4F00A

Crystal structure of the substrate binding domain of e.coli dnak in complex with an apidaecin fragment from the bumblebee (residues 3 to 11)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
219
structure length
219
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/immune system
total genus 66
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4f00A02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4f00A01
3DPQA 4JWCA 4EZZA 4F01A 4FL9A 4EZPA 3DQGA 4F00A 4WV7A 3N8EA 4JWEA 3C7NA 4EZVA 1YUWA 1DKYA 2QXLA 2BPRA 3DOBA 3D2FA 4JNEA 4R5GA 3QNJA 4HYBA 3T49A 4EZXA 4WV5A 1DG4A 3OHXM 4H6IA 7HSCA 4H6HA 4EZUA 3D2EA 4EZSA 2OP6A 4R5JA 3T48A 4EZWA 4EZOA 4R5LA 3T4AG 4E81A 4EZTA 4B9QA 1BPRA 4JWIA 1U00A 5TKYA 1DKXA 4EZNA 4EZYA 3T46A 4JWDA 4HY9A 4JN4A 3DPOA 2V7YA 1CKRA 3L3OM 3T47A 3C7NB 4EZRA 4R5IA 4R5KA 3DPPA 4EZQA 3H0XA 4PO2A 2KHOA 1DKZA 5E84A 2QFFA 2WINM 1Q5LA 4JNFA
chains in the Genus database with same CATH superfamily
3B53X 4DCNC 4F00A 2YIVX 1YUWA 1R34A 2X3XA 4UDYX 4R5JA 3T48A 4BNEA 4DYLA 2EX3B 3DDFA 1OA1A 2YLLA 1W9MA 1WDZA 4JLCA 3C7NA 3OWGA 1PS3A 3D50A 4H6IA 3DX4A 3D2EA 4M0MA 2F7RA 3RV0A 2V7YA 3DPOA 3DPPA 2KHOA 2WINM 3HAJA 2Z0VA 3D52A 3SBTB 4WV7A 2ZXQA 3CKDA 3I2WA 3SYVA 4EZUA 1R5EA 3EJSA 4EZWA 4NQIA 1TQUA 4JWIA 2Z0NA 4HR1B 3BVWA 3D4YA 1TQSA 2QFFA 3Q84A 3M3WA 2O0I1 4EZVA 2FICA 2OW6A 1OAOA 2QXLA 4AKVA 2X3VA 3QNJA 4WPCA 3O3MB 2NCZA 5C5BB 4D8JA 1SU6A 4AVMA 2Z8YA 3SBSA 2D4CA 2GA9D 1GNTA 1SU8A 1ZYLA 4KIKB 1E2UA 3N8EA 3OK8A 2QKWA 1GN9A 3Q0KA 3HAHA 2OBMA 4AZIA 3KAVA 2WYIA 1ZWWA 3BUQA 4EZTA 3CV5A 2PY6A 2RAJA 3DX0A 1X04A 3T46A 3QWEA 4NPHA 1LQ7A 2F7OA 4JNEA 4H8SA 1O7DB 3ZEDA 2RAIA 4EZZA 2EWFA 3DQGA 1R33A 2GAFD 3UITA 1SUFA 2C08A 4HR1A 3BUDA 3SOGA 2MI7A 1Y2OA 1O7DC 2ELBA 1BPRA 4EZXA 3T47A 1I49A 3ABHA 4PO2A 3BUIA 3D4ZA 3I04A 4I43A 4IW0A 2Q12A 2FYVA 4I1QA 3OHXM 3LMFA 2WYHA 3QA8A 2D1LA 1YWMA 4AZBA 2V0OA 4E3CA 2F1AA 3QE6A 4R5IA 4WPEA 3BVUA 3ER9B 3F7WA 4ILGA 1QX1A 4AZ7A 4FZOA 4R5GA 