4EZZA

Crystal structure of the substrate binding domain of e.coli dnak in complex with the designer peptide elplvki
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
218
structure length
218
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 69
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezzA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezzA01
3T4AG 4JWDA 4JWIA 3QNJA 4B9QA 4R5KA 4EZOA 3D2FA 3DPOA 3N8EA 3DQGA 3H0XA 4FL9A 4HYBA 2QXLA 2V7YA 4R5JA 4EZXA 1BPRA 2OP6A 4R5LA 3DPPA 4EZUA 1DKZA 4JWCA 3OHXM 4PO2A 1YUWA 4JNEA 3C7NA 5E84A 4WV7A 4F00A 1DKYA 4JNFA 3T48A 4EZNA 2QFFA 4F01A 3D2EA 4R5GA 4WV5A 3L3OM 4H6IA 2WINM 4EZZA 3DPQA 4EZSA 4HY9A 3T47A 4H6HA 4JN4A 4E81A 5TKYA 4EZPA 1Q5LA 4EZTA 1U00A 4EZRA 3DOBA 2BPRA 4EZWA 4JWEA 1DKXA 3T46A 3T49A 4EZYA 4EZVA 4EZQA 2KHOA 7HSCA 1CKRA 3C7NB 1DG4A 4R5IA
chains in the Genus database with same CATH superfamily
3Q84A 1OAOA 2ELBA 3D2FA 4DYLA 3GI7A 3H0XA 1HWWA 3BLBA 2ND1A 3KAWA 2EFKA 4FZSA 3B52X 3DPQA 4I43A 4HR1A 4EZTA 2BPRA 1DKXA 3A98A 3D52A 3HAHA 1OA1A 1R34A 3VEBA 1I4LA 4PO2A 1R5EA 3T48A 2F7QA 3D2EA 4KIKA 2RAKA 2OBLA 3BUPA 1HTYA 2RT6A 3I01A 2EWFA 3T4AG 2D1LA 3BVVA 4IWPA 2F7RA 4HYBA 4EZUA 4JWCA 2X5CA 4AZ6A 1ZWWA 4IWOA 1QWNA 4EZYA 2YL9A 3M3WA 4WPEA 4JWIA 4NQIA 4IM3A 2FICA 4JL9A 2WYIA 5C5BB 1YUWA 3DX3A 4JLCA 5E84A 2YI8A 3UITA 3O3OB 2OO2A 4E81A 5TKYA 1SU8A 3ZEFA 1SUFA 4D8JA 3DDGA 4NSWA 5KBPA 1GNTA 3D4YA 4HR1B 3CKDA 3QNIA 3EJSA 4ILIA 4EZNA 3I04A 4R5GA 1SU6A 3KAVA 2OW6A 3EJQA 4EZWA 3I2WA 2Z0VA 7HSCA 2ZXQA 5C5BA 3L3PA 1TQSA 2ALWA 4EZOA 3N8EA 4KIKB 4ILHB 3OHXM 3LLLA 1X04A 3BVXA 2YL8A 3EJUA 2JNSA 4AZHA 3D4ZA 1CKRA 4IM0A 3D51A 3G9GA 2KHOA 3I39X 3PLTA 3OWGA 4FL9A 2YIBA 4FZPA 3CV5A 1DKZA 3D50A 4AZIA 1SU7A 4AKVA 3BUBA 2YKTA 4WV5A 3L3OM 2X3WA 1TQUA 3T47A 3FD9A 2Z0NA 3F7WA 3RPMA 2OZNB 2OBMA 2EX3B 4UDXX 3QE6A 2YIVX 2X3XA 2QXLA 3QA8A 5FIGA 4H6IA 2RAJA 3CVRA 3DOBA 3T49A 3C7NB 2EFLA 3SBTB 3CZSA 3BVTA 3DX2A 2OP6A 4H8SA 2GA9D 