4F0YA

Crystal structure of aminoglycoside antibiotic 6'-n-acetyltransferase aac(6')-ig from acinetobacter haemolyticus, apo
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
145
structure length
145
Chain Sequence
MNIKPASEASLKDWLELRNKLWSDSEASHLQEMHQLLAEKYALQLLAYSDHQAIAMLEASIRFEYVNGTETSPVGFLEGIYVLPAHRRSGVATMLIRQAEVWAKQFSCTEFASDAALDNVISHAMHRSLGFQETEKVVYFSKKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside N(6')-acetyltransferase type 1
publication title Structural and Biochemical Characterization of Acinetobacter spp. Aminoglycoside Acetyltransferases Highlights Functional and Evolutionary Variation among Antibiotic Resistance Enzymes.
pubmed doi rcsb
source organism Acinetobacter haemolyticus
molecule tags Transferase
total genus 38
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2012-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4f0yA00
1SQHA 3CXQA 2VI7A 2J8NA 4AVBA 2PR8A 2ZW4A 4KORA 1XE4A 1YX0A 3W6SA 5F48A 2ZW6A 3R9GA 4Y49B 4KOYA 3WR7A 2VZZA 1RO5A 3DNSA 2WPWA 3T90A 4NXYA 2FE7A 4GS4A 5IB0A 4XPDC 3B8GA 4PK3A 2D4OA 1M4IA 1B87A 1VHSA 3UY5A 1QSRA 2P6EA 1IICA 5CNPA 4QVTA 3F8KA 1I1DA 4MHDA 4MY3A 2VXKA 3SHPA 4KVOE 2GANA 2H5MA 3EC4A 5EBVA 3TOAA 2B4DB 4F6AA 1Y9KA 4U5YA 4HKFA 1I21A 3NE7A 1M4GA 1NSLA 2FCKA 2OU2A 2J8RA 5F49A 4CAVA 1M4DA 3MGDA 4KUAA 4MBUA 4KVME 5J8FA 3FB3A 4HNYB 3T9YA 1Q2YA 3H4QA 2ZW5A 3FXTA 1QSNA 2VBQA 1PU9A 4JXQA 1YVKA 2RC4A 1OZPA 1UFHA 1NMTA 4HNXB 3G3SA 4JWPA 2Q44A 3JVNA 3KKWA 5C88A 5DWMA 4MY0A 4ORFA 4E8OA 2PRBA 4OLLA 1VKCA 4YRHA 3R9FA 4JXRA 2VZYA 3I3GA 1YR0A 2B4DA 1WK4A 2Q7BA 3TO7A 4L8AA 2I79A 4NF1A 4XPDB 3TO6A 3FIXA 4FD7A 5J8CA 2ARHA 1MJBA 2BUEA 4NEXA 4F0YA 3P2HA 2I00A 2P0WA 2Y0MA 3D2MA 5KTCA 1XMTA 2F5IA 3C26A 2FL4A 3PZJA 3K9UA 2Z11A 1KZFA 3R9EA 3RYOA 4EVYA 4ZBGA 4QBJA 3W6XA 1CJWA 1XIXA 1YLEA 1CM0A 1GHEA 2CNTA 3LODA 1N71A 2K5TA 4UBRA 2NMTA 2G3TA 4KUBA 4M3SA 3GKRA 2O28A 1Z4RA 3EO4A 4KVXA 2VEZA 4BMHA 4KOTA 2CNMA 3R96A 4LX9A 4H6ZA 3TTHA 4RS2A 4CAWA 1S60A 4PV6A 4XNHC 2P6GA 5KTDA 1V0CA 2OZHA 2ZPAA 3SXNA 3VWEA 4JLYA 1U6MA 5H86A 1WWZA 1M1DA 3EFAA 3ZJ0A 4KOXA 3LD2A 4X5KA 3D8PA 2Z10A 4H6UA 4AB7A 1B6BA 2Q4YA 2IL4A 2D4PA 4E0AA 2JEVA 2B58A 2G3AA 2PC1A 3GYAA 5KTAA 1MJAA 3BJ8A 3QAHA 2B5GB 3TT2A 1MK4A 3F0AA 4FD6A 4CAXA 4R87A 5ISVA 4L89A 1Y7RA 1IYLA 3BLNA 4HNWB 2B3VA 3F5BA 1FY7A 2FT0A 4II9A 1Y9WA 2PSWA 2R1IA 4CS0B 3IWGA 1IYKA 4H89A 2EUIA 5F46A 5EC4A 3I9SA 4B5OA 3CXPA 4AG7A 1ON0A 3D2PA 1YK3A 5JQ4A 1P4NA 4E2AA 5IX3A 3FYNA 2JLMA 2R8VA 3PP9A 4R9MA 2Z0ZA 3E0KA 4UWJA 4KLWA 4JD6A 3P2FA 1TIQA 4RI1A 4UWIA 2J8MA 4PK2A 4NSQA 2FSRA 4OADA 4XNHB 2Q0YA 2B5GA 3PGPA 4KOWA 1P0HA 2G0BA 4K30A 4I49A 3DDDA 1YREA 1S3ZA 1S7LA 1I12A 2CNSA 4NCZA 3DR8A 2OH1A 2FXFA 3FRMA 1S7NA 1S5KA 2JDDA 4B5PB 4MI4A 3FBUA 2HV2A 4CRYB 3ZZIA 1QSOA 3TCVA 2DXQA 2CY2A 5HH1A 3W91A 2P6FA 3GY9A 3OWCA 4R3LA 2AJ6A 3D3SA 5C82A 2AE6A 3S6HA 5IV0A 3TO9A 3BJ7A 5H84A 2BEIA 2GIVA 1S7KA 2ZW7A 4U9YA 2EVNA 3QB8A 1XEBA 2OZGA 4YGOA 2REEA 4AG9A 2KCWA 1Q2CA 1Q2DA 3N7ZA 4DNCA 3FNCA 1S7FA 3TOBA 1RXTA 1L0CA 3TE4A 1IIDA 2R98A 5FVJA 5JPHA 4QB9A 1QSMA 4B5PA 3EY5A 2HQYA 2Q4VA 1XF8A 2X7BA 4UA3A 2JDCA 1MJ9A 3IGRA 2A4NA 4XPKA 3VWDA 3G8WA 4J3GA 3SXOA 1J4JA 4KZTA 4ONUA 5HMNA 1K4JA 1YGHA 4OAEA 4AVCA 4AVAA 4CRZB 2Q04A 2HUZA 4FD5A 5F47A 4R3KA 4LUAA 1KUVA 4IF5A 3R95A 1Z4EA 2BL1A 3DSBA 4Y49C 2WPXA 4XPLA 1M44A 1QSTA 3S6FA 4KLVA 2R7HA 4KOVA 2REFA 1LRZA 2QIRA 4PSWA 2OB0A 4QC6A 3R1KA 1YVOA 4FD4A 1BOBA 1KUYA 2ATRA 2GE3A 3DR6A 3V8IA 1KUXA 2FIWA 3CXSA 2PDOA 5E96A 4MJ8A 4JJXA 2FIAA 1IB1E 5DWNA 4KOUA 2PR1A 4U9ZA 2VQYA 1R57A 4KOSA 5GCNA 2QMLA 5I0CA 2BSWA 4M85A 4R57A 2B4BA 1BO4A 3TFYA 2QECA 2PQ8A 4QUSA 2ZXVA 3EXNA 1PUAA 3S6KA 1Z9UA 2FS5A 2B3UA 1NE9A 2C27A 4IUSA 4YFJA 4PSXA 3JUWA 2OZUA 3S6GA
chains in the Genus database with same CATH superfamily
