4EZZA

Crystal structure of the substrate binding domain of e.coli dnak in complex with the designer peptide elplvki
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
218
structure length
218
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 69
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezzA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezzA01
5E84A 4R5LA 1DKXA 4EZQA 2QFFA 4JWCA 4EZNA 3DPPA 3T4AG 1DKYA 4H6HA 3T46A 1Q5LA 3DQGA 3QNJA 4JWDA 1BPRA 3C7NB 4JWEA 4FL9A 4EZRA 4R5IA 4R5KA 4EZYA 1DG4A 4H6IA 4WV5A 1DKZA 2V7YA 3D2FA 1U00A 1YUWA 2OP6A 4EZUA 4EZVA 4EZSA 4HYBA 4EZXA 4JNFA 4B9QA 4EZTA 4F01A 4JWIA 3T48A 4R5GA 3D2EA 3T47A 4WV7A 4JN4A 3C7NA 4EZZA 4E81A 4EZOA 3T49A 4PO2A 1CKRA 2KHOA 4EZPA 4JNEA 7HSCA 3DOBA 3OHXM 4EZWA 3DPQA 2WINM 4HY9A 5TKYA 3N8EA 3H0XA 2QXLA 4R5JA 2BPRA 3DPOA 4F00A 3L3OM
chains in the Genus database with same CATH superfamily
2X3VA 1E9VA 1I49A 3DDGA 3UITA 2V7YA 4KIKB 2FICA 3CAZA 4I43A 3B52X 4E81A 1CKRA 1JQKA 3QNIA 4UDYX 1O7DB 4HR1B 3OWGA 4AZIA 2MI7A 4IWQA 3SOGA 1BPRA 1W9MA 4NQIA 2F7QA 3ER9B 3D50A 4EZVA 4IM3A 3ABHA 3C7NA 2N3KA 3VEBA 2JNKA 2EWFA 3OHXM 3EJRA 3L3OM 3BVTA 4IM2A 1DKYA 2YL5A 4JWEA 2RAKA 4EZSA 1URUA 5C5BB 3DYTA 4AZHA 2C08A 3CZNA 3KAVA 1O7DC 1OA0A 4G6QA 4ILHB 3CKDA 3O3OB 3N8EA 4R5JA 1I4TA 5TKYA 3B51X 4AVMA 2OW6A 1TQSA 2F18A 3DQGA 3RPMA 3PLTA 3L3PA 2D1LA 2YL6A 3T48A 3QE6A 2OO2A 2OBLA 7HSCA 2LM0A 3F7WA 4AZ6A 1I4DA 1LQ7A 3B53X 4JL9A 2YL8A 2GF4A 1DKXA 1SU6A 4WPCA 3SBTB 4WPEA 2YLAA 4EZYA 4IWPA 1U00A 3I01A 3BUPA 1R34A 3D2EA 3BUIA 1TQVA 4EZOA 2QXLA 3O3NB 3T4AG 3CVRA 2F1BA 3I2WA 4R5KA 4DCNC 1HXKA 3DX4A 4IW0A 1SU8A 2WYHA 4AZCB 2RAJA 2D4CA 3RV1A 5E84A 2QFFA 1ZWWA 3T46A 2X5CA 4NPHA 2Q12A 3LVTA 3BUQA 3I39X 3T47A 3KAWA 3Q84A 2EFKA 4ILIA 1OAOA 2V0OA 3BVXA 2EFLA 2LXYA 3LMFA 4EZQA 3D4YA 3KDRA 4UDXX 3SYVA 4MQDA 3EJTA 3EJPA 2OZNB 1X03A 4HYBA 4JNFA 4EZTA 2YIVX 3Q0KA 3BVUA 4EZWA 3D52A 4KIKA 2YI9A 2Z0VA 4AZCA 3ER8C 2ZXQA 4H6HA 2OW7A 