4WV5A 1E9VA 4B9QA 2F18A 3VEBA 1U00A 4HY9A 2F1BA 3L3OM 2ND1A 2OW7A 2YKTA 2RAKA 4AZGA 1I4TA 2YL8A 2Q13A 2YI9A 4F01A 1E1DA 3D2FA 1TQTA 7HSCA 3DX2A 4ILIA 4EZOA 4R5LA 1TQWA 1CKRA 3O3OB 1JQKA 4ILHB 3CZNA 4FZPA 4EZQA 3BVTA 3EJPA 1Q5LA 2F7PA 4JWCA 4AZ5A 3FD9A 4IWOA 3DX3A 4FZSA 3ACOA 4HYBA 3RPMA 2YIBA 2JNKA 3BUPA 1QWUA 2GF4A 3PLTA 3EJUA 4JL9A 3B51X 3CAZA 3HAIA 3BVXA 1MJGA 1X03A 2F7QA 4IM3A 2ALWA 2LM0A 3BUBA 2OO2A 4FM3A 4IWPA 2EFKA 1HTYA 2YLAA 2X3WA 4EZRA 3BVVA 2YL6A 3I39X 5E84A 3A98A 4JNFA 2YL5A 5C5BA 4JWEA 3DYTA 3EJTA 1URUA 2OBLA 4AZHA 3VEAA 3EJRA 1I4DA 5TKYA 4KIKA 3LVTA 4AZCB 4FL9A 3ZEFA 1QWNA 2ND0A 2LXYA 5KBPA 3RV1A 4IM2A 2YL9A 4JWDA 4JN4A 2N3KA 3CVRA 3KDRA 2YIAA 5FLEX 5FIGA 1DG4A 3VKHA 2OP6A 3B52X 4E81A 4MQDA 4IM0A 4EZNA 1HXKA 3DDGA 2YI8A 1DKZA 4R5KA 1GNLA 3I01A 4EZPA 3ERCC 2BPRA 2Z0OA 2PMRA 3L3PA 4IWQA 4EZSA 3QNIA 2RT6A 3EJQA 4ATMA 4AZCA 3C7NB 1DKXA 3LLLA 3ER8C 3H0XA 3G9GA 3CZSA 4G6QA 3KAWA 3DPQA 1OA0A 4NSWA 1UPXA 1DKYA 1HWWA 3GI7A 2JNSA 3DOBA 3T49A 4AZ6A 3DX1A 1SU7A 4H6HA 1TQVA 1I4LA 3D51A 3BLBA 3T4AG 2OZNB 4EZYA 2X5CA 2EFLA 4UDXX 3O3NB
chains in the Genus database with same CATH topology
1ZYLA 2YI9A 3B53X 4KIKB 4F01A 4FL9A 1E2UA 4F00A 3N8EA 2YIVX 3ZEFA 1E1DA 1YUWA 1GN9A 2ND0A 2OBMA 3D2FA 3KAVA 7HSCA 4UDYX 4R5JA 3T48A 4ILIA 3RV1A 4EZOA 4R5LA 4EZTA 2EX3B 4IM2A 2PY6A 1OA1A 3T46A 4JWDA 4JN4A 3O3OB 1CKRA 1JQKA 4ILHB 2N3KA 4NPHA 4EZQA 4JNEA 1Q5LA 3ZEDA 4JWCA 4EZZA 2EWFA 1W9MA 3FD9A 3DQGA 2GAFD 4IWOA 4JLCA 3KDRA 3UITA 3C7NA 2YIAA 3OWGA 1SUFA 5FLEX 5FIGA 4HYBA 4HR1A 1DG4A 3VKHA 4H6IA 3D2EA 2OP6A 3B52X 4M0MA 4E81A 4MQDA 1BPRA 4IM0A 2YIBA 3RV0A 4EZNA 4EZXA 2V7YA 3DPOA 3T47A 2YI8A 3DPPA 4PO2A 2KHOA 1DKZA 4JL9A 2WINM 4R5KA 3I04A 3B51X 4I43A 1GNLA 3I01A 3SBTB 4EZPA 4WV7A 4IW0A 1MJGA 3ERCC 2BPRA 3OHXM 4IWQA 3LMFA 4IM3A 4EZUA 3QA8A 4EZSA 4EZWA 2LM0A 2RT6A 4FM3A 4JWIA 4E3CA 1DKXA 3C7NB 4IWPA 3ER8C 4HR1B 4EZRA 3I39X 4R5IA 3H0XA 4G6QA 5E84A 2QFFA 3A98A 3KAWA 4JNFA 3DPQA 3ER9B 1OA0A 1UPXA 4JWEA 