4F0QA

Mspji restriction endonuclease - p21 form
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
452
structure length
452
Chain Sequence
b'KADIAWAASAEVANKPRLVFVGDELRYAQGANQRDVELDGFVNYHWLTSPGGLGLPKVMLEAGINAPAEVVGPDRSRRALIAIRSSPWKAGHETNPWHDEFDLDHGHVRYFGDHKPSTVGLPGETKGNRLLLEAARLHAGTTREERLLAPPLFLFRAVTVHRAGRAVVKGHVEFCGAAIIERLEHVVQRDPETGRSFPNLSLDLAVVSGGEIDGVDFRWIDDRRNAALAAGETLRHAPESWIRWVRQGRLAIPGIRRRVLASAVQSSKEQQPASGSAEAATLQTLYKFYDGRKHAFELLASRVAAEVFRESGARYKEGWLSRSSGDGGVDFIGRIDMGSLKASTPVVVLGQAKCIQPTSSVSPEQVARVVARLRRGWIGVYVTTGSFSRQAQVEIIDDQYPVVLIAGGTLAATVRRMVQANYGGDLDALLASTVDEYGAAVTHRRPEEVISL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Restriction endonuclease
publication title Structure and cleavage activity of the tetrameric MspJI DNA modification-dependent restriction endonuclease.
pubmed doi rcsb
source organism Mycobacterium sp.
molecule tags Hydrolase
total genus 127
structure length 452
sequence length 452
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04471 Mrr_cat Restriction endonuclease
A PF18062 RE_AspBHI_N Restriction endonuclease AspBHI N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.280.20 Mainly Beta Roll PUA domain-like PUA domain-like 4f0qA01
3.40.91.100 Alpha Beta 3-Layer(aba) Sandwich Restriction Endonuclease Restriction Endonuclease 4f0qA02
4F0PA 4R28A 4OC8A 4RZLA 4F0QA
chains in the Genus database with same CATH superfamily
3V20A 2EWFA 5EGAA 4RZLA 3DWHA 2XI5A 4AVGA 1M0DA 4E5HA 3FDEA 3HW3A 5D9JA 5CZNA 4YGIA 4AWGA 3Q0DA 1FZRA 2FOKA 1ES8A 2ZKEA 4PW5A 5FDDA 3EBJA 3V1ZA 2BAMA 5FDGA 3BAMA 3CAEA 5DBSA 3DW9A 5CCYA 4E5JA 3WVIA 4E5FA 1D2IA 4F0PA 3MQYA 4E5IA 4ZHZA 3N78A 3A4KA 4PW6A 4AWMA 3MQ6A 5D4GA 3V21A 3HW6A 3HW4A 3BI7A 3HW5A 5D42A 5DESA 5D8UA 1M0IA 1BHMA 2ZO2B 5CL0A 3CLZA 3F8JB 3Q0BX 4AVQA 1ESGA 1KNVA 4AVLA 3DPGA 2GB7A 5JHTA 2ZKFA 3WVPA 2FQZA 2XI7A 5CGVA 4YYLA 3WVKA 3N7BA 4NJ5A 4AWKA 5D2OA 3BM3A 2PFJA 3WVGA 4PW7A 1SDOA 1DFMA 2ZKGA 3ODHA 5I13A 4CGSA 1CFRA 4R28A 2PB7A 4E5EA 3Q0CA 1BAMA 1VRRA 5DEBA 4ZQQA 2ZO1B 4E5GA 2ZO0B 1FOKA 3F8IA 2P0JA 4AWHA 4E5LA 2P14A 3DVOA 2E52A 4AWFA 4NFZA 5JHVA 4F0QA 3OLNA 4CHCA 1DC1A 3WVHA 4ZI0A 3Q0FA 4OC8A 2ZKDA 4CGXA
chains in the Genus database with same CATH topology
3V20A 2EWFA 5EGAA 4RZLA 2XI5A 4AVGA 1M0DA 4E5HA 3HW3A 5D9JA 5CZNA 4YGIA 4AWGA 3Q0DA 1FZRA 2FOKA 1ES8A 5FDDA 3EBJA 3V1ZA 2BAMA 5FDGA 3BAMA 3CAEA 5DBSA 3DW9A 5CCYA 4E5JA 3WVIA 4E5FA 1D2IA 4F0PA 3MQYA 4E5IA 4ZHZA 3N78A 3A4KA 4AWMA 3MQ6A 5D4GA 3V21A 3HW6A 3HW4A 3HW5A 5D42A 5DESA 5D8UA 1M0IA 1BHMA 5CL0A 3Q0BX 4AVQA 1ESGA 1KNVA 4AVLA 3DPGA 2GB7A 5JHTA 3WVPA 2FQZA 2XI7A 5CGVA 4YYLA 3WVKA 3N7BA 4AWKA 5D2OA 3BM3A 2PFJA 3WVGA 1SDOA 1DFMA 3ODHA 5I13A 4CGSA 1CFRA 4R28A 4E5EA 3Q0CA 1BAMA 1VRRA 5DEBA 4ZQQA 4E5GA 1FOKA 2P0JA 4AWHA 4E5LA 2P14A 3DVOA 2E52A 4AWFA 4NFZA 5JHVA 4F0QA 4CHCA 1DC1A 3WVHA 4ZI0A 3Q0FA 4OC8A 4CGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F0P A;  4R28 A;  4OC8 A;  4RZL A;  4F0Q A; 