3DX3A 4EZRA 4HR1A 1OA1A 1DG4A 3D2FA 4AZ7A 2NCZA 4I1QA 3CV5A 1R33A 4JN4A 3DX1A 1E1DA 2JNSA 1SU7A 1HTYA 4EZPA 3D4ZA 5KBPA 4ATMA 3H0XA 4AZ5A 2ALWA 2BPRA 2RT6A 2EX3B 4E3CA 2YIAA 4R5LA 3D51A 3EJSA 3DPPA 2F7OA 4FZPA 2YI8A 3ERCC 3CZSA 4H6IA 3QWEA 4F01A 4R5GA 2FYVA 4PO2A 3ZEDA 2Z8YA 2YIBA 1QWNA 1PS3A 2F7RA 3DPOA 5C5BA 3ACOA 4F00A 3QA8A 4FZSA 2Q13A 3C7NB 4R5IA 4H8SA 3BUDA 4M0MA 4EZXA 1GN9A 4HY9A 4IWOA 3BVVA 3HAHA 4EZNA 2OBMA 3QNJA 1QWUA 5FIGA 1R5EA 3HAJA 4DYLA 1TQUA 1YUWA 1SUFA 3EJQA 3DX0A 1E2UA 1WDZA 1TQTA 3BUBA 3EJUA 1MJGA 3OK8A 3DX2A 3G9GA 3DDFA 2RAIA 2OP6A 3BVWA 2PY6A 2ELBA 4JWIA 2GAFD 1TQWA 1Y2OA 3O3MB 2ND1A 4ILGA 3RV0A 3VKHA 2QKWA 2YLLA 4JLCA 1Q5LA 1ZYLA 4JWDA 4FL9A 2F7PA 4WV5A 5FLEX 1QX1A 2WYIA 4WV7A 3BLBA 4JNEA 3DOBA 1HWWA 4AKVA 2F1AA 1UPXA 3GI7A 4JWCA 3HAIA 1GNLA 4NSWA 4AZGA 2YKTA 3LLLA 3I04A 2O0I1 3ZEFA 4EZZA 3T49A 2KHOA 1I4LA 3A98A 3DPQA 3FD9A 1GNTA 4FM3A 1YWMA 4BNEA 2Z0NA 3SBSA 2GA9D 2YL9A 4FZOA 2Z0OA 2X3WA 1DKZA 4IM0A 2ND0A 4EZUA 4D8JA 3VEAA 4B9QA 3M3WA 2WINM 1X04A 4AZBA 2PMRA 2X3XA
chains in the Genus database with same CATH topology
1DKXA 1MJGA 1E9VA 1SU6A 3SBTB 3ER8C 4H6HA 3UITA 4EZRA 4HR1A 1OA1A 4EZYA 1DG4A 4IWPA 2V7YA 3D2FA 1U00A 2OP6A 2NCZA 4KIKB 3I01A 2PY6A 4JWIA 4I43A 3B52X 3D2EA 2GAFD 4JN4A 4E81A 4EZOA 1CKRA 1E1DA 1JQKA 2JNSA 1SU7A 4EZPA 3O3MB 4UDYX 3H0XA 2ND1A 2QXLA 4ILGA 4HR1B 3OWGA 2BPRA 2RT6A 2EX3B 4E3CA 3O3NB 3RV0A 3VKHA 2YIAA 4R5LA 3DPPA 4JLCA 3T4AG 4IWQA 2YI8A 3ERCC 1Q5LA 1ZYLA 4JWDA 1BPRA 4FL9A 4R5KA 4H6IA 4WV5A 1W9MA 5FLEX 3ER9B 4EZVA 4IM3A 4F01A 4R5GA 4WV7A 3C7NA 2N3KA 4IW0A 4PO2A 3VEBA 3ZEDA 2Z8YA 4JNEA 1SU8A 2EWFA 2YIBA 3DOBA 3OHXM 3RV1A 3DPOA 4F00A 3L3OM 5E84A 3QA8A 1UPXA 2QFFA 3GI7A 4JWCA 4IM2A 1GNLA 1DKYA 3T46A 3C7NB 4JWEA 4R5IA 2X5CA 4NPHA 4M0MA 4EZSA 3I04A 4EZXA 3I39X 3T47A 3ZEFA 4EZZA 3T49A 3KAVA 3KAWA 2KHOA 1OA0A 1GN9A 4G6QA 4ILHB 3A98A 3O3OB 3DPQA 4HY9A 3N8EA 4ILIA 1OAOA 4IWOA 4R5JA 3FD9A 5TKYA 1GNTA 4FM3A 3LMFA 4EZQA 3B51X 4EZNA 