4EZVA 3F7WA 1DKYA 1OAOA 2QXLA 2JNSA 3GI7A 3DOBA 4ILGA 4R5GA 3QNJA 3T49A 4WV5A 1E9VA 1SU7A 3O3MB 4H6HA 2OBLA 2NCZA 3VEAA 3T4AG 4B9QA 3VEBA 4D8JA 1U00A 5TKYA 4EZYA 4HY9A 4KIKA 3L3OM 1SU6A 2ND1A 2X5CA 4UDXX 2Z8YA 3O3NB 3SBSA 2GA9D 1GNTA 1SU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DPQ A;  4JWC A;  4EZZ A;  4F01 A;  4FL9 A;  4EZP A;  3DQG A;  4F00 A;  4WV7 A;  3N8E A;  4JWE A;  3C7N A;  4EZV A;  1YUW A;  1DKY A;  2QXL A;  2BPR A;  3DOB A;  3D2F A;  4JNE A;  4R5G A;  3QNJ A;  4HYB A;  3T49 A;  4EZX A;  4WV5 A;  1DG4 A;  3OHX M;  4H6I A;  7HSC A;  4H6H A;  4EZU A;  3D2E A;  4EZS A;  2OP6 A;  4R5J A;  3T48 A;  4EZW A;  4EZO A;  4R5L A;  3T4A G;  4E81 A;  4EZT A;  4B9Q A;  1BPR A;  4JWI A;  1U00 A;  5TKY A;  1DKX A;  4EZN A;  4EZY A;  3T46 A;  4JWD A;  4HY9 A;  4JN4 A;  3DPO A;  2V7Y A;  1CKR A;  3L3O M;  3T47 A;  3C7N B;  4EZR A;  4R5I A;  4R5K A;  3DPP A;  4EZQ A;  3H0X A;  4PO2 A;  2KHO A;  1DKZ A;  5E84 A;  2QFF A;  2WIN M;  1Q5L A;  4JNF A; 
#chains in the Genus database with same CATH topology
 3B53 X;  4DCN C;  4F00 A;  2YIV X;  1YUW A;  1R34 A;  2X3X A;  4UDY X;  4R5J A;  3T48 A;  4BNE A;  4DYL A;  2EX3 B;  3DDF A;  1OA1 A;  2YLL A;  1W9M A;  1WDZ A;  4JLC A;  3C7N A;  3OWG A;  1PS3 A;  3D50 A;  4H6I A;  3DX4 A;  3D2E A;  4M0M A;  2F7R A;  3RV0 A;  2V7Y A;  3DPO A;  3DPP A;  2KHO A;  2WIN M;  3HAJ A;  2Z0V A;  3D52 A;  3SBT B;  4WV7 A;  2ZXQ A;  3CKD A;  3I2W A;  3SYV A;  4EZU A;  1R5E A;  3EJS A;  4EZW A;  4NQI A;  1TQU A;  4JWI A;  2Z0N A;  4HR1 B;  3BVW A;  3D4Y A;  1TQS A;  2QFF A;  3Q84 A;  3M3W A;  2O0I 1;  4EZV A;  2FIC A;  2OW6 A;  1OAO A;  2QXL A;  4AKV A;  2X3V A;  3QNJ A;  4WPC A;  3O3M B;  2NCZ A;  5C5B B;  4D8J A;  1SU6 A;  4AVM A;  2Z8Y A;  3SBS A;  2D4C A;  2GA9 D;  1GNT A;  1SU8 A;  1ZYL A;  4KIK B;  1E2U A;  3N8E A;  3OK8 A;  2QKW A;  1GN9 A;  3Q0K A;  3HAH A;  2OBM A;  4AZI A;  3KAV A;  2WYI A;  1ZWW A;  3BUQ A;  4EZT A;  3CV5 A;  2PY6 A;  2RAJ A;  3DX0 A;  1X04 A;  3T46 A;  3QWE A;  4NPH A;  1LQ7 A;  2F7O A;  4JNE A;  4H8S A;  1O7D B;  3ZED A;  2RAI A;  4EZZ A;  2EWF A;  3DQG A;  1R33 A;  2GAF D;  3UIT A;  1SUF A;  2C08 A;  4HR1 A;  3BUD A;  3SOG A;  2MI7 A;  1Y2O A;  1O7D C;  2ELB A;  1BPR A;  4EZX A;  3T47 A;  1I49 A;  3ABH A;  4PO2 A;  3BUI A;  3D4Z A;  3I04 A;  4I43 A;  4IW0 A;  2Q12 A;  2FYV A;  4I1Q A;  3OHX M;  3LMF A;  2WYH A;  3QA8 A;  2D1L A;  1YWM A;  4AZB A;  2V0O A;  4E3C A;  2F1A A;  3QE6 A;  4R5I A;  4WPE A;  3BVU A;  3ER9 B;  3F7W A;  4ILG A;  1QX1 A;  4AZ7 A;  4FZO A;  4R5G A;  4WV5 A;  1E9V A;  4B9Q A;  2F18 A;  3VEB A;  1U00 A;  4HY9 A;  2F1B A;  3L3O M;  2ND1 A;  2OW7 A;  2YKT A;  2RAK A;  4AZG A;  1I4T A;  2YL8 A;  2Q13 A;  2YI9 A;  4F01 A;  1E1D A;  3D2F A;  1TQT A;  7HSC A;  3DX2 A;  4ILI A;  4EZO A;  4R5L A;  1TQW A;  1CKR A;  3O3O B;  1JQK A;  4ILH B;  3CZN A;  4FZP A;  4EZQ A;  3BVT A;  3EJP A;  1Q5L A;  2F7P A;  4JWC A;  4AZ5 A;  3FD9 A;  4IWO A;  3DX3 A;  4FZS A;  3ACO A;  4HYB A;  3RPM A;  2YIB A;  2JNK A;  3BUP A;  1QWU A;  2GF4 A;  3PLT A;  3EJU A;  4JL9 A;  3B51 X;  3CAZ A;  3HAI A;  3BVX A;  1MJG A;  1X03 A;  2F7Q A;  4IM3 A;  2ALW A;  2LM0 A;  3BUB A;  2OO2 A;  4FM3 A;  4IWP A;  2EFK A;  1HTY A;  2YLA A;  2X3W A;  4EZR A;  3BVV A;  2YL6 A;  3I39 X;  5E84 A;  3A98 A;  4JNF A;  2YL5 A;  5C5B A;  4JWE A;  3DYT A;  3EJT A;  1URU A;  2OBL A;  4AZH A;  3VEA A;  3EJR A;  1I4D A;  5TKY A;  4KIK A;  3LVT A;  4AZC B;  4FL9 A;  3ZEF A;  1QWN A;  2ND0 A;  2LXY A;  5KBP A;  3RV1 A;  4IM2 A;  2YL9 A;  4JWD A;  4JN4 A;  2N3K A;  3CVR A;  3KDR A;  2YIA A;  5FLE X;  5FIG A;  1DG4 A;  3VKH A;  2OP6 A;  3B52 X;  4E81 A;  4MQD A;  4IM0 A;  4EZN A;  1HXK A;  3DDG A;  2YI8 A;  1DKZ A;  4R5K A;  1GNL A;  3I01 A;  4EZP A;  3ERC C;  2BPR A;  2Z0O A;  2PMR A;  3L3P A;  4IWQ A;  4EZS A;  3QNI A;  2RT6 A;  3EJQ A;  4ATM A;  4AZC A;  3C7N B;  1DKX A;  3LLL A;  3ER8 C;  3H0X A;  3G9G A;  3CZS A;  4G6Q A;  3KAW A;  3DPQ A;  1OA0 A;  4NSW A;  1UPX A;  1DKY A;  1HWW A;  3GI7 A;  2JNS A;  3DOB A;  3T49 A;  4AZ6 A;  3DX1 A;  1SU7 A;  4H6H A;  1TQV A;  1I4L A;  3D51 A;  3BLB A;  3T4A G;  2OZN B;  4EZY A;  2X5C A;  2EFL A;  4UDX X;  3O3N B; 