#chains in the Genus database with same CATH topology
 3V20 A;  2EWF A;  5EGA A;  4RZL A;  3DWH A;  2XI5 A;  4AVG A;  1M0D A;  4E5H A;  3FDE A;  3HW3 A;  5D9J A;  5CZN A;  4YGI A;  4AWG A;  3Q0D A;  1FZR A;  2FOK A;  1ES8 A;  2ZKE A;  4PW5 A;  5FDD A;  3EBJ A;  3V1Z A;  2BAM A;  5FDG A;  3BAM A;  3CAE A;  5DBS A;  3DW9 A;  5CCY A;  4E5J A;  3WVI A;  4E5F A;  1D2I A;  4F0P A;  3MQY A;  4E5I A;  4ZHZ A;  3N78 A;  3A4K A;  4PW6 A;  4AWM A;  3MQ6 A;  5D4G A;  3V21 A;  3HW6 A;  3HW4 A;  3BI7 A;  3HW5 A;  5D42 A;  5DES A;  5D8U A;  1M0I A;  1BHM A;  2ZO2 B;  5CL0 A;  3CLZ A;  3F8J B;  3Q0B X;  4AVQ A;  1ESG A;  1KNV A;  4AVL A;  3DPG A;  2GB7 A;  5JHT A;  2ZKF A;  3WVP A;  2FQZ A;  2XI7 A;  5CGV A;  4YYL A;  3WVK A;  3N7B A;  4NJ5 A;  4AWK A;  5D2O A;  3BM3 A;  2PFJ A;  3WVG A;  4PW7 A;  1SDO A;  1DFM A;  2ZKG A;  3ODH A;  5I13 A;  4CGS A;  1CFR A;  4R28 A;  2PB7 A;  4E5E A;  3Q0C A;  1BAM A;  1VRR A;  5DEB A;  4ZQQ A;  2ZO1 B;  4E5G A;  2ZO0 B;  1FOK A;  3F8I A;  2P0J A;  4AWH A;  4E5L A;  2P14 A;  3DVO A;  2E52 A;  4AWF A;  4NFZ A;  5JHV A;  4F0Q A;  3OLN A;  4CHC A;  1DC1 A;  3WVH A;  4ZI0 A;  3Q0F A;  4OC8 A;  2ZKD A;  4CGX A; 
#chains in the Genus database with same CATH homology
 3V20 A;  2EWF A;  5EGA A;  4RZL A;  2XI5 A;  4AVG A;  1M0D A;  4E5H A;  3HW3 A;  5D9J A;  5CZN A;  4YGI A;  4AWG A;  3Q0D A;  1FZR A;  2FOK A;  1ES8 A;  5FDD A;  3EBJ A;  3V1Z A;  2BAM A;  5FDG A;  3BAM A;  3CAE A;  5DBS A;  3DW9 A;  5CCY A;  4E5J A;  3WVI A;  4E5F A;  1D2I A;  4F0P A;  3MQY A;  4E5I A;  4ZHZ A;  3N78 A;  3A4K A;  4AWM A;  3MQ6 A;  5D4G A;  3V21 A;  3HW6 A;  3HW4 A;  3HW5 A;  5D42 A;  5DES A;  5D8U A;  1M0I A;  1BHM A;  5CL0 A;  3Q0B X;  4AVQ A;  1ESG A;  1KNV A;  4AVL A;  3DPG A;  2GB7 A;  5JHT A;  3WVP A;  2FQZ A;  2XI7 A;  5CGV A;  4YYL A;  3WVK A;  3N7B A;  4AWK A;  5D2O A;  3BM3 A;  2PFJ A;  3WVG A;  1SDO A;  1DFM A;  3ODH A;  5I13 A;  4CGS A;  1CFR A;  4R28 A;  4E5E A;  3Q0C A;  1BAM A;  1VRR A;  5DEB A;  4ZQQ A;  4E5G A;  1FOK A;  2P0J A;  4AWH A;  4E5L A;  2P14 A;  3DVO A;  2E52 A;  4AWF A;  4NFZ A;  5JHV A;  4F0Q A;  4CHC A;  1DC1 A;  3WVH A;  4ZI0 A;  3Q0F A;  4OC8 A;  4CGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...