3SBSA 2GA9D 3KDRA 3DQGA 2OBMA 3QNJA 4UDXX 5FIGA 4MQDA 1DKZA 4IM0A 2ND0A 1YUWA 1SUFA 4EZUA 4D8JA 4HYBA 3VEAA 4JNFA 4B9QA 4EZTA 3T48A 1E2UA 2YIVX 2OBLA 7HSCA 2LM0A 3F7WA 4EZWA 4KIKA 2WINM 2YI9A 3B53X 4JL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E84 A;  4R5L A;  1DKX A;  4EZQ A;  2QFF A;  4JWC A;  4EZN A;  3DPP A;  3T4A G;  1DKY A;  4H6H A;  3T46 A;  1Q5L A;  3DQG A;  3QNJ A;  4JWD A;  1BPR A;  3C7N B;  4JWE A;  4FL9 A;  4EZR A;  4R5I A;  4R5K A;  4EZY A;  1DG4 A;  4H6I A;  4WV5 A;  1DKZ A;  2V7Y A;  3D2F A;  1U00 A;  1YUW A;  2OP6 A;  4EZU A;  4EZV A;  4EZS A;  4HYB A;  4EZX A;  4JNF A;  4B9Q A;  4EZT A;  4F01 A;  4JWI A;  3T48 A;  4R5G A;  3D2E A;  3T47 A;  4WV7 A;  4JN4 A;  3C7N A;  4EZZ A;  4E81 A;  4EZO A;  3T49 A;  4PO2 A;  1CKR A;  2KHO A;  4EZP A;  4JNE A;  7HSC A;  3DOB A;  3OHX M;  4EZW A;  3DPQ A;  2WIN M;  4HY9 A;  5TKY A;  3N8E A;  3H0X A;  2QXL A;  4R5J A;  2BPR A;  3DPO A;  4F00 A;  3L3O M; 
#chains in the Genus database with same CATH topology
 2X3V A;  1E9V A;  1I49 A;  3DDG A;  3UIT A;  2V7Y A;  4KIK B;  2FIC A;  3CAZ A;  4I43 A;  3B52 X;  4E81 A;  1CKR A;  1JQK A;  3QNI A;  4UDY X;  1O7D B;  4HR1 B;  3OWG A;  4AZI A;  2MI7 A;  4IWQ A;  3SOG A;  1BPR A;  1W9M A;  4NQI A;  2F7Q A;  3ER9 B;  3D50 A;  4EZV A;  4IM3 A;  3ABH A;  3C7N A;  2N3K A;  3VEB A;  2JNK A;  2EWF A;  3OHX M;  3EJR A;  3L3O M;  3BVT A;  4IM2 A;  1DKY A;  2YL5 A;  4JWE A;  2RAK A;  4EZS A;  1URU A;  5C5B B;  3DYT A;  4AZH A;  2C08 A;  3CZN A;  3KAV A;  1O7D C;  1OA0 A;  4G6Q A;  4ILH B;  3CKD A;  3O3O B;  3N8E A;  4R5J A;  1I4T A;  5TKY A;  3B51 X;  4AVM A;  2OW6 A;  1TQS A;  2F18 A;  3DQG A;  3RPM A;  3PLT A;  3L3P A;  2D1L A;  2YL6 A;  3T48 A;  3QE6 A;  2OO2 A;  2OBL A;  7HSC A;  2LM0 A;  3F7W A;  4AZ6 A;  1I4D A;  1LQ7 A;  3B53 X;  4JL9 A;  2YL8 A;  2GF4 A;  1DKX A;  1SU6 A;  4WPC A;  3SBT B;  4WPE A;  2YLA A;  4EZY A;  4IWP A;  1U00 A;  3I01 A;  3BUP A;  1R34 A;  