4F0YA

Crystal structure of aminoglycoside antibiotic 6'-n-acetyltransferase aac(6')-ig from acinetobacter haemolyticus, apo
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
145
structure length
145
Chain Sequence
MNIKPASEASLKDWLELRNKLWSDSEASHLQEMHQLLAEKYALQLLAYSDHQAIAMLEASIRFEYVNGTETSPVGFLEGIYVLPAHRRSGVATMLIRQAEVWAKQFSCTEFASDAALDNVISHAMHRSLGFQETEKVVYFSKKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Characterization of Acinetobacter spp. Aminoglycoside Acetyltransferases Highlights Functional and Evolutionary Variation among Antibiotic Resistance Enzymes.
pubmed doi rcsb
source organism Acinetobacter haemolyticus
molecule tags Transferase
molecule keywords Aminoglycoside N(6')-acetyltransferase type 1
total genus 38
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2012-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4f0yA00
3S6HA 2PSWA 3IGRA 4QBJA 4UA3A 2QMLA 2QECA 3R9GA 4KOSA 4JXRA 4IUSA 2HV2A 2VBQA 4CAVA 4L8AA 1MJBA 2Q4VA 2ZW4A 2OB0A 4QC6A 4HNWB 3D2MA 4MHDA 3I3GA 1L0CA 1Q2YA 1K4JA 2O28A 4NCZA 3BLNA 2P0WA 4H6UA 4HKFA 4JWPA 4H89A 4YFJA 1R57A 2BSWA 1RXTA 4B5PA 3PP9A 3JVNA 5KTAA 3R1KA 2Q7BA 3GY9A 2VZZA 1Z4RA 1B87A 4EVYA 1BOBA 1SQHA 4XPLA 3EC4A 4UWIA 3R95A 3P2FA 5KTDA 3TE4A 2G0BA 4KVME 4MY3A 1M4IA 3W91A 5CNPA 4KOXA 1TIQA 2Y0MA 2PR1A 1NSLA 1ON0A 1QSOA 1U6MA 3P2HA 4JLYA 4AB7A 4LX9A 3DDDA 3D8PA 4KUBA 4PK2A 4E8OA 4KLVA 4U9YA 1S7NA 3R9EA 4Y49B 4PSXA 5HMNA 4R57A 3S6FA 2I79A 5J8FA 2C27A 4AG7A 2WPWA 3S6KA 3OWCA 1QSTA 5JQ4A 1NE9A 3H4QA 2Q04A 1I1DA 4KORA 4ONUA 4KOWA 2FS5A 4YGOA 3W6XA 2Z11A 3DR6A 5IX3A 2CNMA 3D2PA 3MGDA 4XNHC 3EY5A 1MJAA 2B3VA 2Q44A 2PQ8A 4MI4A 4UBRA 1KUXA 4Y49C 1IB1E 3BJ7A 3K9UA 2D4OA 4MJ8A 3G3SA 1FY7A 2ZW5A 2I00A 4B5OA 1M4DA 1RO5A 2JDDA 4H6ZA 3DNSA 4RI1A 4BMHA 3T9YA 5EC4A 1WWZA 3TOBA 2VEZA 1S7KA 2WPXA 5E96A 3PGPA 4QVTA 3IWGA 1CM0A 2OZHA 1NMTA 1PUAA 2OZGA 2Q4YA 3DSBA 4KUAA 3VWDA 5IB0A 2FE7A 4X5KA 5C82A 1J4JA 2CNTA 4RS2A 1S7FA 2X7BA 5DWMA 1S60A 2H5MA 4DNCA 2BL1A 1XE4A 3V8IA 5EBVA 4NXYA 3B8GA 2AE6A 1Q2DA 3C26A 2REFA 1KZFA 4JD6A 3EO4A 4XPDB 4OLLA 5ISVA 1M1DA 2GIVA 4JJXA 3F8KA 5JPHA 2J8MA 4AVCA 5IV0A 3LD2A 4B5PB 3T90A 1IYKA 3CXQA 2VXKA 4KOUA 4YRHA 1YGHA 4HNXB 3GKRA 4LUAA 4KVXA 4OADA 2DXQA 4KOVA 1S3ZA 3EFAA 2B5GA 2R8VA 1GHEA 1Q2CA 4MBUA 4HNYB 2A4NA 1XEBA 5H86A 2NMTA 4AVBA 2P6FA 2VQYA 3JUWA 4ZBGA 2ATRA 3LODA 4R3LA 2FIAA 2VZYA 3FRMA 4KOTA 1WK4A 1S5KA 2EUIA 5F46A 3QB8A 1UFHA 3BJ8A 3CXPA 4K30A 3D3SA 3FBUA 3E0KA 2B4DB 2B3UA 1KUVA 2P6EA 3TT2A 2OU2A 1I21A 3DR8A 1QSMA 1N71A 2B4DA 2ZW7A 3FXTA 3SHPA 3G8WA 4E2AA 4PSWA 1XF8A 1VHSA 2GANA 4FD5A 1I12A 3TO9A 1VKCA 2JLMA 2PC1A 