1BAVA 2AFUA 3IU2A 4MFPA 1X10A 6CPAA 1SQHA 2C6CA 3CXQA 2ZOGA 2VI7A 5LRKA 2J8NA 3HUVA 2V8DA 2Q4ZA 3PB6X 4AVBA 2PR8A 2ZW4A 4KORA 5AG5A 3RNZA 4CYPA 1XE4A 1YX0A 3N5FA 3W6SA 4A37A 4OMEA 3D7GA 3IC1A 5LYDA 1Y0YA 5F48A 3QAYA 2ZW6A 3R9GA 4Y49B 4DUKA 4KOYA 5EMIA 3WR7A 2VZZA 3VH9A 1RO5A 3IEHA 2CIJA 3DNSA 3B35A 2WPWA 2PVVA 3T90A 4NXYA 3MRUA 2FE7A 2PVWA 4GS4A 5CBMA 1DE4C 3D4UA 5IB0A 4XPDC 3B8GA 4OC4A 4PK3A 4F9VA 4PXEA 1HEEA 2D4OA 4IAVA 1M4IA 4OIWA 1B87A 1VHSA 1Z8WA 1QSRA 3UY5A 4C7HA 4NGPA 4A31A 2IJZA 2P6EA 1IICA 5CNPA 4NFRA 4PXCA 4QVTA 3F8KA 1I1DA 4MHDA 1TKHA 8CPAA 4MY3A 1H8LA 3FH4A 2VXKA 1Y0RA 3PFOA 4X8IA 5AG6A 3SHPA 4B14A 5JM6A 1XJOA 2ZENA 3D7HA 2GANA 4KVOE 4P6YA 2H5MA 5A27A 3EC4A 5EBVA 3SJEA 2B4DB 3TOAA 4OIDA 4F6AA 4JZ0A 1Y9KA 3L2NA 4P4IA 1CG2A 3K2KA 4U5YA 4HKFA 3SI0A 1ELMP 1I21A 3NE7A 1M4GA 1NSLA 4AXVA 1HDUA 4P4EA 1XOVA 2FCKA 4C2YA 2OU2A 3I1UA 5I4MA 3ISXA 2C1CA 3KR4A 2J8RA 2ZEFA 2POKA 5F49A 4CAVA 2YNEA 4CPAA 4B10A 1M4DA 3MGDA 3NH4A 4KUAA 4MBUA 4KVME 5J8FA 3FB3A 4MCRA 2V8GA 3BI0A 2GU2A 2AFXA 1FT7A 4HNYB 2I3CA 2AFSA 1Q2YA 3T9YA 4CGNA 3H4QA 2ZW5A 1Y7EA 3FXTA 1QSNA 2VBQA 1JWQA 1PU9A 4JXQA 4ZY2A 3HLPA 2HB6A 3GB0A 4KSAA 3H8GA 1KWMA 3NA6A 1YVKA 2RC4A 1OZPA 3RAMA 4C68A 1UFHA 1NMTA 4LQ6A 4BD9A 4HNXB 3G3SA 4KS9A 4PPZA 4JWPA 2Q44A 3B3WA 5CPAA 4FWUA 1AYEA 3JVNA 5JGFA 4A32A 5IB9A 3IIBA 3KKWA 2DPTA 2PJBA 5DWMA 4MY0A 3LACA 5DS0A 3KR5A 5A28A 5C88A 4UEZA 2Z3LA 2CF4A 4MHZA 4ORFA 1VIXA 3B3VA 2PRBA 4OLLA 4E8OA 1VKCA 4YRHA 3R9FA 3LWUA 1YSJA 1ZG8A 2JBJA 2VZYA 3I3GA 1YR0A 4JXRA 2GLJA 4NGNA 4A39A 3CT9A 4KSIA 4LQGA 2HC9A 2B4DA 2AFOA 1WK4A 2JEWA 4R76A 1CP6A 1VGYA 2Q7BA 4UEEA 3TO7A 4L8AA 2I79A 1F2OA 4NF1A 3VARA 4XPDB 1ZLHA 4NGTA 3TO6A 4MHNA 1IGBA 3KGQA 1YQEA 3B2YA 3FIXA 4FD7A 5J8CA 2ARHA 1MJBA 1YW6A 3B3SA 1AMPA 2BUEA 5K8PA 4NEXA 4F0YA 2F8HA 3P2HA 2I00A 1ARLA 4KSFA 1ZLIA 4P4JA 2P0WA 2Y0MA 3D2MA 5KTCA 1XMTA 2F5IA 3C26A 2FL4A 4ZY1A 3FJUA 1XBUA 3PZJA 1LANA 2XEIA 3K9UA 2Q7SA 2Z11A 1QQ9A 1EE3P 1KZFA 3PB9X 3PRTA 3R9EA 3RYOA 4EVYA 4ZBGA 2GLFA 4QBJA 3PBBA 1CJWA 3W6XA 1IOIA 1XIXA 4MFLA 3FMCA 3D68A 4EWTA 1YLEA 2ABZA 1CM0A 1GHEA 2CTBA 2O4HA 1R43A 2CNTA 3S9NA 3NE8A 3LODA 2G9DA 1N71A 2K5TA 4UBRA 4ZY0A 2NMTA 2G3TA 4KUBA 4M3SA 2CXAA 4NGSA 3GKRA 2PJAA 2O28A 1Z4RA 2YGWA 3EO4A 4KVXA 4C2ZA 3PEIA 4UCMA 4ZX8A 2EK8A 2VEZA 1YLOA 1X12A 2NYQA 2WSAA 3KHXA 4OC0A 2PJCA 2WYRA 4BMHA 1IY7A 4KOTA 4CAEA 2CNMA 3KI9A 3R96A 5HVHA 3PB7X 4H6ZA 4LX9A 3DLJA 3TTHA 4RS2A 5THWA 1LAMA 4CAWA 4IHMA 4Z65A 2QYVA 2GFQA 1S60A 4PV6A 4XNHC 2P6GA 1BLLE 5KTDA 1V0CA 2OZHA 3K9TA 2ZPAA 3SXNA 2YNCC 3PBEA 3NH5A 4G1PA 2Z3NA 4CGLA 5J1QA 1PYTB 4JLYA 2EK9A 3VWEA 1U6MA 5H86A 3TC8A 1LCPA 5K8MA 1WWZA 2ZEGA 1M1DA 3B3CA 4UEFA 1TXRA 2WUUA 3EFAA 4NGQA 3ZJ0A 2PIZA 3ISZA 3LD2A 2Z3KA 4KOXA 4NJRA 4OC5A 4X5KA 2PJ9A 3WC5A 3D8PA 2Z10A 4H6UA 4AB7A 1B6BA 2Q4YA 2IL4A 4MCSA 4O23A 5LYLA 2D4PA 4B13A 2RFHA 4E0AA 3FEDA 2JEVA 3KQZA 2B58A 4K3NA 5D8NA 2G3AA 4CGPA 3H8FA 4DYOA 1XMBA 2PC1A 2OR4A 4X3RA 3GYAA 4F0XA 1MJAA 2DEAA 3BJ8A 5KTAA 3QAHA 2B5GB 3TT2A 2OOTA 1MK4A 4BINA 4UFVA 3F0AA 4H2KA 4FD6A 4CAXA 3GIUA 3SJXA 2DPSA 2V8HA 4R87A 3JRUA 5ISVA 4L89A 4P4BA 1Y7RA 4UFWA 4UCPA 1ZG7A 1IYLA 3FEEA 1Z8LA 3BLNA 2B3VA 1LAPA 3BXMA 4HNWB 1ZG9A 3F5BA 1F57A 4MFQA 1FY7A 2FT0A 2FVGA 3IWEA 3KHZA 5ELYA 4II9A 3BI1A 4FAIA 1Y9WA 2PSWA 4FBEA 2R1IA 4R6TA 4CS0B 2RB7A 2J9AA 2YNDA 3IWGA 4CYOA 1LFWA 1IYKA 5K8OA 4H89A 2EUIA 4B6ZA 4FUUA 4RN7A 5F46A 5EC4A 3I9SA 1LOKA 4B5OA 5G21A 3CXPA 4IK2A 4AG7A 1ON0A 4CYQA 3D2PA 1YK3A 1FNOA 5HVGA 2V77A 5JQ4A 4A38A 1TF9A 1P4NA 2PJ8A 2XEJA 4E2AA 5IX3A 2BOAA 3D7DA 3FYNA 1ZO0A 2JLMA 2R8VA 4UFXA 3PP9A 4R9MA 1OBRA 4NGMA 1QMUA 2Z0ZA 3E0KA 4Q7AA 4UIAA 4UWJA 2JBKA 4KLWA 4JD6A 2IMOA 4F8ZA 4NGRA 4OKOA 3P2FA 1TIQA 2NSMA 4RI1A 1R3NA 2QJ8A 4UWIA 2J8MA 1CPSA 4PK2A 4NSQA 2FSRA 4OADA 4XNHB 5HXDA 4WJBA 3GLJA 2Q0YA 2B5GA 3B7IA 3PGPA 4KOWA 1P0HA 2G0BA 4K30A 1IU8A 4I49A 4ZI6A 4MFZA 3DDDA 1YREA 1S3ZA 1S7LA 3LMSA 1I12A 2CNSA 3NFZA 4NCZA 3IU1A 4OP4A 4P4FA 3KQXA 3DR8A 2OH1A 2FXFA 4R8FA 3FRMA 1JQGA 3WC6A 1S7NA 1Z5RA 1S5KA 4EFDA 3RO0A 3SJFA 2JDDA 4B5PB 4MI4A 3FBUA 5AG7A 2HV2A 3D66A 4CRYB 1CBXA 4MHPA 2C6GA 2PJ4A 3ZZIA 1QSOA 4YU9A 3TCVA 4A95A 3GUXA 2DXQA 4CGOA 1UWYA 2CY2A 3IO1A 5HH1A 1Z2LA 1AUGA 2PJ2A 4OC3A 3W91A 2ZEMA 4MFJA 2P6FA 5AGEA 3S9LA 4A33A 2DF5A 3GY9A 2BO9A 2PJ7A 4EMEA 3OWCA 4TWEA 4R3LA 2AJ6A 4ONWA 1VHEA 3D3SA 5C82A 