4F00A

Crystal structure of the substrate binding domain of e.coli dnak in complex with an apidaecin fragment from the bumblebee (residues 3 to 11)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
219
structure length
219
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/immune system
total genus 66
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4f00A02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4f00A01
2OP6A 3C7NA 3DPOA 3OHXM 4R5KA 4EZQA 4PO2A 1DKXA 4EZTA 1BPRA 1CKRA 4EZSA 3N8EA 2QXLA 1DKZA 3D2FA 3DPQA 2KHOA 3L3OM 4JNFA 4EZWA 1Q5LA 3H0XA 4B9QA 4HYBA 4F00A 4HY9A 4EZVA 4EZPA 4JWDA 4JNEA 3T46A 3T49A 4R5LA 4FL9A 3T48A 4EZZA 4R5GA 4JN4A 5E84A 4EZRA 3DQGA 4WV7A 4EZNA 4E81A 1U00A 4R5IA 5TKYA 7HSCA 4H6HA 3QNJA 4EZUA 3C7NB 4WV5A 3T4AG 4EZOA 4JWEA 2V7YA 4JWCA 4EZXA 1YUWA 2QFFA 3D2EA 4F01A 4R5JA 2WINM 2BPRA 4EZYA 4JWIA 4H6IA 1DG4A 1DKYA 3T47A 3DPPA 3DOBA
chains in the Genus database with same CATH superfamily
2FICA 1Q5LA 3D52A 2Q13A 4JNEA 3T46A 2F7OA 2PY6A 4ATMA 3ERCC 2YL6A 3T4AG 3CZSA 4JWEA 1I4TA 2YL9A 3UITA 4NSWA 4JWCA 3D2EA 3LVTA 2D1LA 2OZNB 1TQSA 2ELBA 3I2WA 2WYHA 2WYIA 4IM0A 1PS3A 3I01A 4R5KA 1E1DA 4HR1B 3EJTA 2F7QA 4EZPA 3T49A 4FL9A 4R5GA 3DDFA 4DCNC 3BUPA 2RT6A 2YIBA 2LXYA 4EZXA 3VEBA 4MQDA 4EZQA 1E9VA 3BVTA 3DPQA 2YIVX 3HAIA 3SBSA 5E84A 3SOGA 4EZNA 2YKTA 2F1BA 3B51X 4JWIA 3D4YA 2Q12A 1O7DC 1HTYA 2KHOA 3RV1A 2ALWA 4JL9A 4ILHB 4EZRA 1OA0A 3EJPA 4R5IA 2O0I1 3QA8A 1OA1A 1ZYLA 1SU7A 3GI7A 1DKYA 3T47A 4IWOA 3CKDA 3BVUA 4FZPA 3N8EA 1R33A 2EFLA 4NQIA 3I39X 3ER9B 2D4CA 2Z0OA 3ZEFA 1I49A 4AZGA 2RAJA 2V7YA 2QFFA 1X03A 3D50A 2JNKA 3DPPA 2OP6A 4PO2A 3BUQA 1GN9A 3CAZA 2YIAA 3M3WA 2X3VA 1MJGA 3DYTA 2NCZA 4R5JA 2F18A 4ILIA 4AZCA 3L3PA 2V0OA 1DKXA 2ND0A 3L3OM 4B9QA 4HY9A 4JWDA 3BVWA 3Q84A 3EJQA 4EZUA 3OWGA 3G9GA 2LM0A 2F7RA 3B53X 4E3CA 4H6IA 4JLCA 4AZIA 4H8SA 2Z8YA 4F00A 4IWPA 1WDZA 4NPHA 4E81A 4WV5A 3O3NB 1HXKA 3CVRA 2ZXQA 5KBPA 2QKWA 2OBMA 2X5CA 1YWMA 3B52X 3OK8A 