1M4GA 4QUSA 1CJWA 4CRZB 2ZW6A 4CRYB 1IICA 4CS0B 2K5TA 3ZZIA 2PRBA 3QAHA 3TFYA 1YX0A 1Y9WA 4F0YA 3UY5A 2FXFA 2J8RA 2JDCA 2PR8A 1P4NA 3PZJA 2FSRA 1IYLA 1Y9KA 2R7HA 4M85A 3SXOA 3CXSA 2Z10A 4OAEA 1PU9A 3TOAA 1P0HA 3FYNA 4R87A 5J8CA 4KVOE 5KTCA 1Y7RA 1Z9UA 4XNHB 1KUYA 5FVJA 2REEA 2BUEA 3F5BA 2B4BA 1V0CA 5HH1A 4FD6A 3FIXA 4JXQA 1S7LA 4R9MA 4L89A 5F47A 4UWJA 2OZUA 3KKWA 1YK3A 2B5GB 2CNSA 4F6AA 2R98A 3GYAA 1YVKA 2B58A 3RYOA 2ZPAA 4E0AA 1YVOA 4NSQA 2AJ6A 4XPKA 4NEXA 3VWEA 3WR7A 2PDOA 4U5YA 4KOYA 3S6GA 4U9ZA 1OZPA 1Z4EA 1IIDA 4AVAA 1BO4A 1QSRA 1LRZA 3FB3A 4PV6A 3I9SA 5DWNA 1MJ9A 4NF1A 2EVNA 4II9A 3ZJ0A 4CAXA 4FD7A 1MK4A 2IL4A 1XMTA 2QIRA 2CY2A 3NE7A 5H84A 4R3KA 4I49A 3TTHA 2HQYA 2HUZA 4FD4A 2P6GA 3TCVA 2ARHA 3W6SA 3R96A 4J3GA 3F0AA 5F49A 2KCWA 5C88A 4PK3A 4GS4A 3R9FA 2BEIA 3TO6A 2VI7A 2Z0ZA 2G3AA 2OH1A 4M3SA 4ORFA 2FL4A 5I0CA 2FT0A 4IF5A 3SXNA 1B6BA 5F48A 2FIWA 4KZTA 2F5IA 2GE3A 4QB9A 4AG9A 2Q0YA 4MY0A 4XPDC 3EXNA 2J8NA 2ZXVA 2R1IA 1M44A 1QSNA 2RC4A 3TO7A 2D4PA 1YREA 3FNCA 4KLWA 5GCNA 4CAWA 3N7ZA 2JEVA 2FCKA 1YR0A 1XIXA 2G3TA 1YLEA
chains in the Genus database with same CATH superfamily
3S6HA 4BD9A 2DPTA 2PSWA 3A9LA 3IGRA 4KSAA 4OC0A 4R7MA 4UA3A 2QMLA 4QBJA 2QJ8A 5LYDA 4A2ZA 2Q7SA 2QECA 4F9UA 1YLEA 4NGSA 3R9GA 4KOSA 4JXRA 3V38A 3K2KA 4IUSA 2HV2A 1F2PA 2VBQA 4CAVA 2AFWA 4L8AA 1NSAA 1MJBA 3SJXA 2Q4VA 2ZW4A 2OB0A 4QC6A 3GLJA 1KWMA 2PJ6A 4OC3A 5HVGA 4P4JA 1TKHA 4HNWB 6CPAA 2CF4A 1BAVA 3D2MA 4MHDA 3I3GA 1L0CA 1Q7LA 1Q2YA 3KZWA 1K4JA 2O28A 1XBUA 4NCZA 3BLNA 1Y0YA 2P0WA 4H6UA 4HKFA 4JWPA 4H89A 2PJCA 2QYVA 3SI0A 4YFJA 4MFPA 4X8IA 4UFWA 1BPMA 1R57A 2BSWA 1RXTA 5AG5A 4B12A 4B5PA 4R8FA 3ISZA 2ZEGA 3PP9A 2Z3OA 1Y0RA 4KSIA 2Q4ZA 3KASA 4UFVA 1XJOA 2RB7A 4W9YA 1Z5RA 2WYRA 3JVNA 5KTAA 4P44A 2PIZA 3R1KA 2V8GA 3PBBA 2Q7BA 3GY9A 1IOIA 2VZZA 4P4BA 1Z4RA 3WC6A 1B87A 3I1UA 1BOBA 1SQHA 4PXCA 2PJAA 4UCNA 4EVYA 4XPLA 3PFEA 3EC4A 4UWIA 3RZAA 3R95A 3P2FA 3CPXA 4AXVA 5KTDA 1CPSA 3FECA 4NGQA 3SJFA 3TE4A 2G0BA 4KVME 1Z8XA 3KGQA 4MY3A 3FMCA 1M4IA 3NFZA 4CAFA 2F7VA 3W91A 4MFLA 4M6GA 5CNPA 4KOXA 5K8MA 1TIQA 1YLOA 2Y0MA 2PR1A 5A28A 1NSLA 1ON0A 2PVVA 4MFQA 1ZG8A 1QSOA 1U6MA 3P2HA 5JM6A 4JLYA 2AFZA 2V8DA 4AB7A 3PRTA 4LX9A 4A33A 3DDDA 3D8PA 4KUBA 3LWUA 4PK2A 4CYNA 4CGLA 4E8OA 2GREA 4KLVA 4U9YA 3WT4A 1S7NA 2PRQA 3R9EA 4Y49B 4CYOA 5LYLA 4PSXA 2Z3PA 5HMNA 4R57A 3S6FA 2I79A 5J8FA 2C27A 4NGRA 4PXDA 4AG7A 1YW6A 1LFWA 1IY7A 1PCAA 2WPWA 3S6KA 3JRUA 4MCSA 3OWCA 1QSTA 2PJ7A 5JQ4A 2CTCA 4B11A 2OR4A 1NE9A 3H8FA 3H4QA 4H2KA 4FBEA 2Q04A 3IWWA 1I1DA 1TF9A 4DUKA 2Z3KA 4TWEA 4KORA 4ONUA 1CP7A 4KOWA 4P6YA 2FS5A 4IK2A 4YGOA 3W6XA 3CDXA 4PXEA 4Q7AA 2Z11A 3DR6A 5THWA 5AG4A 4C2YA 3IFEA 4UF4A 4C68A 5IX3A 2PJ5A 1TF8A 2CNMA 3D2PA 2IMOA 3MGDA 4XNHC 3EY5A 5I4MA 2NSMA 1LAMA 1MJAA 1CPXA 2B3VA 2Q44A 3IO1A 3VARA 2PQ8A 4MI4A 4OIWA 4UBRA 1KUXA 4Y49C 1IB1E 3BJ7A 5K8NA 2POKA 2YNDA 3K9UA 3H8EA 4DJLA 2D4OA 2Z3NA 4MJ8A 4UCPA 4B14A 2ANPA 3G3SA 1FY7A 2ZW5A 2I00A 5JH9A 1EE3P 4B5OA 1M4DA 2J9AA 1RO5A 2JDDA 4IAVA 1ZO0A 3DNSA 4H6ZA 4MHYA 4RI1A 4TNUA 4BMHA 1ZLHA 4A94A 5D8NA 3T9YA 5EC4A 1WWZA 4MCQA 4P45A 4OC1A 5CPAA 2VEZA 2AFSA 1ARMA 4JZ0A 1S7KA 3TOBA 3S9LA 1VIXA 2WPXA 5E96A 3PGPA 4QVTA 2ZENA 2WSAA 3IWGA 3L2NA 1CM0A 2GLFA 3D67A 4NFRA 4UCMA 1R3NA 1NMTA 2OZHA 3SI2A 1YQEA 3FH4A 3KHZA 1PUAA 2OZGA 2Q4YA 3DSBA 4KUAA 3VWDA 5IB0A 3MN8A 4DYOA 2FE7A 4X5KA 2PE3A 4ZX8A 4CPAA 1YMEA 3RNZA 5DS0A 4OMEA 8CPAA 5C82A 1J4JA 2CNTA 1HDQA 4MHNA 3FEDA 4RS2A 1S7FA 2X7BA 5DWMA 1S60A 1M4LA 1TKJA 2H5MA 3K9TA 4DNCA 2BL1A 1XE4A 3V8IA 5EBVA 4ZGYB 4UFXA 2XEGA 5D29A 5K8PA 3IU2A 4NXYA 4C2XA 1ELLP 3B8GA 3D4UA 4ONWA 4CGNA 4B10A 2AE6A 2AFXA 1Q2DA 2DPSA 2ZEOA 3C26A 4UIBA 4CAEA 1ELMP 2REFA 5HXDA 1KZFA 3NH8A 4JD6A 3WC5A 3EO4A 4XPDB 4OLLA 4FUUA 5ISVA 4NGMA 1M1DA 4YU9A 4ZX9A 3RAMA 3S9MA 4A32A 2IJZA 2GIVA 4JJXA 3F8KA 5JPHA 3KL9A 4KSFA 1HEEA 2J8MA 3SJEA 1LAPA 2Q51A 2YNCA 4AVCA 3B3SA 5IV0A 4OP4A 2YGWA 3PB7X 4MMOA 5A27A 2ZEFA 4CYQA 3LD2A 4B5PB 3T90A 4C2ZA 1IYKA 3CXQA 2VXKA 3D7HA 4KOUA 4CGMA 2QVPA 3GB0A 1R43A 2PJ1A 3PB6X 4NGTA 1QMUA 4CGOA 1BLLE 5LRJA 4YRHA 1YGHA 1LOKA 1LCPA 2DF5A 5IB9A 4HNXB 3GKRA 1RTQA 2V8VA 1Z8TA 5LYIA 3PB8X 3IWEA 3H8GA 4LUAA 2C6CA 2WZNA 3IU1A 3FJUA 2DXQA 4KVXA 4OADA 5J1QA 2CTBA 4UEEA 3B2YA 4KOVA 2OOTA 4ZYQA 2GLJA 3DLJA 5ELYA 1S3ZA 3EFAA 2B5GA 4WWVA 1TKFA 5BWAB 2R8VA 3NE8A 1GHEA 1Q2CA 4HPSA 3B3CA 4MBUA 4HNYB 3SI1A 2A4NA 1XEBA 4NJQA 4PPZA 4NGPA 4Q38A 2ABZA 2NMTA 2ZEEA 3H5ZA 5H86A 3WC7A 3T8WA 5EMIA 4C7IA 4AVBA 1X10A 4R76A 2P6FA 2VQYA 4ZI6A 3JUWA 3NH4A 1QQ9A 4MXUA 4ZBGA 1ARLA 2ATRA 3LODA 4R3LA 3SJGA 4C7HA 4A30A 2FIAA 2VZYA 3FRMA 1XMBA 1WK4A 4KOTA 1XFOA 3VH9A 1S5KA 2EUIA 4PXBA 5F46A 3QB8A 2C6GA 1UFHA 3GIUA 3BJ8A 1YW4A 3CXPA 4K30A 4NGNA 3QAYA 3D3SA 3FBUA 3E0KA 2B4DB 2B3UA 1KUVA 2P6EA 2XEFA 3KQZA 2VL1A 3TT2A 2OU2A 1I21A 3DR8A 1ZG9A 4X2TA 1QSMA 5LRKA 1AMPA 1N71A 2B4DA 3FEEA 2ZW7A 4OC2A 2EWBA 1IU8A 2EO8A 3FF3A 3FXTA 3IC1A 3SHPA 3G8WA 5K8OA 4E2AA 2PCUA 4PSWA 1XF8A 1VHSA 2GANA 2CIJA 3TC8A 4FD5A 1X12A 2PJ3A 1I12A 3B35A 3WABA 3CT9A 3TO9A 1VKCA 4CGPA 1AUGA 2JLMA 2PC1A 1ZG7A 2PJ4A 2XEJA 1M4GA 2YNCC 1BPNA 4QUSA 1CJWA 4CRZB 2ZW6A 2DEAA 4ZY2A 3PFOA 4CRYB 3NH5A 1IICA 4CS0B 2V8HA 2K5TA 3ZZIA 5JGFA 2PRBA 3QAHA 3TFYA 1YX0A 1OBRA 1Y9WA 4YWYA 1IOFA 5HVHA 2EK9A 4F0YA 2PIYA 2FXFA 3UY5A 2Z3MA 2AFUA 2BO9A 