2AE6A 1F2PA 2EWBA 3S6HA 1RTQA 4CAFA 5IV0A 1BPMA 3T8WA 3TO9A 3PB4X 4UCNA 2Q43A 3BJ7A 5H84A 2BEIA 2GIVA 1BPNA 1S7KA 2ZW7A 4U9YA 2EVNA 3QB8A 5LYFA 5HVFA 7CPAA 1CPXA 1XEBA 4C2XA 3H8EA 1IOFA 3PB8X 4OC2A 4P44A 4GXHA 4GM5A 1ELLP 4C7IA 2OZGA 5BWAB 4YGOA 3V38A 2YNCA 2REEA 3IFEA 3VATA 2KCWA 5LYIA 4AG9A 1Q2CA 2PIYA 3SI1A 4ZX9A 1Q2DA 1CX8A 2ZOFA 3H5ZA 3N7ZA 2XEFA 4UIBA 3PFEA 4DNCA 5AG4A 4ZGYB 3FNCA 3FX6A 1S7FA 3TOBA 1RXTA 1L0CA 3FVLA 3JTKA 2Z3MA 4MFKA 4ZYQA 3TE4A 3WABA 1IIDA 2R98A 5FVJA 5JPHA 2C6PA 4P45A 2PJ5A 4TNUA 2O53A 4NJQA 4QB9A 1QSMA 1HDQA 2GREA 4B5PA 4M6IA 1GYTA 3EY5A 4MXUA 1M4LA 3IWWA 2HQYA 4F9UA 2Q4VA 1XF8A 2X7BA 4UA3A 4CGMA 1DTDA 2JDCA 3RZAA 1MJ9A 3IGRA 5G1ZA 2A4NA 2PJ3A 5JH9A 4XPKA 3VWDA 2ANPA 4P4DA 4WWVA 3G8WA 3A9LA 4J3GA 3SXOA 4MRIA 3BHXA 3KL9A 1J4JA 4PQAA 5F09A 5LRJA 4KZTA 4ONUA 5G22A 1K4JA 5HMNA 1YGHA 4OAEA 4AVCA 2PJ0A 4AVAA 4CRZB 4CYNA 1YMEA 1VHOA 2HUZA 2Q04A 4FD5A 5F47A 4A94A 2ZEPA 4R3KA 3FECA 4LUAA 1KUVA 2AFZA 3KASA 3IJ3A 1TF8A 4IF5A 3D7FA 3R95A 1Z4EA 2BL1A 3DSBA 4Y49C 2WPXA 4XPLA 1M44A 1QSTA 3S6FA 3CPAA 2R7HA 4KLVA 4KOVA 4MCQA 2REFA 2ZEDA 1LRZA 2WZNA 4PXDA 4M6HA 2VL1A 2QIRA 2Z3PA 3KZWA 1A2ZA 4MHYA 4PSWA 3TX8A 2OB0A 2ZELA 2ZEHA 4W9YA 4JYWA 4QC6A 4MMOA 5LRGA 3R1KA 3D67A 4YWYA 1YVOA 2EO8A 4FD4A 1BOBA 1KUYA 2ATRA 4MCPA 2GE3A 2PJ1A 2Z3OA 4DJLA 2AFMA 4Q36A 4BBHA 3DR6A 3V8IA 4RUHA 2PCUA 1TKJA 4M6GA 3FF3A 1KUXA 3B3TA 3QNVA 2FIWA 3CXSA 3S9MA 1Z8XA 2PDOA 5E96A 2XEGA 4MJ8A 4JJXA 2IQ6A 5G20A 3V7ZA 2FIAA 2ZEOA 1IB1E 5DWNA 2PE3A 3WT4A 4A2ZA 4KOUA 2ZEEA 3WC7A 1Z8TA 3SJGA 4P10A 5D29A 2PR1A 2PJ6A 4U9ZA 2VQYA 1R57A 2BCOA 4KOSA 1YW4A 5GCNA 1PCAA 2QMLA 4UF4A 4B11A 5I0CA 1XRYA 2BSWA 3RBUA 1TKFA 4M85A 2V8VA 2B4BA 1BO4A 4R57A 4X2TA 3TFYA 2PRQA 2ODFA 2QECA 2PQ8A 3SI2A 4QUSA 4A30A 2ZXVA 4OC1A 2F7VA 2QVPA 3DGVA 4R7MA 3EXNA 1ARMA 1CP7A 1PUAA 3CZXA 3CDXA 1Q7LA 3MN8A 1Z9UA 4Q38A 4PXBA 3NH8A 3S6KA 2FS5A 1NSAA 2B3UA 1NE9A 2CTCA 2C27A 2EBJA 3CPXA 4HPSA 4IUSA 4B12A 1XFOA 3JUWA 4PSXA 2OZUA 3S6GA 4YFJA 2Q51A 2AFWA 5K8NA
chains in the Genus database with same CATH topology
3IU2A 4MFPA 1SQHA 3CXQA 2VI7A 2J8NA 4AVBA 2PR8A 2ZW4A 4KORA 5AG5A 4CYPA 1XE4A 1YX0A 3W6SA 5F48A 2ZW6A 3R9GA 4Y49B 4KOYA 3WR7A 2VZZA 1RO5A 3DNSA 2WPWA 3T90A 4NXYA 2FE7A 4GS4A 5IB0A 4XPDC 3B8GA 4PK3A 2D4OA 1M4IA 1B87A 1VHSA 3UY5A 1QSRA 4C7HA 4A31A 2P6EA 1IICA 5CNPA 4QVTA 3F8KA 1I1DA 4MHDA 4MY3A 2VXKA 4B14A 5AG6A 3SHPA 4KVOE 2GANA 2H5MA 5A27A 3EC4A 5EBVA 3TOAA 2B4DB 4F6AA 1Y9KA 4U5YA 4HKFA 1I21A 3NE7A 1M4GA 1NSLA 2FCKA 4C2YA 2OU2A 2J8RA 5F49A 4CAVA 2YNEA 4B10A 1M4DA 3MGDA 4KUAA 4MBUA 4KVME 5J8FA 3FB3A 4HNYB 3T9YA 1Q2YA 4CGNA 3H4QA 2ZW5A 3FXTA 1QSNA 2VBQA 1PU9A 4JXQA 4KSAA 1YVKA 2RC4A 1OZPA 4C68A 1UFHA 1NMTA 4HNXB 3G3SA 4KS9A 4JWPA 2Q44A 3JVNA 4A32A 3KKWA 2DPTA 5A28A 5DWMA 4MY0A 5C88A 2Z3LA 4ORFA 4E8OA 2PRBA 4OLLA 1VKCA 4YRHA 3R9FA 4JXRA 2VZYA 3I3GA 1YR0A 2B4DA 1WK4A 2Q7BA 3TO7A 4L8AA 2I79A 4NF1A 4XPDB 3TO6A 3FIXA 4FD7A 5J8CA 2ARHA 1MJBA 2BUEA 4NEXA 4F0YA 3P2HA 2I00A 4KSFA 2P0WA 2Y0MA 3D2MA 5KTCA 1XMTA 2F5IA 3C26A 2FL4A 3PZJA 3K9UA 2Z11A 1KZFA 3R9EA 3RYOA 4EVYA 4ZBGA 4QBJA 3W6XA 1CJWA 1XIXA 4MFLA 1YLEA 1CM0A 1GHEA 2CNTA 3LODA 1N71A 2K5TA 4UBRA 2NMTA 2G3TA 4KUBA 4M3SA 2CXAA 3GKRA 2O28A 1Z4RA 2YGWA 3EO4A 4KVXA 4C2ZA 4UCMA 2VEZA 2WSAA 4BMHA 4KOTA 4CAEA 2CNMA 3R96A 4LX9A 4H6ZA 3TTHA 4RS2A 4CAWA 1S60A 4PV6A 4XNHC 2P6GA 5KTDA 1V0CA 2OZHA 2ZPAA 3SXNA 2YNCC 2Z3NA 4CGLA 3VWEA 4JLYA 1U6MA 5H86A 1WWZA 1M1DA 2WUUA 3EFAA 3ZJ0A 4KOXA 3LD2A 2Z3KA 4X5KA 3D8PA 2Z10A 4H6UA 4AB7A 1B6BA 2Q4YA 2IL4A 2D4PA 4B13A 4E0AA 2JEVA 2B58A 4CGPA 2G3AA 4F0XA 2PC1A 3GYAA 5KTAA 1MJAA 3BJ8A 3QAHA 2B5GB 3TT2A 1MK4A 4UFVA 3F0AA 4FD6A 4CAXA 2DPSA 4R87A 5ISVA 4L89A 4UFWA 1Y7RA 4UCPA 1IYLA 3BLNA 4HNWB 2B3VA 3F5BA 4MFQA 1FY7A 2FT0A 3IWEA 4II9A 1Y9WA 2PSWA 2R1IA 4CS0B 2YNDA 3IWGA 4CYOA 1IYKA 4H89A 2EUIA 5F46A 5EC4A 3I9SA 4B5OA 5G21A 3CXPA 4AG7A 1ON0A 4CYQA 3D2PA 1YK3A 5JQ4A 1P4NA 4E2AA 5IX3A 3FYNA 1ZO0A 2JLMA 2R8VA 4UFXA 3PP9A 4R9MA 2Z0ZA 3E0KA 4UWJA 4KLWA 4JD6A 3P2FA 1TIQA 4RI1A 4UWIA 2J8MA 4PK2A 4NSQA 2FSRA 4OADA 4XNHB 2Q0YA 2B5GA 