#chains in the Genus database with same CATH homology
 1ZYL A;  2YI9 A;  3B53 X;  4KIK B;  4F01 A;  4FL9 A;  1E2U A;  4F00 A;  3N8E A;  2YIV X;  3ZEF A;  1E1D A;  1YUW A;  1GN9 A;  2ND0 A;  2OBM A;  3D2F A;  3KAV A;  7HSC A;  4UDY X;  4R5J A;  3T48 A;  4ILI A;  3RV1 A;  4EZO A;  4R5L A;  4EZT A;  2EX3 B;  4IM2 A;  2PY6 A;  1OA1 A;  3T46 A;  4JWD A;  4JN4 A;  3O3O B;  1CKR A;  1JQK A;  4ILH B;  2N3K A;  4NPH A;  4EZQ A;  4JNE A;  1Q5L A;  3ZED A;  4JWC A;  4EZZ A;  2EWF A;  1W9M A;  3FD9 A;  3DQG A;  2GAF D;  4IWO A;  4JLC A;  3KDR A;  3UIT A;  3C7N A;  2YIA A;  3OWG A;  1SUF A;  5FLE X;  5FIG A;  4HYB A;  4HR1 A;  1DG4 A;  3VKH A;  4H6I A;  3D2E A;  2OP6 A;  3B52 X;  4M0M A;  4E81 A;  4MQD A;  1BPR A;  4IM0 A;  2YIB A;  3RV0 A;  4EZN A;  4EZX A;  2V7Y A;  3DPO A;  3T47 A;  2YI8 A;  3DPP A;  4PO2 A;  2KHO A;  1DKZ A;  4JL9 A;  2WIN M;  4R5K A;  3I04 A;  3B51 X;  4I43 A;  1GNL A;  3I01 A;  3SBT B;  4EZP A;  4WV7 A;  4IW0 A;  1MJG A;  3ERC C;  2BPR A;  3OHX M;  4IWQ A;  3LMF A;  4IM3 A;  4EZU A;  3QA8 A;  4EZS A;  4EZW A;  2LM0 A;  2RT6 A;  4FM3 A;  4JWI A;  4E3C A;  1DKX A;  3C7N B;  4IWP A;  3ER8 C;  4HR1 B;  4EZR A;  3I39 X;  4R5I A;  3H0X A;  4G6Q A;  5E84 A;  2QFF A;  3A98 A;  3KAW A;  4JNF A;  3DPQ A;  3ER9 B;  1OA0 A;  1UPX A;  4JWE A;  4EZV A;  3F7W A;  1DKY A;  1OAO A;  2QXL A;  2JNS A;  3GI7 A;  3DOB A;  4ILG A;  4R5G A;  3QNJ A;  3T49 A;  4WV5 A;  1E9V A;  1SU7 A;  3O3M B;  4H6H A;  2OBL A;  2NCZ A;  3VEA A;  3T4A G;  4B9Q A;  3VEB A;  4D8J A;  1U00 A;  5TKY A;  4EZY A;  4HY9 A;  4KIK A;  3L3O M;  1SU6 A;  2ND1 A;  2X5C A;  4UDX X;  2Z8Y A;  3O3N B;  3SBS A;  2GA9 D;  1GNT A;  1SU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...