4FWUA 1F57A 2J8RA 2JDCA 2PR8A 2BCOA 2PJ8A 1P4NA 3PZJA 2ZEDA 2FSRA 2XEIA 1IYLA 1PYTB 1Y9KA 1IGBA 2R7HA 2ZELA 3LMSA 3JTKA 4M85A 4MCPA 4MCRA 3SXOA 1VGYA 3CXSA 5G21A 2Z10A 3IIBA 4R6TA 4OAEA 1PU9A 3TOAA 5AG7A 4EWTA 1P0HA 3FYNA 4R87A 1FT7A 4UIAA 4EFDA 5J8CA 4KVOE 3BI0A 1Y7RA 5KTCA 3N5FA 4OC4A 3V7ZA 3B3TA 1Z9UA 1TXRA 1KUYA 4KS9A 4XNHB 2ZEMA 5FVJA 4K3NA 3S9NA 2REEA 2BUEA 1HDUA 3F5BA 2GU2A 3HLPA 4G1PA 4CYPA 4MHPA 2B4BA 4UEFA 5AG6A 1V0CA 4GXHA 3GUXA 5HH1A 4FD6A 2GFQA 3FIXA 5LRGA 3KR5A 4JXQA 1JQGA 1S7LA 2PJ0A 1Z8LA 2C1CA 1AYEA 4L89A 4OIDA 4R9MA 2IQ6A 5F47A 4UWJA 4A37A 1VHEA 2JEWA 2NYQA 2OZUA 3KKWA 4F8ZA 2ZEPA 1JWQA 2RFHA 1YK3A 4OKOA 2O4HA 4RUHA 3D66A 2B5GB 2V77A 4F0XA 2CNSA 4F6AA 2R98A 2HB6A 4GM5A 4EMEA 2WUUA 2PJ2A 1Z8WA 1YVKA 3GYAA 4IHMA 1VHOA 3B3VA 2B58A 3PEIA 2Q43A 4P4IA 3RYOA 2ZPAA 4E0AA 1DE4C 2C6PA 4MFJA 4ZY1A 1YVOA 4NSQA 3B7IA 2AJ6A 4MHZA 3KQXA 4A31A 4XPKA 1Y7EA 4NEXA 3VWEA 2EBJA 3WR7A 2PDOA 3LACA 2PVWA 2ZOFA 4M6HA 5G20A 5CBMA 1CG2A 2YNEA 2G9DA 2F8HA 4U5YA 3D68A 4KOYA 3S6GA 1XOVA 2ODFA 4U9ZA 3RBUA 4B6ZA 1OZPA 1Z4EA 1IIDA 3BHXA 4AVAA 1GYTA 5AGEA 1BO4A 1QSRA 5G22A 1LRZA 4LQ6A 2PJ9A 2FVGA 3BXMA 2Z3LA 3FB3A 4PV6A 3TX8A 1A2ZA 4FAIA 1Z2LA 2EK8A 3I9SA 5DWNA 1MJ9A 4NF1A 2EVNA 4II9A 3ZJ0A 2BOAA 3VATA 1YSJA 4RN7A 4BINA 4CAXA 4WJBA 4FD7A 1MK4A 3FVLA 4NJRA 2IL4A 1XMTA 4B13A 2QIRA 3KR4A 2CY2A 3NE7A 5H84A 4R3KA 4MFKA 4P4DA 3FX6A 4I49A 1ZLIA 3TTHA 2HQYA 2HUZA 3IJ3A 1H8LA 4MRIA 3IEHA 4A95A 4UEZA 1DTDA 4FD4A 2P6GA 3TCVA 3KI9A 2ARHA 3W6SA 2ZOGA 3KHXA 3R96A 5LYFA 4J3GA 3F0AA 3MRUA 4X3RA 5F49A 2KCWA 5C88A 3D7FA 4PK3A 4GS4A 4MFZA 3B3WA 3D7GA 3R9FA 2BEIA 3TO6A 2VI7A 2Z0ZA 4P10A 4A39A 2G3AA 1F2OA 2OH1A 4M3SA 1CX8A 4ORFA 7CPAA 4OC5A 3NA6A 2FL4A 2PJBA 5G1ZA 5I0CA 2FT0A 4JYWA 3CPAA 4IF5A 4M6IA 4P4FA 4PQAA 3D7DA 1B6BA 5F48A 3SXNA 1LANA 2AFMA 2JBJA 3PBEA 2FIWA 4KZTA 3ISXA 2F5IA 1UWYA 2GE3A 3CZXA 4QB9A 4AG9A 4F9VA 2Q0YA 4MY0A 4XPDC 3DGVA 3EXNA 5HVFA 1CBXA 2J8NA 1CP6A 2ZXVA 4Q36A 2R1IA 1M44A 1QSNA 2RC4A 2JBKA 3BI1A 3TO7A 3HUVA 1XRYA 4P4EA 5F09A 2D4PA 1YREA 4A38A 3FNCA 4KLWA 1FNOA 5GCNA 4CAWA 4LQGA 3N7ZA 2AFOA 2HC9A 4Z65A 3PB4X 2ZEHA 4O23A 2I3CA 2JEVA 2FCKA 3QNVA 1YR0A 4BBHA 1XIXA 3PB9X 4ZY0A 2G3TA 2O53A 2CXAA 3RO0A
chains in the Genus database with same CATH topology