1CKRA 3CV5A 3DX1A 1DKZA 3H0XA 3DDGA 3BUDA 2EWFA 1TQUA 3T48A 4EZZA 4KIKA 3EJSA 2FYVA 2Z0VA 3D51A 3VKHA 1I4LA 1URUA 2N3KA 3Q0KA 1SU6A 4FM3A 3ACOA 3DOBA 1LQ7A 4WPCA 4UDXX 4EZSA 2QXLA 3HAHA 1QWNA 2GAFD 3RPMA 3VEAA 1TQVA 3CZNA 4AKVA 4AZ5A 3KDRA 3BVVA 3DX2A 2F1AA 3QWEA 1YUWA 2WINM 2BPRA 2YLAA 3O3OB 4BNEA 1QX1A 4AVMA 4EZWA 4IWQA 2EFKA 4AZHA 1O7DB 3DX0A 5C5BB 1X04A 5C5BA 2EX3B 3QNJA 3KAVA 1QWUA 4AZBA 1OAOA 1Y2OA 4AZ6A 2Z0NA 1BPRA 4AZCB 1UPXA 3DPOA 3D2FA 3BUIA 4HYBA 4M0MA 3I04A 2YLLA 3ABHA 1R5EA 3BUBA 4WV7A 3SYVA 1U00A 1R34A 2OW6A 4EZOA 4FZOA 4EZYA 1DG4A 2X3XA 2JNSA 3PLTA 3QNIA 1SU8A 4UDYX 3BLBA 4IM2A 4EZVA 4HR1A 4D8JA 3LLLA 4JN4A 3QE6A 3A98A 4G6QA 3ER8C 1I4DA 3EJUA 3EJRA 2OO2A 3HAJA 3OHXM 4I1QA 1W9MA 4IW0A 4ILGA 1HWWA 4R5LA 3LMFA 4DYLA 4KIKB 3KAWA 4IM3A 1GNLA 1TQTA 5FLEX 2RAKA 2YI8A 4F01A 3RV0A 4I43A 4AZ7A 2C08A 1ZWWA 4FZSA 2PMRA 2X3WA 3DQGA 1JQKA 2OW7A 5TKYA 2MI7A 2RAIA 3F7WA 4H6HA 3FD9A 3SBTB 3O3MB 1TQWA 2OBLA 3C7NB 2YL5A 4WPEA 1GNTA 3C7NA 3ZEDA 2F7PA 5FIGA 4EZTA 4JNFA 2ND1A 2GF4A 3D4ZA 3DX3A 2YL8A 7HSCA 1SUFA 1E2UA 2YI9A 3BVXA 2GA9D 3DX4A
chains in the Genus database with same CATH topology
2JNSA 2X5CA 3B52X 1CKRA 3N8EA 1SU8A 1DKZA 3H0XA 4UDYX 1Q5LA 4IM2A 4EZVA 4HR1A 4D8JA 4JNEA 3T46A 2EWFA 3I39X 3T48A 4EZZA 4JN4A 4KIKA 2PY6A 3ERCC 3ER9B 3VKHA 3A98A 4G6QA 2N3KA 3ER8C 3T4AG 3ZEFA 4JWEA 3UITA 2V7YA 4JWCA 2QFFA 3D2EA 1SU6A 4FM3A 3DPPA 3DOBA 2OP6A 3OHXM 4IM0A 3I01A 4R5KA 1W9MA 4PO2A 4UDXX 4EZSA 4IW0A 2QXLA 1E1DA 1GN9A 2GAFD 4HR1B 3VEAA 4EZPA 3T49A 4FL9A 4ILGA 2YIAA 4R5LA 3LMFA 4R5GA 4KIKB 1MJGA 3KDRA 3KAWA 4IM3A 1GNLA 5FLEX 2RT6A 2YIBA 2NCZA 4EZXA 1YUWA 2YI8A 4F01A 3VEBA 4R5JA 2WINM 2BPRA 3RV0A 4I43A 3O3OB 4ILIA 4MQDA 4EZQA 1DKXA 1E9VA 2ND0A 4EZWA 3DPQA 4IWQA 3L3OM 4B9QA 4HY9A 2YIVX 4JWDA 3SBSA 5E84A 1JQKA 3DQGA 4EZNA 5TKYA 2EX3B 3F7WA 4H6HA 3FD9A 3QNJA 4EZUA 3KAVA 3OWGA 3SBTB 1OAOA 2LM0A 3B51X 3O3MB 3B53X 4E3CA 4JWIA 4H6IA 2OBLA 3C7NB 1BPRA 1GNTA 1UPXA 3C7NA 3DPOA 3ZEDA 4JLCA 5FIGA 