG A;  2Q12 A;  2Z8Y A;  4AZ7 A;  5C5B B;  2OO2 A;  4WV5 A;  3C7N A;  3HAH A; 
#chains in the Genus database with same CATH homology
 1ZYL A;  3DPP A;  4E81 A;  4JN4 A;  4FM3 A;  4EZP A;  2QXL A;  4H6I A;  4G6Q A;  4F00 A;  4HR1 A;  4JWD A;  3KAW A;  3LMF A;  3VEB A;  2V7Y A;  3KDR A;  2EWF A;  2OBM A;  4H6H A;  3ERC C;  1DKZ A;  3H0X A;  4EZX A;  2LM0 A;  4I43 A;  1W9M A;  4FL9 A;  1E9V A;  3VEA A;  3L3O M;  1BPR A;  3OHX M;  3B51 X;  4JWI A;  2GA9 D;  4UDX X;  4EZV A;  4IM3 A;  4EZQ A;  3KAV A;  2EX3 B;  2YIA A;  3ZED A;  1OA0 A;  4EZR A;  1SU6 A;  4IM0 A;  4IW0 A;  3DPO A;  5FLE X;  3UIT A;  2PY6 A;  4KIK A;  2YI8 A;  1GNL A;  4EZN A;  2RT6 A;  2NCZ A;  1SU7 A;  2JNS A;  3ER9 B;  2N3K A;  3B52 X;  4KIK B;  3O3M B;  4WV7 A;  4JL9 A;  4M0M A;  2BPR A;  3ZEF A;  2OBL A;  4ILI A;  5FIG A;  2ND1 A;  1OAO A;  1UPX A;  3N8E A;  1E2U A;  4UDY X;  4NPH A;  4E3C A;  3SBS A;  3QA8 A;  4MQD A;  3RV0 A;  2WIN M;  5E84 A;  4EZS A;  4EZU A;  1YUW A;  3VKH A;  2X5C A;  4ILH B;  1GNT A;  1DKY A;  3FD9 A;  3T47 A;  4JWE A;  4R5I A;  1OA1 A;  4EZT A;  2YI9 A;  4R5L A;  1DKX A;  4EZZ A;  3T49 A;  3A98 A;  3ER8 C;  4JLC A;  3I01 A;  2KHO A;  1U00 A;  3B53 X;  1SU8 A;  3D2F A;  3T4A G;  1MJG A;  2ND0 A;  4D8J A;  1Q5L A;  1E1D A;  3D2E A;  1JQK A;  4IM2 A;  3OWG A;  2QFF A;  2GAF D;  2YIV X;  3DPQ A;  3I39 X;  3T46 A;  5TKY A;  1CKR A;  4R5G A;  2OP6 A;  4PO2 A;  3T48 A;  4EZY A;  3F7W A;  3RV1 A;  3C7N B;  4IWP A;  3QNJ A;  4JNF A;  3DQG A;  4EZW A;  4EZO A;  1DG4 A;  4R5J A;  4F01 A;  4R5K A;  4IWQ A;  3DOB A;  4HR1 B;  4HYB A;  7HSC A;  4IWO A;  4ILG A;  4B9Q A;  3O3O B;  2Z8Y A;  2YIB A;  1GN9 A;  4JWC A;  3GI7 A;  4JNE A;  4WV5 A;  3SBT B;  3I04 A;  1SUF A;  3C7N A;  3O3N B;  4HY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...