3S6HA 2DPTA 2PSWA 3A9LA 3IGRA 4KSAA 4QBJA 4UA3A 2QMLA 4A2ZA 2QECA 3R9GA 4KOSA 4JXRA 4IUSA 2HV2A 2VBQA 4CAVA 4L8AA 1MJBA 2Q4VA 2ZW4A 2OB0A 4QC6A 4HNWB 3D2MA 4MHDA 3I3GA 1L0CA 1Q2YA 1K4JA 2O28A 4NCZA 3BLNA 2P0WA 4H6UA 4HKFA 4JWPA 4H89A 4YFJA 4MFPA 4UFWA 1R57A 2BSWA 5AG5A 1RXTA 4B12A 4B5PA 3PP9A 2Z3OA 4UFVA 3JVNA 5KTAA 3R1KA 2Q7BA 3GY9A 2VZZA 1Z4RA 1B87A 4EVYA 1BOBA 1SQHA 4UCNA 4XPLA 3EC4A 4UWIA 3R95A 3P2FA 5KTDA 3TE4A 2G0BA 4KVME 4MY3A 1M4IA 4CAFA 3W91A 4MFLA 5CNPA 4KOXA 1TIQA 2Y0MA 2PR1A 5A28A 1NSLA 1ON0A 4MFQA 1QSOA 1U6MA 3P2HA 4JLYA 4AB7A 4LX9A 4A33A 3DDDA 3D8PA 4KUBA 4PK2A 4CYNA 4CGLA 4E8OA 4KLVA 4U9YA 1S7NA 3R9EA 4Y49B 4CYOA 4PSXA 2Z3PA 5HMNA 4R57A 3S6FA 2I79A 5J8FA 2C27A 4AG7A 2WPWA 3S6KA 3OWCA 1QSTA 5JQ4A 4B11A 1NE9A 3H4QA 2Q04A 1I1DA 2Z3KA 4KORA 4ONUA 4KOWA 2FS5A 4YGOA 3W6XA 2Z11A 3DR6A 5AG4A 4C2YA 5IX3A 4C68A 2CNMA 3D2PA 3MGDA 4XNHC 3EY5A 1MJAA 2B3VA 2Q44A 2PQ8A 4MI4A 4UBRA 1KUXA 4Y49C 1IB1E 3BJ7A 2YNDA 3K9UA 2D4OA 2Z3NA 4MJ8A 4UCPA 4B14A 3G3SA 1FY7A 2ZW5A 2I00A 4B5OA 1M4DA 1RO5A 2JDDA 1ZO0A 3DNSA 4H6ZA 4RI1A 4BMHA 3T9YA 5EC4A 1WWZA 3TOBA 2VEZA 1S7KA 2WPXA 5E96A 3PGPA 4QVTA 2WSAA 3IWGA 4UCMA 1CM0A 2OZHA 1NMTA 1PUAA 2OZGA 2Q4YA 3DSBA 4KUAA 3VWDA 5IB0A 2FE7A 4X5KA 5C82A 1J4JA 2CNTA 4RS2A 1S7FA 2X7BA 5DWMA 1S60A 2H5MA 4DNCA 2BL1A 1XE4A 3V8IA 5EBVA 4ZGYB 4UFXA 3IU2A 4NXYA 4C2XA 3B8GA 4CGNA 4B10A 2AE6A 1Q2DA 2DPSA 3C26A 4CAEA 2REFA 1KZFA 4JD6A 3EO4A 4XPDB 4OLLA 5ISVA 1M1DA 4A32A 2GIVA 4JJXA 3F8KA 5JPHA 4KSFA 2J8MA 2YNCA 4AVCA 5IV0A 2YGWA 5A27A 4CYQA 3LD2A 4B5PB 3T90A 4C2ZA 1IYKA 3CXQA 2VXKA 4KOUA 4CGMA 4CGOA 4YRHA 1YGHA 4HNXB 3GKRA 3IWEA 4LUAA 3IU1A 4KVXA 2DXQA 4OADA 4KOVA 1S3ZA 3EFAA 2B5GA 5BWAB 2R8VA 1GHEA 1Q2CA 4MBUA 4HNYB 2A4NA 1XEBA 5H86A 4Q38A 2NMTA 3H5ZA 4C7IA 4AVBA 2P6FA 2VQYA 3JUWA 4ZBGA 2ATRA 3LODA 4R3LA 4C7HA 4A30A 2FIAA 2VZYA 3FRMA 4KOTA 1WK4A 1S5KA 2EUIA 5F46A 3QB8A 1UFHA 3BJ8A 3CXPA 4K30A 3D3SA 3FBUA 3E0KA 2B4DB 2B3UA 1KUVA 2P6EA 3TT2A 2OU2A 1I21A 3DR8A 1QSMA 1N71A 2B4DA 2ZW7A 3FXTA 3SHPA 3G8WA 4E2AA 4PSWA 1XF8A 1VHSA 2GANA 4FD5A 1I12A 3TO9A 1VKCA 4CGPA 2JLMA 2PC1A 1M4GA 2YNCC 4QUSA 1CJWA 4CRZB 2ZW6A 4CRYB 1IICA 4CS0B 2K5TA 3ZZIA 2PRBA 3QAHA 3TFYA 1YX0A 1Y9WA 4F0YA 3UY5A 2FXFA 2Z3MA 2J8RA 2JDCA 2PR8A 1P4NA 3PZJA 2FSRA 1IYLA 1Y9KA 2R7HA 4M85A 3JTKA 3SXOA 3CXSA 5G21A 2Z10A 4OAEA 1PU9A 3TOAA 5AG7A 1P0HA 3FYNA 4R87A 5J8CA 4KVOE 5KTCA 1Y7RA 1Z9UA 4XNHB 1KUYA 4KS9A 5FVJA 2REEA 2BUEA 3F5BA 4CYPA 2B4BA 5AG6A 1V0CA 5HH1A 4FD6A 3FIXA 4JXQA 1S7LA 4R9MA 4L89A 5F47A 4UWJA 2OZUA 3KKWA 1YK3A 2B5GB 4F0XA 2CNSA 4F6AA 2R98A 2WUUA 3GYAA 1YVKA 2B58A 3RYOA 2ZPAA 4E0AA 4MFJA 1YVOA 4NSQA 2AJ6A 4A31A 4XPKA 4NEXA 3VWEA 3WR7A 2PDOA 5G20A 2YNEA 4U5YA 4KOYA 3S6GA 4U9ZA 1OZPA 1Z4EA 1IIDA 4AVAA 5AGEA 1BO4A 1QSRA 5G22A 1LRZA 2Z3LA 3FB3A 4PV6A 3I9SA 5DWNA 1MJ9A 4NF1A 2EVNA 4II9A 3ZJ0A 4CAXA 4FD7A 1MK4A 2IL4A 1XMTA 4B13A 2QIRA 2CY2A 3NE7A 5H84A 4R3KA 4MFKA 4I49A 3TTHA 2HQYA 2HUZA 4A95A 4FD4A 2P6GA 3TCVA 2ARHA 3W6SA 3R96A 4J3GA 3F0AA 5F49A 