4EZTA 4JNFA 3D2FA 2KHOA 2ND1A 2Z8YA 3RV1A 4HYBA 4F00A 4M0MA 4IWPA 3I04A 4JL9A 4NPHA 4ILHB 4EZRA 4WV7A 1OA0A 4E81A 1U00A 4R5IA 7HSCA 1SUFA 1E2UA 3QA8A 1OA1A 2YI9A 4WV5A 3O3NB 4EZOA 1ZYLA 1SU7A 2GA9D 3GI7A 4EZYA 1DG4A 1DKYA 3T47A 4IWOA 2OBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OP6 A;  3C7N A;  3DPO A;  3OHX M;  4R5K A;  4EZQ A;  4PO2 A;  1DKX A;  4EZT A;  1BPR A;  1CKR A;  4EZS A;  3N8E A;  2QXL A;  1DKZ A;  3D2F A;  3DPQ A;  2KHO A;  3L3O M;  4JNF A;  4EZW A;  1Q5L A;  3H0X A;  4B9Q A;  4HYB A;  4F00 A;  4HY9 A;  4EZV A;  4EZP A;  4JWD A;  4JNE A;  3T46 A;  3T49 A;  4R5L A;  4FL9 A;  3T48 A;  4EZZ A;  4R5G A;  4JN4 A;  5E84 A;  4EZR A;  3DQG A;  4WV7 A;  4EZN A;  4E81 A;  1U00 A;  4R5I A;  5TKY A;  7HSC A;  4H6H A;  3QNJ A;  4EZU A;  3C7N B;  4WV5 A;  3T4A G;  4EZO A;  4JWE A;  2V7Y A;  4JWC A;  4EZX A;  1YUW A;  2QFF A;  3D2E A;  4F01 A;  4R5J A;  2WIN M;  2BPR A;  4EZY A;  4JWI A;  4H6I A;  1DG4 A;  1DKY A;  3T47 A;  3DPP A;  3DOB A; 
#chains in the Genus database with same CATH topology
 2FIC A;  1Q5L A;  3D52 A;  2Q13 A;  4JNE A;  3T46 A;  2F7O A;  2PY6 A;  4ATM A;  3ERC C;  2YL6 A;  3T4A G;  3CZS A;  4JWE A;  1I4T A;  2YL9 A;  3UIT A;  4NSW A;  4JWC A;  3D2E A;  3LVT A;  2D1L A;  2OZN B;  1TQS A;  2ELB A;  3I2W A;  2WYH A;  2WYI A;  4IM0 A;  1PS3 A;  3I01 A;  4R5K A;  1E1D A;  4HR1 B;  3EJT A;  2F7Q A;  4EZP A;  3T49 A;  4FL9 A;  4R5G A;  3DDF A;  4DCN C;  3BUP A;  2RT6 A;  2YIB A;  2LXY A;  4EZX A;  3VEB A;  4MQD A;  4EZQ A;  1E9V A;  3BVT A;  3DPQ A;  2YIV X;  3HAI A;  3SBS A;  5E84 A;  3SOG A;  4EZN A;  2YKT A;  2F1B A;  3B51 X;  4JWI A;  3D4Y A;  2Q12 A;  1O7D C;  1HTY A;  2KHO A;  3RV1 A;  2ALW A;  4JL9 A;  4ILH B;  4EZR A;  1OA0 A;  3EJP A;  4R5I A;  2O0I 1;  3QA8 A;  1OA1 A;  1ZYL A;  1SU7 A;  3GI7 A;  1DKY A;  3T47 A;  4IWO A;  3CKD A;  3BVU A;  4FZP A;  3N8E A;  1R33 A;  2EFL A;  4NQI A;  3I39 X;  3ER9 B;  2D4C A;  2Z0O A;  3ZEF A;  1I49 A;  4AZG