4F0PA

Mspji restriction endonuclease - p31 form
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
450
structure length
450
Chain Sequence
b'DIAWAASAEVANKPRLVFVGDELRYAQGANQRDVELDGFVNYHWLTSPGGLGLPKVMLEAGINAPAEVVGPDRSRRALIAIRSSPWKAGHETNPWHDEFDLDHGHVRYFGDHKPSTVGLPGETKGNRLLLEAARLHAGTTREERLLAPPLFLFRAVTVHRAGRAVVKGHVEFCGAAIIERLEHVVQRDPETGRSFPNLSLDLAVVSGGEIDGVDFRWIDDRRNAALAAGETLRHAPESWIRWVRQGRLAIPGIRRRVLASAVQSSKEQQPASGSAEAATLQTLYKFYDGRKHAFELLASRVAAEVFRESGARYKEGWLSRSSGDGGVDFIGRIDMGSLKASTPVVVLGQAKCIQPTSSVSPEQVARVVARLRRGWIGVYVTTGSFSRQAQVEIIDDQYPVVLIAGGTLAATVRRMVQANYGGDLDALLASTVDEYGAAVTHRRPEEVISL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Restriction endonuclease
publication title Structure and cleavage activity of the tetrameric MspJI DNA modification-dependent restriction endonuclease.
pubmed doi rcsb
source organism Mycobacterium sp.
molecule tags Hydrolase
total genus 120
structure length 450
sequence length 450
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04471 Mrr_cat Restriction endonuclease
A PF18062 RE_AspBHI_N Restriction endonuclease AspBHI N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.280.20 Mainly Beta Roll PUA domain-like PUA domain-like 4f0pA01
3.40.91.100 Alpha Beta 3-Layer(aba) Sandwich Restriction Endonuclease Restriction Endonuclease 4f0pA02
4RZLA 4R28A 4OC8A 4F0QA 4F0PA
chains in the Genus database with same CATH superfamily
4NJ5A 4AVLA 3MQYA 3ODHA 4ZHZA 3FDEA 3N78A 3BAMA 4E5JA 4R28A 3N7BA 3OLNA 3DVOA 3CLZA 5FDGA 3Q0CA 3Q0FA 1M0DA 3HW3A 2E52A 3DPGA 2ZO0B 3BI7A 4YGIA 5CCYA 3V20A 5D2OA 1M0IA 1D2IA 4PW5A 2ZKGA 4E5LA 3HW4A 5JHTA 4E5FA 4AWHA 2BAMA 5D8UA 5FDDA 1KNVA 3WVGA 1FOKA 3F8JB 2ZKEA 5CZNA 1FZRA 3F8IA 4AWMA 4F0PA 4NFZA 2XI5A 2PFJA 5EGAA 4AVQA 3BM3A 3Q0DA 3MQ6A 3V21A 2ZKFA 5D4GA 4E5EA 4E5IA 3V1ZA 3Q0BX 3WVPA 1ESGA 4AWGA 3WVHA 3DW9A 4E5GA 1SDOA 4F0QA 5DBSA 2P14A 3HW5A 4AVGA 3HW6A 3EBJA 5CGVA 4RZLA 4CGSA 1VRRA 1DFMA 1BAMA 4YYLA 4AWKA 4E5HA 5CL0A 5D42A 3DWHA 4PW7A 4CGXA 2GB7A 2EWFA 2P0JA 1BHMA 2ZKDA 2XI7A 1DC1A 3A4KA 1ES8A 4ZQQA 2FQZA 5I13A 5DEBA 2ZO2B 3WVKA 2ZO1B 4CHCA 5D9JA 1CFRA 2PB7A 4PW6A 4AWFA 3WVIA 3CAEA 5DESA 4ZI0A 4OC8A 5JHVA 2FOKA
chains in the Genus database with same CATH topology
4AVLA 3MQYA 3ODHA 4ZHZA 3N78A 3BAMA 4E5JA 4R28A 3N7BA 3DVOA 5FDGA 3Q0CA 3Q0FA 1M0DA 3HW3A 2E52A 3DPGA 4YGIA 5CCYA 3V20A 5D2OA 1M0IA 1D2IA 4E5LA 3HW4A 5JHTA 4E5FA 4AWHA 2BAMA 5D8UA 5FDDA 1KNVA 3WVGA 1FOKA 5CZNA 1FZRA 4AWMA 4F0PA 4NFZA 2XI5A 2PFJA 5EGAA 4AVQA 3BM3A 3Q0DA 3MQ6A 3V21A 5D4GA 4E5EA 4E5IA 3V1ZA 3Q0BX 3WVPA 1ESGA 4AWGA 3WVHA 3DW9A 4E5GA 1SDOA 4F0QA 5DBSA 2P14A 3HW5A 4AVGA 3HW6A 3EBJA 5CGVA 4RZLA 4CGSA 1VRRA 1DFMA 1BAMA 4YYLA 4AWKA 4E5HA 5CL0A 5D42A 4CGXA 2GB7A 2EWFA 2P0JA 1BHMA 2XI7A 1DC1A 3A4KA 1ES8A 4ZQQA 2FQZA 5I13A 5DEBA 3WVKA 4CHCA 5D9JA 1CFRA 4AWFA 3WVIA 3CAEA 5DESA 4ZI0A 4OC8A 5JHVA 2FOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RZL A;  4R28 A;  4OC8 A;  4F0Q A;  4F0P A; 