2KCWA 5C88A 4PK3A 4GS4A 4MFZA 3R9FA 2BEIA 3TO6A 2VI7A 2Z0ZA 2G3AA 2OH1A 4M3SA 4ORFA 2FL4A 5G1ZA 5I0CA 2FT0A 4IF5A 3SXNA 1B6BA 5F48A 2FIWA 4KZTA 2F5IA 2GE3A 4QB9A 4AG9A 2Q0YA 4MY0A 4XPDC 3EXNA 2J8NA 2ZXVA 4Q36A 2R1IA 1M44A 1QSNA 2RC4A 3TO7A 2D4PA 1YREA 3FNCA 4KLWA 5GCNA 4CAWA 3N7ZA 2JEVA 2FCKA 1YR0A 4BBHA 1XIXA 2G3TA 1YLEA 2CXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6H A;  2PSW A;  3IGR A;  4QBJ A;  4UA3 A;  2QML A;  2QEC A;  3R9G A;  4KOS A;  4JXR A;  4IUS A;  2HV2 A;  2VBQ A;  4CAV A;  4L8A A;  1MJB A;  2Q4V A;  2ZW4 A;  2OB0 A;  4QC6 A;  4HNW B;  3D2M A;  4MHD A;  3I3G A;  1L0C A;  1Q2Y A;  1K4J A;  2O28 A;  4NCZ A;  3BLN A;  2P0W A;  4H6U A;  4HKF A;  4JWP A;  4H89 A;  4YFJ A;  1R57 A;  2BSW A;  1RXT A;  4B5P A;  3PP9 A;  3JVN A;  5KTA A;  3R1K A;  2Q7B A;  3GY9 A;  2VZZ A;  1Z4R A;  1B87 A;  4EVY A;  1BOB A;  1SQH A;  4XPL A;  3EC4 A;  4UWI A;  3R95 A;  3P2F A;  5KTD A;  3TE4 A;  2G0B A;  4KVM E;  4MY3 A;  1M4I A;  3W91 A;  5CNP A;  4KOX A;  1TIQ A;  2Y0M A;  2PR1 A;  1NSL A;  1ON0 A;  1QSO A;  1U6M A;  3P2H A;  4JLY A;  4AB7 A;  4LX9 A;  3DDD A;  3D8P A;  4KUB A;  4PK2 A;  4E8O A;  4KLV A;  4U9Y A;  1S7N A;  3R9E A;  4Y49 B;  4PSX A;  5HMN A;  4R57 A;  3S6F A;  2I79 A;  5J8F A;  2C27 A;  4AG7 A;  2WPW A;  3S6K A;  3OWC A;  1QST A;  5JQ4 A;  1NE9 A;  3H4Q A;  2Q04 A;  1I1D A;  4KOR A;  4ONU A;  4KOW A;  2FS5 A;  4YGO A;  3W6X A;  2Z11 A;  3DR6 A;  5IX3 A;  2CNM A;  3D2P A;  3MGD A;  4XNH C;  3EY5 A;  1MJA A;  2B3V A;  2Q44 A;  2PQ8 A;  4MI4 A;  4UBR A;  1KUX A;  4Y49 C;  1IB1 E;  3BJ7 A;  3K9U A;  2D4O A;  4MJ8 A;  3G3S A;  1FY7 A;  2ZW5 A;  2I00 A;  4B5O A;  1M4D A;  1RO5 A;  2JDD A;  4H6Z A;  3DNS A;  4RI1 A;  4BMH A;  3T9Y A;  5EC4 A;  1WWZ A;  3TOB A;  2VEZ A;  1S7K A;  2WPX A;  5E96 A;  3PGP A;  4QVT A;  3IWG A;  1CM0 A;  2OZH A;  1NMT A;  1PUA A;  2OZG A;  2Q4Y A;  3DSB A;  4KUA A;  3VWD A;  5IB0 A;  2FE7 A;  4X5K A;  5C82 A;  1J4J A;  2CNT A;  4RS2 A;  1S7F A;  2X7B A;  5DWM A;  1S60 A;  2H5M A;  4DNC A;  2BL1 A;  1XE4 A;  3V8I A;  5EBV A;  4NXY A;  3B8G A;  2AE6 A;  1Q2D A;  3C26 A;  2REF A;  1KZF A;  4JD6 A;  3EO4 A;  4XPD B;  4OLL A;  5ISV A;  1M1D A;  2GIV A;  4JJX A;  3F8K A;  5JPH A;  2J8M A;  4AVC A;  5IV0 A;  3LD2 A;  4B5P B;  3T90 A;  1IYK A;  3CXQ A;  2VXK A;  4KOU A;  4YRH A;  1YGH A;  4HNX B;  3GKR A;  4LUA A;  4KVX A;  4OAD A;  2DXQ A;  4KOV A;  1S3Z A;  3EFA A;  2B5G A;  2R8V A;  1GHE A;  1Q2C A;  4MBU A;  4HNY B;  2A4N A;  1XEB A;  5H86 A;  2NMT A;  4AVB A;  2P6F A;  2VQY A;  3JUW A;  4ZBG A;  2ATR A;  3LOD A;  4R3L A;  2FIA A;  2VZY A;  3FRM A;  