2C08A 3BUQA 1DKYA 2YLAA 1TQWA 4HY9A 2ND0A 3SOGA 1U00A 1E2UA 3DPOA 1WDZA 3QWEA 3BUDA 3DQGA 2YLLA 2F1AA 3KDRA 3HAIA 2YIAA 3ERCC 1BPRA 4R5LA 3DX1A 1YWMA 1MJGA 3C7NA 2Z0OA 4FZOA 4JNFA 4ILGA 3DX4A 3CZNA 4ATMA 3VEAA 1X03A 4EZQA 1DG4A 2JNKA 4M0MA 2Q12A 3O3NB 1PS3A 4R5JA 4EZXA 2PMRA 2GF4A 2F7OA 1URUA 2YL6A 2RAIA 2QFFA 4BNEA 1R33A 2N3KA 4EZZA 1O7DB 4UDYX 2QKWA 4EZVA 4R5IA 4R5KA 4IW0A 1ZYLA 4G6QA 1I4DA 3ER9B 5FLEX 2YI9A 3BVUA 2PY6A 2GAFD 4JNEA 1GNLA 4EZRA 4AZCB 2OW7A 3O3MB 2V0OA 4DCNC 4B9QA 2F1BA 4WPCA 3LVTA 3CAZA 1O7DC 1LQ7A 2Z8YA 1I49A 1E9VA 1QWUA 1UPXA 4AZGA 1QX1A 4AZBA 3SYVA 3EJPA 3RV1A 4JN4A 3ER8C 3BUIA 1Y2OA 4AZ7A 2MI7A 3VKHA 3BVWA 3DYTA 2LM0A 3ACOA 3Q0KA 3ABHA 3DDFA 2F18A 2Q13A 4AZCA 4AVMA 1HXKA 3EJRA 4F00A 4F01A 4IM2A 2D4CA 1OA0A 4FM3A 4JWDA 3QNJA 1W9MA 2V7YA 2FYVA 2F7PA 3DPPA 3HAJA 4NPHA 2O0I1 3ZEDA 1TQVA 2WINM 1Q5LA 4EZPA 2YL5A 3EJTA 4JWEA 3B53X 3DX0A 4MQDA 3LMFA 1JQKA 3OK8A 3RV0A 1E1DA 4E3CA 4AZ5A 2WYHA 1I4TA 4I1QA 4IWQA 4WV7A 3B51X 2NCZA 1TQTA 4EZSA 2LXYA 4H6HA 3SBSA 3T46A 2X3VA 1GN9A
chains in the Genus database with same CATH topology
4D8JA 1OAOA 4B9QA 3D2FA 3SBTB 3GI7A 1GNTA 2Z8YA 3H0XA 1E9VA 2OP6A 2GA9D 4HR1B 2ND1A 3KAWA 1UPXA 4ILIA 1DKYA 3I04A 4EZNA 4R5GA 3B52X 1SU6A 3DPQA 3KAVA 4I43A 4HY9A 3RV1A 2ND0A 4JN4A 4HR1A 1U00A 4EZTA 3ER8C 2BPRA 4EZWA 1DKXA 7HSCA 3A98A 1E2UA 4EZOA 3DPOA 3VKHA 2LM0A 3N8EA 4KIKB 1OA1A 3DQGA 3KDRA 2YIAA 3ERCC 1BPRA 4R5LA 3VEBA 4ILHB 1MJGA 3OHXM 4PO2A 3C7NA 4F00A 4JNFA 3T48A 4ILGA 4KIKA 3D2EA 4IM2A 4F01A 3VEAA 2OBLA 2JNSA 1CKRA 4EZQA 4IM0A 2RT6A 2KHOA 3I01A 1OA0A 1DG4A 2EWFA 3T4AG 3I39X 4FM3A 3QNJA 4JWDA 3OWGA 1W9MA 4IWPA 4FL9A 4HYBA 2V7YA 4M0MA 3O3NB 4R5JA 2YIBA 4EZXA 3DPPA 4EZUA 1DKZA 4JWCA 2X5CA 4NPHA 1SU7A 3ZEDA 2QFFA 4WV5A 2N3KA 3L3OM 2WINM 4EZZA 4IWOA 3T47A 1Q5LA 3FD9A 1SUFA 4UDYX 4EZPA 4JWEA 4EZYA 4EZVA 3F7WA 3B53X 2OBMA 2EX3B 4R5IA 4MQDA 4UDXX 4JWIA 4IM3A 4R5KA 4IW0A 3LMFA 1JQKA 2YIVX 3RV0A 1E1DA 2QXLA 1ZYLA 4G6QA 4E3CA 3QA8A 