A;  2RAJ A;  2V7Y A;  2QFF A;  1X03 A;  3D50 A;  2JNK A;  3DPP A;  2OP6 A;  4PO2 A;  3BUQ A;  1GN9 A;  3CAZ A;  2YIA A;  3M3W A;  2X3V A;  1MJG A;  3DYT A;  2NCZ A;  4R5J A;  2F18 A;  4ILI A;  4AZC A;  3L3P A;  2V0O A;  1DKX A;  2ND0 A;  3L3O M;  4B9Q A;  4HY9 A;  4JWD A;  3BVW A;  3Q84 A;  3EJQ A;  4EZU A;  3OWG A;  3G9G A;  2LM0 A;  2F7R A;  3B53 X;  4E3C A;  4H6I A;  4JLC A;  4AZI A;  4H8S A;  2Z8Y A;  4F00 A;  4IWP A;  1WDZ A;  4NPH A;  4E81 A;  4WV5 A;  3O3N B;  1HXK A;  3CVR A;  2ZXQ A;  5KBP A;  2QKW A;  2OBM A;  2X5C A;  1YWM A;  3B52 X;  3OK8 A;  1CKR A;  3CV5 A;  3DX1 A;  1DKZ A;  3H0X A;  3DDG A;  3BUD A;  2EWF A;  1TQU A;  3T48 A;  4EZZ A;  4KIK A;  3EJS A;  2FYV A;  2Z0V A;  3D51 A;  3VKH A;  1I4L A;  1URU A;  2N3K A;  3Q0K A;  1SU6 A;  4FM3 A;  3ACO A;  3DOB A;  1LQ7 A;  4WPC A;  4UDX X;  4EZS A;  2QXL A;  3HAH A;  1QWN A;  2GAF D;  3RPM A;  3VEA A;  1TQV A;  3CZN A;  4AKV A;  4AZ5 A;  3KDR A;  3BVV A;  3DX2 A;  2F1A A;  3QWE A;  1YUW A;  2WIN M;  2BPR A;  2YLA A;  3O3O B;  4BNE A;  1QX1 A;  4AVM A;  4EZW A;  4IWQ A;  2EFK A;  4AZH A;  1O7D B;  3DX0 A;  5C5B B;  1X04 A;  5C5B A;  2EX3 B;  3QNJ A;  3KAV A;  1QWU A;  4AZB A;  1OAO A;  1Y2O A;  4AZ6 A;  2Z0N A;  1BPR A;  4AZC B;  1UPX A;  3DPO A;  3D2F A;  3BUI A;  4HYB A;  4M0M A;  3I04 A;  2YLL A;  3ABH A;  1R5E A;  3BUB A;  4WV7 A;  3SYV A;  1U00 A;  1R34 A;  2OW6 A;  4EZO A;  4FZO A;  4EZY A;  1DG4 A;  2X3X A;  2JNS A;  3PLT A;  3QNI A;  1SU8 A;  4UDY X;  3BLB A;  4IM2 A;  4EZV A;  4HR1 A;  4D8J A;  3LLL A;  4JN4 A;  3QE6 A;  3A98 A;  4G6Q A;  3ER8 C;  1I4D A;  3EJU A;  3EJR A;  2OO2 A;  3HAJ A;  3OHX M;  4I1Q A;  1W9M A;  4IW0 A;  4ILG A;  1HWW A;  4R5L A;  3LMF A;  4DYL A;  4KIK B;  3KAW A;  4IM3 A;  1GNL A;  1TQT A;  5FLE X;  2RAK A;  2YI8 A;  4F01 A;  3RV0 A;  4I43 A;  4AZ7 A;  2C08 A;  1ZWW A;  4FZS A;  2PMR A;  2X3W A;  3DQG A;  1JQK A;  2OW7 A;  5TKY A;  2MI7 A;  2RAI A;  3F7W A;  4H6H A;  3FD9 A;  3SBT B;  3O3M B;  1TQW A;  2OBL A;  3C7N B;  2YL5 A;  4WPE A;  1GNT A;  3C7N A;  3ZED A;  2F7P A;  5FIG A;  4EZT A;  4JNF A;  2ND1 A;  2GF4 A;  3D4Z A;  3DX3 A;  2YL8 A;  7HSC A;  1SUF A;  1E2U A;  2YI9 A;  3BVX A;  2GA9 D;  3DX4 A; 