3PGPA 4KOWA 1P0HA 2G0BA 4K30A 4I49A 4MFZA 3DDDA 1YREA 1S3ZA 1S7LA 1I12A 2CNSA 4NCZA 3IU1A 3DR8A 2OH1A 2FXFA 3FRMA 1S7NA 1S5KA 2JDDA 4B5PB 4MI4A 3FBUA 5AG7A 2HV2A 4CRYB 3ZZIA 1QSOA 3TCVA 4A95A 2DXQA 4CGOA 2CY2A 5HH1A 3W91A 5AGEA 4MFJA 2P6FA 4A33A 3GY9A 3OWCA 4R3LA 2AJ6A 3D3SA 5C82A 2AE6A 3S6HA 5IV0A 4CAFA 3TO9A 4UCNA 3BJ7A 5H84A 2BEIA 2GIVA 1S7KA 2ZW7A 4U9YA 2EVNA 3QB8A 1XEBA 4C2XA 4C7IA 2OZGA 5BWAB 4YGOA 2YNCA 2REEA 4AG9A 2KCWA 1Q2CA 1Q2DA 3H5ZA 3N7ZA 4DNCA 5AG4A 4ZGYB 3FNCA 1S7FA 3TOBA 1RXTA 1L0CA 3JTKA 4MFKA 2Z3MA 3TE4A 1IIDA 2R98A 5FVJA 5JPHA 4QB9A 1QSMA 4B5PA 3EY5A 2HQYA 2Q4VA 1XF8A 2X7BA 4UA3A 4CGMA 2JDCA 1MJ9A 3IGRA 5G1ZA 2A4NA 4XPKA 3VWDA 3G8WA 3A9LA 4J3GA 3SXOA 1J4JA 4KZTA 4ONUA 5G22A 1K4JA 5HMNA 1YGHA 4OAEA 4AVCA 4AVAA 4CRZB 4CYNA 2Q04A 2HUZA 4FD5A 5F47A 4R3KA 4LUAA 1KUVA 4IF5A 3R95A 1Z4EA 2BL1A 3DSBA 4Y49C 2WPXA 4XPLA 1M44A 1QSTA 3S6FA 4KLVA 2R7HA 4KOVA 2REFA 1LRZA 2QIRA 2Z3PA 4PSWA 2OB0A 4QC6A 3R1KA 1YVOA 4FD4A 1BOBA 1KUYA 2ATRA 2GE3A 2Z3OA 4Q36A 4BBHA 3DR6A 3V8IA 1KUXA 2FIWA 3CXSA 2PDOA 5E96A 4MJ8A 4JJXA 5G20A 2FIAA 1IB1E 5DWNA 4A2ZA 4KOUA 2PR1A 4U9ZA 2VQYA 1R57A 4KOSA 5GCNA 2QMLA 4B11A 5I0CA 2BSWA 4M85A 4R57A 2B4BA 1BO4A 3TFYA 4A30A 2QECA 2PQ8A 4QUSA 2ZXVA 3EXNA 1PUAA 4Q38A 3S6KA 1Z9UA 2FS5A 2B3UA 1NE9A 2C27A 4IUSA 4B12A 4YFJA 4PSXA 3JUWA 2OZUA 3S6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQH A;  3CXQ A;  2VI7 A;  2J8N A;  4AVB A;  2PR8 A;  2ZW4 A;  4KOR A;  1XE4 A;  1YX0 A;  3W6S A;  5F48 A;  2ZW6 A;  3R9G A;  4Y49 B;  4KOY A;  3WR7 A;  2VZZ A;  1RO5 A;  3DNS A;  2WPW A;  3T90 A;  4NXY A;  2FE7 A;  4GS4 A;  5IB0 A;  4XPD C;  3B8G A;  4PK3 A;  2D4O A;  1M4I A;  1B87 A;  1VHS A;  3UY5 A;  1QSR A;  2P6E A;  1IIC A;  5CNP A;  4QVT A;  3F8K A;  1I1D A;  4MHD A;  4MY3 A;  2VXK A;  3SHP A;  4KVO E;  2GAN A;  2H5M A;  3EC4 A;  5EBV A;  3TOA A;  2B4D B;  4F6A A;  1Y9K A;  4U5Y A;  4HKF A;  1I21 A;  3NE7 A;  1M4G A;  1NSL A;  2FCK A;  2OU2 A;  2J8R A;  5F49 A;  4CAV A;  1M4D A;  3MGD A;  4KUA A;  4MBU A;  4KVM E;  5J8F A;  3FB3 A;  4HNY B;  3T9Y A;  1Q2Y A;  3H4Q A;  2ZW5 A;  3FXT A;  1QSN A;  2VBQ A;  1PU9 A;  4JXQ A;  1YVK A;  2RC4 A;  1OZP A;  1UFH A;  1NMT A;  4HNX B;  3G3S A;  4JWP A;  2Q44 A;  3JVN A;  3KKW A;  5C88 A;  5DWM A;  4MY0 A;  4ORF A;  4E8O A;  2PRB A;  4OLL A;  1VKC A;  4YRH A;  3R9F A;  4JXR A;  2VZY A;  3I3G A;  1YR0 A;  2B4D A;  1WK4 A;  2Q7B A;  3TO7 A;  4L8A A;  2I79 A;  4NF1 A;  4XPD B;  3TO6 A;  3FIX A;  4FD7 A;  5J8C A;  2ARH A;  1MJB A;  2BUE A;  4NEX A;  4F0Y A;  3P2H A;  2I00 A;  2P0W A;  2Y0M A;  3D2M A;  5KTC A;  1XMT A;  2F5I A;  3C26 A;  2FL4 A;  3PZJ A;  3K9U A;  2Z11 A;  1KZF A;  3R9E A;  3RYO A;  4EVY A;  4ZBG A;  4QBJ A;  3W6X A;  1CJW A;  1XIX A;  1YLE A;  1CM0 A;  1GHE A;  2CNT A;  3LOD A;  1N71 A;  2K5T A;  4UBR A;  2NMT A;  2G3T A;  4KUB A;  4M3S A;  3GKR A;  2O28 A;  1Z4R A;  3EO4 A;  4KVX A;  2VEZ A;  4BMH A;  4KOT A;  2CNM A;  3R96 A;  4LX9 A;  4H6Z A;  3TTH A;  4RS2 A;  4CAW A;  1S60 A;  4PV6 A;  4XNH C;  2P6G A;  5KTD A;  1V0C A;  2OZH A;  2ZPA A;  3SXN A;  3VWE A;  4JLY A;  1U6M A;  5H86 A;  1WWZ A;  1M1D A;  3EFA A;  3ZJ0 A;  4KOX A;  3LD2 A;  4X5K A;  3D8P A;  2Z10 A;  4H6U A;  4AB7 A;  1B6B A;  2Q4Y A;  2IL4 A;  2D4P A;  4E0A A;  2JEV A;  2B58 A;  2G3A A;  2PC1 A;  3GYA A;  5KTA A;  1MJA A;  3BJ8 A;  3QAH A;  2B5G B;  3TT2 A;  1MK4 A;  3F0A A;  4FD6 A;  4CAX A;  4R87 A;  5ISV A;  4L89 A;  1Y7R A;  1IYL A;  3BLN A;  4HNW B;  2B3V A;  3F5B A;  1FY7 A;  2FT0 A;  4II9 A;  1Y9W A;  2PSW A;  2R1I A;  4CS0 B;  3IWG A;  1IYK A;  4H89 A;  2EUI A;  5F46 A;  5EC4 A;  3I9S A;  4B5O A;  3CXP A;  4AG7 A;  1ON0 A;  3D2P A;  1YK3 A;  5JQ4 A;  1P4N A;  4E2A A;  5IX3 A;  3FYN A;  2JLM A;  2R8V A;  3PP9 A;  4R9M A;  2Z0Z A;  3E0K A;  4UWJ A;  4KLW A;  4JD6 A;  3P2F A;  1TIQ A;  4RI1 A;  4UWI A;  2J8M A;  4PK2 A;  4NSQ A;  2FSR A;  4OAD A;  4XNH B;  2Q0Y A;  2B5G A;  3PGP A;  4KOW A;  1P0H A;  2G0B A;  4K30 A;  4I49 A;  3DDD A;  1YRE A;  1S3Z A;  1S7L A;  1I12 A;  2CNS A;  4NCZ A;  3DR8 A;  2OH1 A;  2FXF A;  3FRM A;  1S7N A;  1S5K A;  2JDD A;  4B5P B;  4MI4 A;  3FBU A;  2HV2 A;  4CRY B;  3ZZI A;  1QSO A;  3TCV A;  2DXQ A;  2CY2 A;  5HH1 A;  3W91 A;  2P6F A;  3GY9 A;  3OWC A;  4R3L A;  2AJ6 A;  3D3S A;  5C82 A;  2AE6 A;  3S6H A;  5IV0 A;  3TO9 A;  3BJ7 A;  5H84 A;  2BEI A;  2GIV A;  1S7K A;  2ZW7 A;  4U9Y A;  2EVN A;  3QB8 A;  1XEB A;  2OZG A;  4YGO A;  2REE A;  4AG9 A;  2KCW A;  1Q2C A;  1Q2D A;  3N7Z A;  4DNC A;  3FNC A;  1S7F A;  3TOB A;  1RXT A;  1L0C A;  3TE4 A;  1IID A;  2R98 A;  5FVJ A;  5JPH A;  4QB9 A;  1QSM A;  4B5P A;  3EY5 A;  2HQY A;  2Q4V A;  1XF8 A;  2X7B A;  4UA3 A;  2JDC A;  1MJ9 A;  3IGR A;  2A4N A;  4XPK A;  3VWD A;  3G8W A;  4J3G A;  3SXO A;  1J4J A;  4KZT A;  4ONU A;  5HMN A;  1K4J A;  1YGH A;  4OAE A;  4AVC A;  4AVA A;  4CRZ B;  2Q04 A;  2HUZ A;  4FD5 A;  5F47 A;  4R3K A;  4LUA A;  1KUV A;  4IF5 A;  3R95 A;  1Z4E A;  2BL1 A;  3DSB A;  4Y49 C;  2WPX A;  4XPL A;  1M44 A;  1QST A;  3S6F A;  4KLV A;  2R7H A;  4KOV A;  2REF A;  1LRZ A;  2QIR A;  4PSW A;  2OB0 A;  4QC6 A;  3R1K A;  1YVO A;  4FD4 A;  1BOB A;  1KUY A;  2ATR A;  2GE3 A;  3DR6 A;  3V8I A;  1KUX A;  2FIW A;  3CXS A;  2PDO A;  5E96 A;  4MJ8 A;  4JJX A;  2FIA A;  1IB1 E;  5DWN A;  4KOU A;  2PR1 A;  4U9Z A;  2VQY A;  1R57 A;  4KOS A;  5GCN A;  2QML A;  5I0C A;  2BSW A;  4M85 A;  4R57 A;  2B4B A;  1BO4 A;  3TFY A;  2QEC A;  2PQ8 A;  4QUS A;  2ZXV A;  3EXN A;  1PUA A;  3S6K A;  1Z9U A;  2FS5 A;  2B3U A;  1NE9 A;  2C27 A;  4IUS A;  4YFJ A;  4PSX A;  3JUW A;  2OZU A;  3S6G A; 
#chains in the Genus database with same CATH topology
 1BAV A;  2AFU A;  3IU2 A;  4MFP A;  1X10 A;  6CPA A;  1SQH A;  2C6C A;  3CXQ A;  2ZOG A;  2VI7 A;  5LRK A;  2J8N A;  3HUV A;  2V8D A;  2Q4Z A;  3PB6 X;  4AVB A;  2PR8 A;  2ZW4 A;  4KOR A;  5AG5 A;  3RNZ A;  4CYP A;  1XE4 A;  1YX0 A;  3N5F A;  3W6S A;  4A37 A;  4OME A;  3D7G A;  3IC1 A;  5LYD A;  1Y0Y A;  5F48 A;  3QAY A;  2ZW6 A;  3R9G A;  4Y49 B;  4DUK A;  4KOY A;  5EMI A;  3WR7 A;  2VZZ A;  3VH9 A;  1RO5 A;  3IEH A;  2CIJ A;  3DNS A;  3B35 A;  2WPW A;  2PVV A;  3T90 A;  4NXY A;  3MRU A;  2FE7 A;  2PVW A;  4GS4 A;  5CBM A;  1DE4 C;  3D4U A;  5IB0 A;  4XPD C;  3B8G A;  4OC4 A;  4PK3 A;  4F9V A;  4PXE A;  1HEE A;  2D4O A;  4IAV A;  1M4I A;  4OIW A;  1B87 A;  1VHS A;  1Z8W A;  1QSR A;  3UY5 A;  4C7H A;  4NGP A;  4A31 A;  2IJZ A;  2P6E A;  1IIC A;  5CNP A;  4NFR A;  4PXC A;  4QVT A;  3F8K A;  1I1D A;  4MHD A;  1TKH A;  8CPA A;  4MY3 A;  1H8L A;  3FH4 A;  2VXK A;  1Y0R A;  3PFO A;  4X8I A;  5AG6 A;  3SHP A;  4B14 A;  5JM6 A;  1XJO A;  2ZEN A;  3D7H A;  2GAN A;  4KVO E;  4P6Y A;  2H5M A;  5A27 A;  3EC4 A;  5EBV A;  3SJE A;  2B4D B;  3TOA A;  4OID A;  4F6A A;  4JZ0 A;  1Y9K A;  3L2N A;  4P4I A;  1CG2 A;  3K2K A;  4U5Y A;  4HKF A;  3SI0 A;  1ELM P;  1I21 A;  3NE7 A;  1M4G A;  1NSL A;  4AXV A;  1HDU A;  4P4E A;  1XOV A;  2FCK A;  4C2Y A;  2OU2 A;  3I1U A;  5I4M A;  3ISX A;  2C1C A;  3KR4 A;  2J8R A;  2ZEF A;  2POK A;  5F49 A;  4CAV A;  2YNE A;  4CPA A;  4B10 A;  1M4D A;  3MGD A;  3NH4 A;  4KUA A;  4MBU A;  4KVM E;  5J8F A;  3FB3 A;  4MCR A;  2V8G A;  3BI0 A;  2GU2 A;  2AFX A;  1FT7 A;  4HNY B;  2I3C A;  2AFS A;  1Q2Y A;  3T9Y A;  4CGN A;  3H4Q A;  2ZW5 A;  1Y7E A;  3FXT A;  1QSN A;  2VBQ A;  1JWQ A;  1PU9 A;  4JXQ A;  4ZY2 A;  3HLP A;  2HB6 A;  3GB0 A;  4KSA A;  3H8G A;  1KWM A;  3NA6 A;  1YVK A;  2RC4 A;  1OZP A;  3RAM A;  4C68 A;  1UFH A;  1NMT A;  4LQ6 A;  4BD9 A;  4HNX B;  3G3S A;  4KS9 A;  4PPZ A;  4JWP A;  2Q44 A;  3B3W A;  5CPA A;  4FWU A;  1AYE A;  3JVN A;  5JGF A;  4A32 A;  5IB9 A;  3IIB A;  3KKW A;  2DPT A;  2PJB A;  5DWM A;  4MY0 A;  3LAC A;  5DS0 A;  3KR5 A;  5A28 A;  5C88 A;  4UEZ A;  2Z3L A;  2CF4 A;  4MHZ A;  4ORF A;  1VIX A;  3B3V A;  2PRB A;  4OLL A;  4E8O A;  1VKC A;  4YRH A;  3R9F A;  3LWU A;  1YSJ A;  1ZG8 A;  2JBJ A;  2VZY A;  3I3G A;  1YR0 A;  4JXR A;  2GLJ A;  4NGN A;  4A39 A;  3CT9 A;  4KSI A;  4LQG A;  2HC9 A;  2B4D A;  2AFO A;  1WK4 A;  2JEW A;  4R76 A;  1CP6 A;  1VGY A;  2Q7B A;  4UEE