4KOT A;  1WK4 A;  1S5K A;  2EUI A;  5F46 A;  3QB8 A;  1UFH A;  3BJ8 A;  3CXP A;  4K30 A;  3D3S A;  3FBU A;  3E0K A;  2B4D B;  2B3U A;  1KUV A;  2P6E A;  3TT2 A;  2OU2 A;  1I21 A;  3DR8 A;  1QSM A;  1N71 A;  2B4D A;  2ZW7 A;  3FXT A;  3SHP A;  3G8W A;  4E2A A;  4PSW A;  1XF8 A;  1VHS A;  2GAN A;  4FD5 A;  1I12 A;  3TO9 A;  1VKC A;  2JLM A;  2PC1 A;  1M4G A;  4QUS A;  1CJW A;  4CRZ B;  2ZW6 A;  4CRY B;  1IIC A;  4CS0 B;  2K5T A;  3ZZI A;  2PRB A;  3QAH A;  3TFY A;  1YX0 A;  1Y9W A;  4F0Y A;  3UY5 A;  2FXF A;  2J8R A;  2JDC A;  2PR8 A;  1P4N A;  3PZJ A;  2FSR A;  1IYL A;  1Y9K A;  2R7H A;  4M85 A;  3SXO A;  3CXS A;  2Z10 A;  4OAE A;  1PU9 A;  3TOA A;  1P0H A;  3FYN A;  4R87 A;  5J8C A;  4KVO E;  5KTC A;  1Y7R A;  1Z9U A;  4XNH B;  1KUY A;  5FVJ A;  2REE A;  2BUE A;  3F5B A;  2B4B A;  1V0C A;  5HH1 A;  4FD6 A;  3FIX A;  4JXQ A;  1S7L A;  4R9M A;  4L89 A;  5F47 A;  4UWJ A;  2OZU A;  3KKW A;  1YK3 A;  2B5G B;  2CNS A;  4F6A A;  2R98 A;  3GYA A;  1YVK A;  2B58 A;  3RYO A;  2ZPA A;  4E0A A;  1YVO A;  4NSQ A;  2AJ6 A;  4XPK A;  4NEX A;  3VWE A;  3WR7 A;  2PDO A;  4U5Y A;  4KOY A;  3S6G A;  4U9Z A;  1OZP A;  1Z4E A;  1IID A;  4AVA A;  1BO4 A;  1QSR A;  1LRZ A;  3FB3 A;  4PV6 A;  3I9S A;  5DWN A;  1MJ9 A;  4NF1 A;  2EVN A;  4II9 A;  3ZJ0 A;  4CAX A;  4FD7 A;  1MK4 A;  2IL4 A;  1XMT A;  2QIR A;  2CY2 A;  3NE7 A;  5H84 A;  4R3K A;  4I49 A;  3TTH A;  2HQY A;  2HUZ A;  4FD4 A;  2P6G A;  3TCV A;  2ARH A;  3W6S A;  3R96 A;  4J3G A;  3F0A A;  5F49 A;  2KCW A;  5C88 A;  4PK3 A;  4GS4 A;  3R9F A;  2BEI A;  3TO6 A;  2VI7 A;  2Z0Z A;  2G3A A;  2OH1 A;  4M3S A;  4ORF A;  2FL4 A;  5I0C A;  2FT0 A;  4IF5 A;  3SXN A;  1B6B A;  5F48 A;  2FIW A;  4KZT A;  2F5I A;  2GE3 A;  4QB9 A;  4AG9 A;  2Q0Y A;  4MY0 A;  4XPD C;  3EXN A;  2J8N A;  2ZXV A;  2R1I A;  1M44 A;  1QSN A;  2RC4 A;  3TO7 A;  2D4P A;  1YRE A;  3FNC A;  4KLW A;  5GCN A;  4CAW A;  3N7Z A;  2JEV A;  2FCK A;  1YR0 A;  1XIX A;  2G3T A;  1YLE A; 
#chains in the Genus database with same CATH topology
 3S6H A;  4BD9 A;  2DPT A;  2PSW A;  3A9L A;  3IGR A;  4KSA A;  4OC0 A;  4R7M A;  4UA3 A;  2QML A;  4QBJ A;  2QJ8 A;  5LYD A;  4A2Z A;  2Q7S A;  2QEC A;  4F9U A;  1YLE A;  4NGS A;  3R9G A;  4KOS A;  4JXR A;  3V38 A;  3K2K A;  4IUS A;  2HV2 A;  1F2P A;  2VBQ A;  4CAV A;  2AFW A;  4L8A A;  1NSA A;  1MJB A;  3SJX A;  2Q4V A;  2ZW4 A;  2OB0 A;  4QC6 A;  3GLJ A;  1KWM A;  2PJ6 A;  4OC3 A;  5HVG A;  4P4J A;  1TKH A;  4HNW B;  6CPA A;  2CF4 A;  1BAV A;  3D2M A;  4MHD A;  3I3G A;  1L0C A;  1Q7L A;  1Q2Y A;  3KZW A;  1K4J A;  2O28 A;  1XBU A;  4NCZ A;  3BLN A;  1Y0Y