4JL9A 3ER9B 5FLEX 2YI9A 2PY6A 2GAFD 1YUWA 4JLCA 4IWQA 4JNEA 5E84A 4WV7A 3B51X 2YI8A 2NCZA 3UITA 3O3OB 1GNLA 5FIGA 4H6IA 4EZSA 4H6HA 4E81A 5TKYA 1SU8A 4EZRA 3DOBA 3SBSA 3T46A 3T49A 3ZEFA 1GN9A 3O3MB 3C7NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T4A G;  4JWD A;  4JWI A;  3QNJ A;  4B9Q A;  4R5K A;  4EZO A;  3D2F A;  3DPO A;  3N8E A;  3DQG A;  3H0X A;  4FL9 A;  4HYB A;  2QXL A;  2V7Y A;  4R5J A;  4EZX A;  1BPR A;  2OP6 A;  4R5L A;  3DPP A;  4EZU A;  1DKZ A;  4JWC A;  3OHX M;  4PO2 A;  1YUW A;  4JNE A;  3C7N A;  5E84 A;  4WV7 A;  4F00 A;  1DKY A;  4JNF A;  3T48 A;  4EZN A;  2QFF A;  4F01 A;  3D2E A;  4R5G A;  4WV5 A;  3L3O M;  4H6I A;  2WIN M;  4EZZ A;  3DPQ A;  4EZS A;  4HY9 A;  3T47 A;  4H6H A;  4JN4 A;  4E81 A;  5TKY A;  4EZP A;  1Q5L A;  4EZT A;  1U00 A;  4EZR A;  3DOB A;  2BPR A;  4EZW A;  4JWE A;  1DKX A;  3T46 A;  3T49 A;  4EZY A;  4EZV A;  4EZQ A;  2KHO A;  7HSC A;  1CKR A;  3C7N B;  1DG4 A;  4R5I A; 
#chains in the Genus database with same CATH topology
 3Q84 A;  1OAO A;  2ELB A;  3D2F A;  4DYL A;  3GI7 A;  3H0X A;  1HWW A;  3BLB A;  2ND1 A;  3KAW A;  2EFK A;  4FZS A;  3B52 X;  3DPQ A;  4I43 A;  4HR1 A;  4EZT A;  2BPR A;  1DKX A;  3A98 A;  3D52 A;  3HAH A;  1OA1 A;  1R34 A;  3VEB A;  1I4L A;  4PO2 A;  1R5E A;  3T48 A;  2F7Q A;  3D2E A;  4KIK A;  2RAK A;  2OBL A;  3BUP A;  1HTY A;  2RT6 A;  3I01 A;  2EWF A;  3T4A G;  2D1L A;  3BVV A;  4IWP A;  2F7R A;  4HYB A;  4EZU A;  4JWC A;  2X5C A;  4AZ6 A;  1ZWW A;  4IWO A;  1QWN A;  4EZY A;  2YL9 A;  3M3W A;  4WPE A;  4JWI A;  4NQI A;  4IM3 A;  2FIC A;  4JL9 A;  2WYI A;  5C5B B;  1YUW A;  3DX3 A;  4JLC A;  5E84 A;  2YI8 A;  3UIT A;  3O3O B;  2OO2 A;  4E81 A;  5TKY A;  1SU8 A;  3ZEF A;  1SUF A;  4D8J A;  3DDG A;  4NSW A;  5KBP A;  1GNT A;  3D4Y A;  4HR1 B;  3CKD A;  3QNI A;  3EJS A;  4ILI A;  4EZN A;  3I04 A;  4R5G A;  1SU6 A;  3KAV A;  2OW6 A;  3EJQ A;  4EZW A;  3I2W A;  2Z0V A;  7HSC A;  2ZXQ A;  5C5B A;  