A;  3TO7 A;  4L8A A;  2I79 A;  1F2O A;  4NF1 A;  3VAR A;  4XPD B;  1ZLH A;  4NGT A;  3TO6 A;  4MHN A;  1IGB A;  3KGQ A;  1YQE A;  3B2Y A;  3FIX A;  4FD7 A;  5J8C A;  2ARH A;  1MJB A;  1YW6 A;  3B3S A;  1AMP A;  2BUE A;  5K8P A;  4NEX A;  4F0Y A;  2F8H A;  3P2H A;  2I00 A;  1ARL A;  4KSF A;  1ZLI A;  4P4J A;  2P0W A;  2Y0M A;  3D2M A;  5KTC A;  1XMT A;  2F5I A;  3C26 A;  2FL4 A;  4ZY1 A;  3FJU A;  1XBU A;  3PZJ A;  1LAN A;  2XEI A;  3K9U A;  2Q7S A;  2Z11 A;  1QQ9 A;  1EE3 P;  1KZF A;  3PB9 X;  3PRT A;  3R9E A;  3RYO A;  4EVY A;  4ZBG A;  2GLF A;  4QBJ A;  3PBB A;  1CJW A;  3W6X A;  1IOI A;  1XIX A;  4MFL A;  3FMC A;  3D68 A;  4EWT A;  1YLE A;  2ABZ A;  1CM0 A;  1GHE A;  2CTB A;  2O4H A;  1R43 A;  2CNT A;  3S9N A;  3NE8 A;  3LOD A;  2G9D A;  1N71 A;  2K5T A;  4UBR A;  4ZY0 A;  2NMT A;  2G3T A;  4KUB A;  4M3S A;  2CXA A;  4NGS A;  3GKR A;  2PJA A;  2O28 A;  1Z4R A;  2YGW A;  3EO4 A;  4KVX A;  4C2Z A;  3PEI A;  4UCM A;  4ZX8 A;  2EK8 A;  2VEZ A;  1YLO A;  1X12 A;  2NYQ A;  2WSA A;  3KHX A;  4OC0 A;  2PJC A;  2WYR A;  4BMH A;  1IY7 A;  4KOT A;  4CAE A;  2CNM A;  3KI9 A;  3R96 A;  5HVH A;  3PB7 X;  4H6Z A;  4LX9 A;  3DLJ A;  3TTH A;  4RS2 A;  5THW A;  1LAM A;  4CAW A;  4IHM A;  4Z65 A;  2QYV A;  2GFQ A;  1S60 A;  4PV6 A;  4XNH C;  2P6G A;  1BLL E;  5KTD A;  1V0C A;  2OZH A;  3K9T A;  2ZPA A;  3SXN A;  2YNC C;  3PBE A;  3NH5 A;  4G1P A;  2Z3N A;  4CGL A;  5J1Q A;  1PYT B;  4JLY A;  2EK9 A;  3VWE A;  1U6M A;  5H86 A;  3TC8 A;  1LCP A;  5K8M A;  1WWZ A;  2ZEG A;  1M1D A;  3B3C A;  4UEF A;  1TXR A;  2WUU A;  3EFA A;  4NGQ A;  3ZJ0 A;  2PIZ A;  3ISZ A;  3LD2 A;  2Z3K A;  4KOX A;  4NJR A;  4OC5 A;  4X5K A;  2PJ9 A;  3WC5 A;  3D8P A;  2Z10 A;  4H6U A;  4AB7 A;  1B6B A;  2Q4Y A;  2IL4 A;  4MCS A;  4O23 A;  5LYL A;  2D4P A;  4B13 A;  2RFH A;  4E0A A;  3FED A;  2JEV A;  3KQZ A;  2B58 A;  4K3N A;  5D8N A;  2G3A A;  4CGP A;  3H8F A;  4DYO A;  1XMB A;  2PC1 A;  2OR4 A;  4X3R A;  3GYA A;  4F0X A;  1MJA A;  2DEA A;  3BJ8 A;  5KTA A;  3QAH A;  2B5G B;  3TT2 A;  2OOT A;  1MK4 A;  4BIN A;  4UFV A;  3F0A A;  4H2K A;  4FD6 A;  4CAX A;  3GIU A;  3SJX A;  2DPS A;  2V8H A;  4R87 A;  3JRU A;  5ISV A;  4L89 A;  4P4B A;  1Y7R A;  4UFW A;  4UCP A;  1ZG7 A;  1IYL A;  3FEE A;  1Z8L A;  3BLN A;  2B3V A;  1LAP A;  3BXM A;  4HNW B;  1ZG9 A;  3F5B A;  1F57 A;  4MFQ A;  1FY7 A;  2FT0 A;  2FVG A;  3IWE A;  3KHZ A;  5ELY A;  4II9 A;  3BI1 A;  4FAI A;  1Y9W A;  2PSW A;  4FBE A;  2R1I A;  4R6T A;  4CS0 B;  2RB7 A;  2J9A A;  2YND A;  3IWG A;  4CYO A;  1LFW A;  1IYK A;  5K8O A;  4H89 A;  2EUI A;  4B6Z A;  4FUU A;  4RN7 A;  5F46 A;  5EC4 A;  3I9S A;  1LOK A;  4B5O A;  5G21 A;  3CXP A;  4IK2 A;  4AG7 A;  1ON0 A;  4CYQ A;  3D2P A;  1YK3 A;  1FNO A;  5HVG A;  2V77 A;  5JQ4 A;  4A38 A;  1TF9 A;  1P4N A;  2PJ8 A;  2XEJ A;  4E2A A;  5IX3 A;  2BOA A;  3D7D A;  3FYN A;  1ZO0 A;  2JLM A;  2R8V A;  4UFX A;  3PP9 A;  4R9M A;  1OBR A;  4NGM A;  1QMU A;  2Z0Z A;  3E0K A;  4Q7A A;  4UIA A;  4UWJ A;  2JBK A;  4KLW A;  4JD6 A;  2IMO A;  4F8Z A;  4NGR A;  4OKO A;  3P2F A;  1TIQ A;  2NSM A;  4RI1 A;  1R3N A;  2QJ8 A;  4UWI A;  2J8M A;  1CPS A;  4PK2 A;  4NSQ A;  2FSR A;  4OAD A;  4XNH B;  5HXD A;  4WJB A;  3GLJ A;  2Q0Y A;  2B5G A;  3B7I A;  3PGP A;  4KOW A;  1P0H A;  2G0B A;  4K30 A;  1IU8 A;  4I49 A;  4ZI6 A;  4MFZ A;  3DDD A;  1YRE A;  1S3Z A;  1S7L A;  3LMS A;  1I12 A;  2CNS A;  3NFZ A;  4NCZ A;  3IU1 A;  4OP4 A;  4P4F A;  3KQX A;  3DR8 A;  2OH1 A;  2FXF A;  4R8F A;  3FRM A;  1JQG A;  3WC6 A;  1S7N A;  1Z5R A;  1S5K A;  4EFD A;  3RO0 A;  3SJF A;  2JDD A;  4B5P B;  4MI4 A;  3FBU A;  5AG7 A;  2HV2 A;  3D66 A;  4CRY B;  1CBX A;  4MHP A;  2C6G A;  2PJ4 A;  3ZZI A;  1QSO A;  4YU9 A;  3TCV A;  4A95 A;  3GUX A;  2DXQ A;  4CGO A;  1UWY A;  2CY2 A;  3IO1 A;  5HH1 A;  1Z2L A;  1AUG A;  2PJ2 A;  4OC3 A;  3W91 A;  2ZEM A;  4MFJ A;  2P6F A;  5AGE A;  3S9L A;  4A33 A;  2DF5 A;  3GY9 A;  2BO9 A;  2PJ7 A;  4EME A;  3OWC A;  4TWE A;  4R3L A;  2AJ6 A;  4ONW A;  1VHE A;  3D3S A;  5C82 A;  2AE6 A;  