#chains in the Genus database with same CATH topology
 4NJ5 A;  4AVL A;  3MQY A;  3ODH A;  4ZHZ A;  3FDE A;  3N78 A;  3BAM A;  4E5J A;  4R28 A;  3N7B A;  3OLN A;  3DVO A;  3CLZ A;  5FDG A;  3Q0C A;  3Q0F A;  1M0D A;  3HW3 A;  2E52 A;  3DPG A;  2ZO0 B;  3BI7 A;  4YGI A;  5CCY A;  3V20 A;  5D2O A;  1M0I A;  1D2I A;  4PW5 A;  2ZKG A;  4E5L A;  3HW4 A;  5JHT A;  4E5F A;  4AWH A;  2BAM A;  5D8U A;  5FDD A;  1KNV A;  3WVG A;  1FOK A;  3F8J B;  2ZKE A;  5CZN A;  1FZR A;  3F8I A;  4AWM A;  4F0P A;  4NFZ A;  2XI5 A;  2PFJ A;  5EGA A;  4AVQ A;  3BM3 A;  3Q0D A;  3MQ6 A;  3V21 A;  2ZKF A;  5D4G A;  4E5E A;  4E5I A;  3V1Z A;  3Q0B X;  3WVP A;  1ESG A;  4AWG A;  3WVH A;  3DW9 A;  4E5G A;  1SDO A;  4F0Q A;  5DBS A;  2P14 A;  3HW5 A;  4AVG A;  3HW6 A;  3EBJ A;  5CGV A;  4RZL A;  4CGS A;  1VRR A;  1DFM A;  1BAM A;  4YYL A;  4AWK A;  4E5H A;  5CL0 A;  5D42 A;  3DWH A;  4PW7 A;  4CGX A;  2GB7 A;  2EWF A;  2P0J A;  1BHM A;  2ZKD A;  2XI7 A;  1DC1 A;  3A4K A;  1ES8 A;  4ZQQ A;  2FQZ A;  5I13 A;  5DEB A;  2ZO2 B;  3WVK A;  2ZO1 B;  4CHC A;  5D9J A;  1CFR A;  2PB7 A;  4PW6 A;  4AWF A;  3WVI A;  3CAE A;  5DES A;  4ZI0 A;  4OC8 A;  5JHV A;  2FOK A; 
#chains in the Genus database with same CATH homology
 4AVL A;  3MQY A;  3ODH A;  4ZHZ A;  3N78 A;  3BAM A;  4E5J A;  4R28 A;  3N7B A;  3DVO A;  5FDG A;  3Q0C A;  3Q0F A;  1M0D A;  3HW3 A;  2E52 A;  3DPG A;  4YGI A;  5CCY A;  3V20 A;  5D2O A;  1M0I A;  1D2I A;  4E5L A;  3HW4 A;  5JHT A;  4E5F A;  4AWH A;  2BAM A;  5D8U A;  5FDD A;  1KNV A;  3WVG A;  1FOK A;  5CZN A;  1FZR A;  4AWM A;  4F0P A;  4NFZ A;  2XI5 A;  2PFJ A;  5EGA A;  4AVQ A;  3BM3 A;  3Q0D A;  3MQ6 A;  3V21 A;  5D4G A;  4E5E A;  4E5I A;  3V1Z A;  3Q0B X;  3WVP A;  1ESG A;  4AWG A;  3WVH A;  3DW9 A;  4E5G A;  1SDO A;  4F0Q A;  5DBS A;  2P14 A;  3HW5 A;  4AVG A;  3HW6 A;  3EBJ A;  5CGV A;  4RZL A;  4CGS A;  1VRR A;  1DFM A;  1BAM A;  4YYL A;  4AWK A;  4E5H A;  5CL0 A;  5D42 A;  4CGX A;  2GB7 A;  2EWF A;  2P0J A;  1BHM A;  2XI7 A;  1DC1 A;  3A4K A;  1ES8 A;  4ZQQ A;  2FQZ A;  5I13 A;  5DEB A;  3WVK A;  4CHC A;  5D9J A;  1CFR A;  4AWF A;  3WVI A;  3CAE A;  5DES A;  4ZI0 A;  4OC8 A;  5JHV A;  2FOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...