3L3P A;  1TQS A;  2ALW A;  4EZO A;  3N8E A;  4KIK B;  4ILH B;  3OHX M;  3LLL A;  1X04 A;  3BVX A;  2YL8 A;  3EJU A;  2JNS A;  4AZH A;  3D4Z A;  1CKR A;  4IM0 A;  3D51 A;  3G9G A;  2KHO A;  3I39 X;  3PLT A;  3OWG A;  4FL9 A;  2YIB A;  4FZP A;  3CV5 A;  1DKZ A;  3D50 A;  4AZI A;  1SU7 A;  4AKV A;  3BUB A;  2YKT A;  4WV5 A;  3L3O M;  2X3W A;  1TQU A;  3T47 A;  3FD9 A;  2Z0N A;  3F7W A;  3RPM A;  2OZN B;  2OBM A;  2EX3 B;  4UDX X;  3QE6 A;  2YIV X;  2X3X A;  2QXL A;  3QA8 A;  5FIG A;  4H6I A;  2RAJ A;  3CVR A;  3DOB A;  3T49 A;  3C7N B;  2EFL A;  3SBT B;  3CZS A;  3BVT A;  3DX2 A;  2OP6 A;  4H8S A;  2GA9 D;  2C08 A;  3BUQ A;  1DKY A;  2YLA A;  1TQW A;  4HY9 A;  2ND0 A;  3SOG A;  1U00 A;  1E2U A;  3DPO A;  1WDZ A;  3QWE A;  3BUD A;  3DQG A;  2YLL A;  2F1A A;  3KDR A;  3HAI A;  2YIA A;  3ERC C;  1BPR A;  4R5L A;  3DX1 A;  1YWM A;  1MJG A;  3C7N A;  2Z0O A;  4FZO A;  4JNF A;  4ILG A;  3DX4 A;  3CZN A;  4ATM A;  3VEA A;  1X03 A;  4EZQ A;  1DG4 A;  2JNK A;  4M0M A;  2Q12 A;  3O3N B;  1PS3 A;  4R5J A;  4EZX A;  2PMR A;  2GF4 A;  2F7O A;  1URU A;  2YL6 A;  2RAI A;  2QFF A;  4BNE A;  1R33 A;  2N3K A;  4EZZ A;  1O7D B;  4UDY X;  2QKW A;  4EZV A;  4R5I A;  4R5K A;  4IW0 A;  1ZYL A;  4G6Q A;  1I4D A;  3ER9 B;  5FLE X;  2YI9 A;  3BVU A;  2PY6 A;  2GAF D;  4JNE A;  1GNL A;  4EZR A;  4AZC B;  2OW7 A;  3O3M B;  2V0O A;  4DCN C;  4B9Q A;  2F1B A;  4WPC A;  3LVT A;  3CAZ A;  1O7D C;  1LQ7 A;  2Z8Y A;  1I49 A;  1E9V A;  1QWU A;  1UPX A;  4AZG A;  1QX1 A;  4AZB A;  3SYV A;  3EJP A;  3RV1 A;  4JN4 A;  3ER8 C;  3BUI A;  1Y2O A;  4AZ7 A;  2MI7 A;  3VKH A;  3BVW A;  3DYT A;  2LM0 A;  3ACO A;  3Q0K A;  3ABH A;  3DDF A;  2F18 A;  2Q13 A;  4AZC A;  4AVM A;  1HXK A;  3EJR A;  4F00 A;  4F01 A;  4IM2 A;  2D4C A;  1OA0 A;  4FM3 A;  4JWD A;  3QNJ A;  1W9M A;  2V7Y A;  2FYV A;  2F7P A;  3DPP A;  3HAJ A;  4NPH A;  2O0I 1;  3ZED A;  1TQV A;  2WIN M;  1Q5L A;  4EZP A;  2YL5 A;  3EJT A;  4JWE A;  3B53 X;  3DX0 A;  4MQD A;  3LMF A;  1JQK A;  3OK8 A;  3RV0 A;  1E1D A;  4E3C A;  4AZ5 A;  2WYH A;  1I4T A;  4I1Q A;  4IWQ A;  4WV7 A;  3B51 X;  2NCZ A;  1TQT A;  4EZS A;  2LXY A;  4H6H A;  3SBS A;  3T46 A;  2X3V A;  1GN9 A; 