1F2P A;  2EWB A;  3S6H A;  1RTQ A;  4CAF A;  5IV0 A;  1BPM A;  3T8W A;  3TO9 A;  3PB4 X;  4UCN A;  2Q43 A;  3BJ7 A;  5H84 A;  2BEI A;  2GIV A;  1BPN A;  1S7K A;  2ZW7 A;  4U9Y A;  2EVN A;  3QB8 A;  5LYF A;  5HVF A;  7CPA A;  1CPX A;  1XEB A;  4C2X A;  3H8E A;  1IOF A;  3PB8 X;  4OC2 A;  4P44 A;  4GXH A;  4GM5 A;  1ELL P;  4C7I A;  2OZG A;  5BWA B;  4YGO A;  3V38 A;  2YNC A;  2REE A;  3IFE A;  3VAT A;  2KCW A;  5LYI A;  4AG9 A;  1Q2C A;  2PIY A;  3SI1 A;  4ZX9 A;  1Q2D A;  1CX8 A;  2ZOF A;  3H5Z A;  3N7Z A;  2XEF A;  4UIB A;  3PFE A;  4DNC A;  5AG4 A;  4ZGY B;  3FNC A;  3FX6 A;  1S7F A;  3TOB A;  1RXT A;  1L0C A;  3FVL A;  3JTK A;  2Z3M A;  4MFK A;  4ZYQ A;  3TE4 A;  3WAB A;  1IID A;  2R98 A;  5FVJ A;  5JPH A;  2C6P A;  4P45 A;  2PJ5 A;  4TNU A;  2O53 A;  4NJQ A;  4QB9 A;  1QSM A;  1HDQ A;  2GRE A;  4B5P A;  4M6I A;  1GYT A;  3EY5 A;  4MXU A;  1M4L A;  3IWW A;  2HQY A;  4F9U A;  2Q4V A;  1XF8 A;  2X7B A;  4UA3 A;  4CGM A;  1DTD A;  2JDC A;  3RZA A;  1MJ9 A;  3IGR A;  5G1Z A;  2A4N A;  2PJ3 A;  5JH9 A;  4XPK A;  3VWD A;  2ANP A;  4P4D A;  4WWV A;  3G8W A;  3A9L A;  4J3G A;  3SXO A;  4MRI A;  3BHX A;  3KL9 A;  1J4J A;  4PQA A;  5F09 A;  5LRJ A;  4KZT A;  4ONU A;  5G22 A;  1K4J A;  5HMN A;  1YGH A;  4OAE A;  4AVC A;  2PJ0 A;  4AVA A;  4CRZ B;  4CYN A;  1YME A;  1VHO A;  2HUZ A;  2Q04 A;  4FD5 A;  5F47 A;  4A94 A;  2ZEP A;  4R3K A;  3FEC A;  4LUA A;  1KUV A;  2AFZ A;  3KAS A;  3IJ3 A;  1TF8 A;  4IF5 A;  3D7F A;  3R95 A;  1Z4E A;  2BL1 A;  3DSB A;  4Y49 C;  2WPX A;  4XPL A;  1M44 A;  1QST A;  3S6F A;  3CPA A;  2R7H A;  4KLV A;  4KOV A;  4MCQ A;  2REF A;  2ZED A;  1LRZ A;  2WZN A;  4PXD A;  4M6H A;  2VL1 A;  2QIR A;  2Z3P A;  3KZW A;  1A2Z A;  4MHY A;  4PSW A;  3TX8 A;  2OB0 A;  2ZEL A;  2ZEH A;  4W9Y A;  4JYW A;  4QC6 A;  4MMO A;  5LRG A;  3R1K A;  3D67 A;  4YWY A;  1YVO A;  2EO8 A;  4FD4 A;  1BOB A;  1KUY A;  2ATR A;  4MCP A;  2GE3 A;  2PJ1 A;  2Z3O A;  4DJL A;  2AFM A;  4Q36 A;  4BBH A;  3DR6 A;  3V8I A;  4RUH A;  2PCU A;  1TKJ A;  4M6G A;  3FF3 A;  1KUX A;  3B3T A;  3QNV A;  2FIW A;  3CXS A;  3S9M A;  1Z8X A;  2PDO A;  5E96 A;  2XEG A;  4MJ8 A;  4JJX A;  2IQ6 A;  5G20 A;  3V7Z A;  2FIA A;  2ZEO A;  1IB1 E;  5DWN A;  2PE3 A;  3WT4 A;  4A2Z A;  4KOU A;  2ZEE A;  3WC7 A;  1Z8T A;  3SJG A;  4P10 A;  5D29 A;  2PR1 A;  2PJ6 A;  4U9Z A;  2VQY A;  1R57 A;  2BCO A;  4KOS A;  1YW4 A;  5GCN A;  1PCA A;  2QML A;  4UF4 A;  4B11 A;  5I0C A;  1XRY A;  2BSW A;  3RBU A;  1TKF A;  4M85 A;  2V8V A;  2B4B A;  1BO4 A;  4R57 A;  4X2T A;  3TFY A;  2PRQ A;  2ODF A;  2QEC A;  2PQ8 A;  3SI2 A;  4QUS A;  4A30 A;  2ZXV A;  4OC1 A;  2F7V A;  2QVP A;  3DGV A;  4R7M A;  3EXN A;  1ARM A;  1CP7 A;  1PUA A;  3CZX A;  3CDX A;  1Q7L A;  3MN8 A;  1Z9U A;  4Q38 A;  4PXB A;  3NH8 A;  3S6K A;  2FS5 A;  1NSA A;  2B3U A;  1NE9 A;  2CTC A;  2C27 A;  2EBJ A;  3CPX A;  4HPS A;  4IUS A;  4B12 A;  1XFO A;  3JUW A;  4PSX A;  2OZU A;  3S6G A;  4YFJ A;  2Q51 A;  2AFW A;  5K8N A; 
#chains in the Genus database with same CATH homology
 3IU2 A;  4MFP A;  1SQH A;  3CXQ A;  2VI7 A;  2J8N A;  4AVB A;  2PR8 A;  2ZW4 A;  4KOR A;  5AG5 A;  4CYP A;  1XE4 A;  1YX0 A;  3W6S A;  5F48 A;  2ZW6 A;  3R9G A;  4Y49 B;  4KOY A;  3WR7 A;  2VZZ A;  1RO5 A;  3DNS A;  2WPW A;  3T90 A;  4NXY A;  2FE7 A;  4GS4 A;  5IB0 A;  4XPD C;  3B8G A;  4PK3 A;  2D4O A;  1M4I A;  1B87 A;  1VHS A;  3UY5 A;  1QSR A;  4C7H A;  4A31 A;  2P6E A;  1IIC A;  5CNP A;  4QVT A;  3F8K A;  1I1D A;  4MHD A;  4MY3 A;  2VXK A;  4B14 A;  5AG6 A;  3SHP A;  4KVO E;  2GAN A;  2H5M A;  5A27 A;  3EC4 A;  5EBV A;  3TOA A;  2B4D B;  4F6A A;  1Y9K A;  4U5Y A;  4HKF A;  1I21 A;  3NE7 A;  1M4G A;  1NSL A;  2FCK A;  4C2Y A;  2OU2 A;  2J8R A;  5F49 A;  4CAV A;  2YNE A;  4B10 A;  1M4D A;  3MGD A;  4KUA A;  4MBU A;  4KVM E;  5J8F A;  3FB3 A;  4HNY B;  3T9Y A;  1Q2Y A;  4CGN A;  3H4Q A;  2ZW5 A;  3FXT A;  1QSN A;  2VBQ A;  1PU9 A;  4JXQ A;  4KSA A;  1YVK A;  2RC4 A;  1OZP A;  4C68 A;  1UFH A;  1NMT A;  4HNX B;  3G3S A;  4KS9 A;  4JWP A;  2Q44 