3D2E A;  3BUI A;  1TQV A;  4EZO A;  2QXL A;  3O3N B;  3T4A G;  3CVR A;  2F1B A;  3I2W A;  4R5K A;  4DCN C;  1HXK A;  3DX4 A;  4IW0 A;  1SU8 A;  2WYH A;  4AZC B;  2RAJ A;  2D4C A;  3RV1 A;  5E84 A;  2QFF A;  1ZWW A;  3T46 A;  2X5C A;  4NPH A;  2Q12 A;  3LVT A;  3BUQ A;  3I39 X;  3T47 A;  3KAW A;  3Q84 A;  2EFK A;  4ILI A;  1OAO A;  2V0O A;  3BVX A;  2EFL A;  2LXY A;  3LMF A;  4EZQ A;  3D4Y A;  3KDR A;  4UDX X;  3SYV A;  4MQD A;  3EJT A;  3EJP A;  2OZN B;  1X03 A;  4HYB A;  4JNF A;  4EZT A;  2YIV X;  3Q0K A;  3BVU A;  4EZW A;  3D52 A;  4KIK A;  2YI9 A;  2Z0V A;  4AZC A;  3ER8 C;  2ZXQ A;  4H6H A;  2OW7 A;  3DX3 A;  4EZR A;  4HR1 A;  1OA1 A;  1DG4 A;  3D2F A;  4AZ7 A;  2NCZ A;  4I1Q A;  3CV5 A;  1R33 A;  4JN4 A;  3DX1 A;  1E1D A;  2JNS A;  1SU7 A;  1HTY A;  4EZP A;  3D4Z A;  5KBP A;  4ATM A;  3H0X A;  4AZ5 A;  2ALW A;  2BPR A;  2RT6 A;  2EX3 B;  4E3C A;  2YIA A;  4R5L A;  3D51 A;  3EJS A;  3DPP A;  2F7O A;  4FZP A;  2YI8 A;  3ERC C;  3CZS A;  4H6I A;  3QWE A;  4F01 A;  4R5G A;  2FYV A;  4PO2 A;  3ZED A;  2Z8Y A;  2YIB A;  1QWN A;  1PS3 A;  2F7R A;  3DPO A;  5C5B A;  3ACO A;  4F00 A;  3QA8 A;  4FZS A;  2Q13 A;  3C7N B;  4R5I A;  4H8S A;  3BUD A;  4M0M A;  4EZX A;  1GN9 A;  4HY9 A;  4IWO A;  3BVV A;  3HAH A;  4EZN A;  2OBM A;  3QNJ A;  1QWU A;  5FIG A;  1R5E A;  3HAJ A;  4DYL A;  1TQU A;  1YUW A;  1SUF A;  3EJQ A;  3DX0 A;  1E2U A;  1WDZ A;  1TQT A;  3BUB A;  3EJU A;  1MJG A;  3OK8 A;  3DX2 A;  3G9G A;  3DDF A;  2RAI A;  2OP6 A;  3BVW A;  2PY6 A;  2ELB A;  4JWI A;  2GAF D;  1TQW A;  1Y2O A;  3O3M B;  2ND1 A;  4ILG A;  3RV0 A;  3VKH A;  2QKW A;  2YLL A;  4JLC A;  1Q5L A;  1ZYL A;  4JWD A;  4FL9 A;  2F7P A;  4WV5 A;  5FLE X;  1QX1 A;  2WYI A;  4WV7 A;  3BLB A;  4JNE A;  3DOB A;  1HWW A;  4AKV A;  2F1A A;  1UPX A;  3GI7 A;  4JWC A;  3HAI A;  1GNL A;  4NSW A;  4AZG A;  2YKT A;  3LLL A;  3I04 A;  2O0I 1;  3ZEF A;  4EZZ A;  3T49 A;  2KHO A;  1I4L A;  3A98 A;  3DPQ A;  3FD9 A;  1GNT A;  4FM3 A;  1YWM A;  4BNE A;  2Z0N A;  3SBS A;  2GA9 D;  2YL9 A;  4FZO A;  2Z0O A;  2X3W A;  1DKZ A;  4IM0 A;  2ND0 A;  4EZU A;  4D8J A;  3VEA A;  4B9Q A;  3M3W A;  2WIN M;  1X04 A;  4AZB A;  2PMR A;  2X3X A; 
#chains in the Genus database with same CATH homology
 1DKX A;  1MJG A;  1E9V A;  1SU6 A;  3SBT B;  3ER8 C;  4H6H A;  3UIT A;  4EZR A;  4HR1 A;  1OA1 A;  4EZY A;  1DG4 A;  4IWP A;  2V7Y A;  3D2F A;  1U00 A;  2OP6 A;  2NCZ A;  4KIK B;  3I01 A;  2PY6 A;  4JWI A;  4I43 A;  3B52 X;  3D2E A;  2GAF D;  4JN4 A;  4E81 A;  4EZO A;  1CKR A;  1E1D A;  1JQK A;  2JNS A;  1SU7 A;  4EZP A;  3O3M B;  4UDY X;  3H0X A;  2ND1 A;  2QXL A;  4ILG A;  4HR1 B;  3OWG A;  2BPR A;  2RT6 A;  2EX3 B;  4E3C A;  3O3N B;  3RV0 A;  3VKH A;  2YIA A;  4R5L A;  3DPP A;  4JLC A;  3T4A G;  4IWQ A;  2YI8 A;  3ERC C;  1Q5L A;  1ZYL A;  4JWD A;  1BPR A;  4FL9 A;  4R5K A;  4H6I A;  4WV5 A;  1W9M A;  5FLE X;  3ER9 B;  4EZV A;  4IM3 A;  4F01 A;  4R5G A;  4WV7 A;  3C7N A;  2N3K A;  4IW0 A;  4PO2 A;  3VEB A;  3ZED A;  2Z8Y A;  4JNE A;  1SU8 A;  2EWF A;  2YIB A;  3DOB A;  3OHX M;  3RV1 A;  3DPO A;  4F00 A;  3L3O M;  5E84 A;  3QA8 A;  1UPX A;  2QFF A;  3GI7 A;  4JWC A;  4IM2 A;  1GNL A;  1DKY A;  3T46 A;  3C7N B;  4JWE A;  4R5I A;  2X5C A;  4NPH A;  4M0M A;  4EZS A;  3I04 A;  4EZX A;  3I39 X;  3T47 A;  3ZEF A;  4EZZ A;  3T49 A;  3KAV A;  3KAW A;  2KHO A;  1OA0 A;  1GN9 A;  4G6Q A;  4ILH B;  3A98 A;  3O3O B;  3DPQ A;  4HY9 A;  3N8E A;  4ILI A;  1OAO A;  4IWO A;  4R5J A;  3FD9 A;  5TKY A;  1GNT A;  4FM3 A;  3LMF A;  4EZQ A;  3B51 X;  4EZN A;  3SBS A;  2GA9 D;  3KDR A;  3DQG A;  2OBM A;  3QNJ A;  4UDX X;  5FIG A;  4MQD A;  1DKZ A;  4IM0 A;  2ND0 A;  1YUW A;  1SUF A;  4EZU A;  4D8J A;  4HYB A;  3VEA A;  4JNF A;  4B9Q A;  4EZT A;  3T48 A;  1E2U A;  2YIV X;  2OBL A;  7HSC A;  2LM0 A;  3F7W A;  4EZW A;  4KIK A;  2WIN M;  2YI9 A;  3B53 X;  4JL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...