#chains in the Genus database with same CATH homology
 4D8J A;  1OAO A;  4B9Q A;  3D2F A;  3SBT B;  3GI7 A;  1GNT A;  2Z8Y A;  3H0X A;  1E9V A;  2OP6 A;  2GA9 D;  4HR1 B;  2ND1 A;  3KAW A;  1UPX A;  4ILI A;  1DKY A;  3I04 A;  4EZN A;  4R5G A;  3B52 X;  1SU6 A;  3DPQ A;  3KAV A;  4I43 A;  4HY9 A;  3RV1 A;  2ND0 A;  4JN4 A;  4HR1 A;  1U00 A;  4EZT A;  3ER8 C;  2BPR A;  4EZW A;  1DKX A;  7HSC A;  3A98 A;  1E2U A;  4EZO A;  3DPO A;  3VKH A;  2LM0 A;  3N8E A;  4KIK B;  1OA1 A;  3DQG A;  3KDR A;  2YIA A;  3ERC C;  1BPR A;  4R5L A;  3VEB A;  4ILH B;  1MJG A;  3OHX M;  4PO2 A;  3C7N A;  4F00 A;  4JNF A;  3T48 A;  4ILG A;  4KIK A;  3D2E A;  4IM2 A;  4F01 A;  3VEA A;  2OBL A;  2JNS A;  1CKR A;  4EZQ A;  4IM0 A;  2RT6 A;  2KHO A;  3I01 A;  1OA0 A;  1DG4 A;  2EWF A;  3T4A G;  3I39 X;  4FM3 A;  3QNJ A;  4JWD A;  3OWG A;  1W9M A;  4IWP A;  4FL9 A;  4HYB A;  2V7Y A;  4M0M A;  3O3N B;  4R5J A;  2YIB A;  4EZX A;  3DPP A;  4EZU A;  1DKZ A;  4JWC A;  2X5C A;  4NPH A;  1SU7 A;  3ZED A;  2QFF A;  4WV5 A;  2N3K A;  3L3O M;  2WIN M;  4EZZ A;  4IWO A;  3T47 A;  1Q5L A;  3FD9 A;  1SUF A;  4UDY X;  4EZP A;  4JWE A;  4EZY A;  4EZV A;  3F7W A;  3B53 X;  2OBM A;  2EX3 B;  4R5I A;  4MQD A;  4UDX X;  4JWI A;  4IM3 A;  4R5K A;  4IW0 A;  3LMF A;  1JQK A;  2YIV X;  3RV0 A;  1E1D A;  2QXL A;  1ZYL A;  4G6Q A;  4E3C A;  3QA8 A;  4JL9 A;  3ER9 B;  5FLE X;  2YI9 A;  2PY6 A;  2GAF D;  1YUW A;  4JLC A;  4IWQ A;  4JNE A;  5E84 A;  4WV7 A;  3B51 X;  2YI8 A;  2NCZ A;  3UIT A;  3O3O B;  1GNL A;  5FIG A;  4H6I A;  4EZS A;  4H6H A;  4E81 A;  5TKY A;  1SU8 A;  4EZR A;  3DOB A;  3SBS A;  3T46 A;  3T49 A;  3ZEF A;  1GN9 A;  3O3M B;  3C7N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...