#chains in the Genus database with same CATH homology
 2JNS A;  2X5C A;  3B52 X;  1CKR A;  3N8E A;  1SU8 A;  1DKZ A;  3H0X A;  4UDY X;  1Q5L A;  4IM2 A;  4EZV A;  4HR1 A;  4D8J A;  4JNE A;  3T46 A;  2EWF A;  3I39 X;  3T48 A;  4EZZ A;  4JN4 A;  4KIK A;  2PY6 A;  3ERC C;  3ER9 B;  3VKH A;  3A98 A;  4G6Q A;  2N3K A;  3ER8 C;  3T4A G;  3ZEF A;  4JWE A;  3UIT A;  2V7Y A;  4JWC A;  2QFF A;  3D2E A;  1SU6 A;  4FM3 A;  3DPP A;  3DOB A;  2OP6 A;  3OHX M;  4IM0 A;  3I01 A;  4R5K A;  1W9M A;  4PO2 A;  4UDX X;  4EZS A;  4IW0 A;  2QXL A;  1E1D A;  1GN9 A;  2GAF D;  4HR1 B;  3VEA A;  4EZP A;  3T49 A;  4FL9 A;  4ILG A;  2YIA A;  4R5L A;  3LMF A;  4R5G A;  4KIK B;  1MJG A;  3KDR A;  3KAW A;  4IM3 A;  1GNL A;  5FLE X;  2RT6 A;  2YIB A;  2NCZ A;  4EZX A;  1YUW A;  2YI8 A;  4F01 A;  3VEB A;  4R5J A;  2WIN M;  2BPR A;  3RV0 A;  4I43 A;  3O3O B;  4ILI A;  4MQD A;  4EZQ A;  1DKX A;  1E9V A;  2ND0 A;  4EZW A;  3DPQ A;  4IWQ A;  3L3O M;  4B9Q A;  4HY9 A;  2YIV X;  4JWD A;  3SBS A;  5E84 A;  1JQK A;  3DQG A;  4EZN A;  5TKY A;  2EX3 B;  3F7W A;  4H6H A;  3FD9 A;  3QNJ A;  4EZU A;  3KAV A;  3OWG A;  3SBT B;  1OAO A;  2LM0 A;  3B51 X;  3O3M B;  3B53 X;  4E3C A;  4JWI A;  4H6I A;  2OBL A;  3C7N B;  1BPR A;  1GNT A;  1UPX A;  3C7N A;  3DPO A;  3ZED A;  4JLC A;  5FIG A;  4EZT A;  4JNF A;  3D2F A;  2KHO A;  2ND1 A;  2Z8Y A;  3RV1 A;  4HYB A;  4F00 A;  4M0M A;  4IWP A;  3I04 A;  4JL9 A;  4NPH A;  4ILH B;  4EZR A;  4WV7 A;  1OA0 A;  4E81 A;  1U00 A;  4R5I A;  7HSC A;  1SUF A;  1E2U A;  3QA8 A;  1OA1 A;  2YI9 A;  4WV5 A;  3O3N B;  4EZO A;  1ZYL A;  1SU7 A;  2GA9 D;  3GI7 A;  4EZY A;  1DG4 A;  1DKY A;  3T47 A;  4IWO A;  2OBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...