A;  3JVN A;  4A32 A;  3KKW A;  2DPT A;  5A28 A;  5DWM A;  4MY0 A;  5C88 A;  2Z3L A;  4ORF A;  4E8O A;  2PRB A;  4OLL A;  1VKC A;  4YRH A;  3R9F A;  4JXR A;  2VZY A;  3I3G A;  1YR0 A;  2B4D A;  1WK4 A;  2Q7B A;  3TO7 A;  4L8A A;  2I79 A;  4NF1 A;  4XPD B;  3TO6 A;  3FIX A;  4FD7 A;  5J8C A;  2ARH A;  1MJB A;  2BUE A;  4NEX A;  4F0Y A;  3P2H A;  2I00 A;  4KSF A;  2P0W A;  2Y0M A;  3D2M A;  5KTC A;  1XMT A;  2F5I A;  3C26 A;  2FL4 A;  3PZJ A;  3K9U A;  2Z11 A;  1KZF A;  3R9E A;  3RYO A;  4EVY A;  4ZBG A;  4QBJ A;  3W6X A;  1CJW A;  1XIX A;  4MFL A;  1YLE A;  1CM0 A;  1GHE A;  2CNT A;  3LOD A;  1N71 A;  2K5T A;  4UBR A;  2NMT A;  2G3T A;  4KUB A;  4M3S A;  2CXA A;  3GKR A;  2O28 A;  1Z4R A;  2YGW A;  3EO4 A;  4KVX A;  4C2Z A;  4UCM A;  2VEZ A;  2WSA A;  4BMH A;  4KOT A;  4CAE A;  2CNM A;  3R96 A;  4LX9 A;  4H6Z A;  3TTH A;  4RS2 A;  4CAW A;  1S60 A;  4PV6 A;  4XNH C;  2P6G A;  5KTD A;  1V0C A;  2OZH A;  2ZPA A;  3SXN A;  2YNC C;  2Z3N A;  4CGL A;  3VWE A;  4JLY A;  1U6M A;  5H86 A;  1WWZ A;  1M1D A;  2WUU A;  3EFA A;  3ZJ0 A;  4KOX A;  3LD2 A;  2Z3K A;  4X5K A;  3D8P A;  2Z10 A;  4H6U A;  4AB7 A;  1B6B A;  2Q4Y A;  2IL4 A;  2D4P A;  4B13 A;  4E0A A;  2JEV A;  2B58 A;  4CGP A;  2G3A A;  4F0X A;  2PC1 A;  3GYA A;  5KTA A;  1MJA A;  3BJ8 A;  3QAH A;  2B5G B;  3TT2 A;  1MK4 A;  4UFV A;  3F0A A;  4FD6 A;  4CAX A;  2DPS A;  4R87 A;  5ISV A;  4L89 A;  4UFW A;  1Y7R A;  4UCP A;  1IYL A;  3BLN A;  4HNW B;  2B3V A;  3F5B A;  4MFQ A;  1FY7 A;  2FT0 A;  3IWE A;  4II9 A;  1Y9W A;  2PSW A;  2R1I A;  4CS0 B;  2YND A;  3IWG A;  4CYO A;  1IYK A;  4H89 A;  2EUI A;  5F46 A;  5EC4 A;  3I9S A;  4B5O A;  5G21 A;  3CXP A;  4AG7 A;  1ON0 A;  4CYQ A;  3D2P A;  1YK3 A;  5JQ4 A;  1P4N A;  4E2A A;  5IX3 A;  3FYN A;  1ZO0 A;  2JLM A;  2R8V A;  4UFX A;  3PP9 A;  4R9M A;  2Z0Z A;  3E0K A;  4UWJ A;  4KLW A;  4JD6 A;  3P2F A;  1TIQ A;  4RI1 A;  4UWI A;  2J8M A;  4PK2 A;  4NSQ A;  2FSR A;  4OAD A;  4XNH B;  2Q0Y A;  2B5G A;  3PGP A;  4KOW A;  1P0H A;  2G0B A;  4K30 A;  4I49 A;  4MFZ A;  3DDD A;  1YRE A;  1S3Z A;  1S7L A;  1I12 A;  2CNS A;  4NCZ A;  3IU1 A;  3DR8 A;  2OH1 A;  2FXF A;  3FRM A;  1S7N A;  1S5K A;  2JDD A;  4B5P B;  4MI4 A;  3FBU A;  5AG7 A;  2HV2 A;  4CRY B;  3ZZI A;  1QSO A;  3TCV A;  4A95 A;  2DXQ A;  4CGO A;  2CY2 A;  5HH1 A;  3W91 A;  5AGE A;  4MFJ A;  2P6F A;  4A33 A;  3GY9 A;  3OWC A;  4R3L A;  2AJ6 A;  3D3S A;  5C82 A;  2AE6 A;  3S6H A;  5IV0 A;  4CAF A;  3TO9 A;  4UCN A;  3BJ7 A;  5H84 A;  2BEI A;  2GIV A;  1S7K A;  2ZW7 A;  4U9Y A;  2EVN A;  3QB8 A;  1XEB A;  4C2X A;  4C7I A;  2OZG A;  5BWA B;  4YGO A;  2YNC A;  2REE A;  4AG9 A;  2KCW A;  1Q2C A;  1Q2D A;  3H5Z A;  3N7Z A;  4DNC A;  5AG4 A;  4ZGY B;  3FNC A;  1S7F A;  3TOB A;  1RXT A;  1L0C A;  3JTK A;  4MFK A;  2Z3M A;  3TE4 A;  1IID A;  2R98 A;  5FVJ A;  5JPH A;  4QB9 A;  1QSM A;  4B5P A;  3EY5 A;  2HQY A;  2Q4V A;  1XF8 A;  2X7B A;  4UA3 A;  4CGM A;  2JDC A;  1MJ9 A;  3IGR A;  5G1Z A;  2A4N A;  4XPK A;  3VWD A;  3G8W A;  3A9L A;  4J3G A;  3SXO A;  1J4J A;  4KZT A;  4ONU A;  5G22 A;  1K4J A;  5HMN A;  1YGH A;  4OAE A;  4AVC A;  4AVA A;  4CRZ B;  4CYN A;  2Q04 A;  2HUZ A;  4FD5 A;  5F47 A;  4R3K A;  4LUA A;  1KUV A;  4IF5 A;  3R95 A;  1Z4E A;  2BL1 A;  3DSB A;  4Y49 C;  2WPX A;  4XPL A;  1M44 A;  1QST A;  3S6F A;  4KLV A;  2R7H A;  4KOV A;  2REF A;  1LRZ A;  2QIR A;  2Z3P A;  4PSW A;  2OB0 A;  4QC6 A;  3R1K A;  1YVO A;  4FD4 A;  1BOB A;  1KUY A;  2ATR A;  2GE3 A;  2Z3O A;  4Q36 A;  4BBH A;  3DR6 A;  3V8I A;  1KUX A;  2FIW A;  3CXS A;  2PDO A;  5E96 A;  4MJ8 A;  4JJX A;  5G20 A;  2FIA A;  1IB1 E;  5DWN A;  4A2Z A;  4KOU A;  2PR1 A;  4U9Z A;  2VQY A;  1R57 A;  4KOS A;  5GCN A;  2QML A;  4B11 A;  5I0C A;  2BSW A;  4M85 A;  4R57 A;  2B4B A;  1BO4 A;  3TFY A;  4A30 A;  2QEC A;  2PQ8 A;  4QUS A;  2ZXV A;  3EXN A;  1PUA A;  4Q38 A;  3S6K A;  1Z9U A;  2FS5 A;  2B3U A;  1NE9 A;  2C27 A;  4IUS A;  4B12 A;  4YFJ A;  4PSX A;  3JUW A;  2OZU A;  3S6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...