A;  2P0W A;  4H6U A;  4HKF A;  4JWP A;  4H89 A;  2PJC A;  2QYV A;  3SI0 A;  4YFJ A;  4MFP A;  4X8I A;  4UFW A;  1BPM A;  1R57 A;  2BSW A;  1RXT A;  5AG5 A;  4B12 A;  4B5P A;  4R8F A;  3ISZ A;  2ZEG A;  3PP9 A;  2Z3O A;  1Y0R A;  4KSI A;  2Q4Z A;  3KAS A;  4UFV A;  1XJO A;  2RB7 A;  4W9Y A;  1Z5R A;  2WYR A;  3JVN A;  5KTA A;  4P44 A;  2PIZ A;  3R1K A;  2V8G A;  3PBB A;  2Q7B A;  3GY9 A;  1IOI A;  2VZZ A;  4P4B A;  1Z4R A;  3WC6 A;  1B87 A;  3I1U A;  1BOB A;  1SQH A;  4PXC A;  2PJA A;  4UCN A;  4EVY A;  4XPL A;  3PFE A;  3EC4 A;  4UWI A;  3RZA A;  3R95 A;  3P2F A;  3CPX A;  4AXV A;  5KTD A;  1CPS A;  3FEC A;  4NGQ A;  3SJF A;  3TE4 A;  2G0B A;  4KVM E;  1Z8X A;  3KGQ A;  4MY3 A;  3FMC A;  1M4I A;  3NFZ A;  4CAF A;  2F7V A;  3W91 A;  4MFL A;  4M6G A;  5CNP A;  4KOX A;  5K8M A;  1TIQ A;  1YLO A;  2Y0M A;  2PR1 A;  5A28 A;  1NSL A;  1ON0 A;  2PVV A;  4MFQ A;  1ZG8 A;  1QSO A;  1U6M A;  3P2H A;  5JM6 A;  4JLY A;  2AFZ A;  2V8D A;  4AB7 A;  3PRT A;  4LX9 A;  4A33 A;  3DDD A;  3D8P A;  4KUB A;  3LWU A;  4PK2 A;  4CYN A;  4CGL A;  4E8O A;  2GRE A;  4KLV A;  4U9Y A;  3WT4 A;  1S7N A;  2PRQ A;  3R9E A;  4Y49 B;  4CYO A;  5LYL A;  4PSX A;  2Z3P A;  5HMN A;  4R57 A;  3S6F A;  2I79 A;  5J8F A;  2C27 A;  4NGR A;  4PXD A;  4AG7 A;  1YW6 A;  1LFW A;  1IY7 A;  1PCA A;  2WPW A;  3S6K A;  3JRU A;  4MCS A;  3OWC A;  1QST A;  2PJ7 A;  5JQ4 A;  2CTC A;  4B11 A;  2OR4 A;  1NE9 A;  3H8F A;  3H4Q A;  4H2K A;  4FBE A;  2Q04 A;  3IWW A;  1I1D A;  1TF9 A;  4DUK A;  2Z3K A;  4TWE A;  4KOR A;  4ONU A;  1CP7 A;  4KOW A;  4P6Y A;  2FS5 A;  4IK2 A;  4YGO A;  3W6X A;  3CDX A;  4PXE A;  4Q7A A;  2Z11 A;  3DR6 A;  5THW A;  5AG4 A;  4C2Y A;  3IFE A;  4UF4 A;  4C68 A;  5IX3 A;  2PJ5 A;  1TF8 A;  2CNM A;  3D2P A;  2IMO A;  3MGD A;  4XNH C;  3EY5 A;  5I4M A;  2NSM A;  1LAM A;  1MJA A;  1CPX A;  2B3V A;  2Q44 A;  3IO1 A;  3VAR A;  2PQ8 A;  4MI4 A;  4OIW A;  4UBR A;  1KUX A;  4Y49 C;  1IB1 E;  3BJ7 A;  5K8N A;  2POK A;  2YND A;  3K9U A;  3H8E A;  4DJL A;  2D4O A;  2Z3N A;  4MJ8 A;  4UCP A;  4B14 A;  2ANP A;  3G3S A;  1FY7 A;  2ZW5 A;  2I00 A;  5JH9 A;  1EE3 P;  4B5O A;  1M4D A;  2J9A A;  1RO5 A;  2JDD A;  4IAV A;  1ZO0 A;  3DNS A;  4H6Z A;  4MHY A;  4RI1 A;  4TNU A;  4BMH A;  1ZLH A;  4A94 A;  5D8N A;  3T9Y A;  5EC4 A;  1WWZ A;  4MCQ A;  4P45 A;  4OC1 A;  5CPA A;  2VEZ A;  2AFS A;  1ARM A;  4JZ0 A;  1S7K A;  3TOB A;  3S9L A;  1VIX A;  2WPX A;  5E96 A;  3PGP A;  4QVT A;  2ZEN A;  2WSA A;  3IWG A;  3L2N A;  1CM0 A;  2GLF A;  3D67 A;  4NFR A;  4UCM A;  1R3N A;  1NMT A;  2OZH A;  3SI2 A;  1YQE A;  3FH4 A;  3KHZ A;  1PUA A;  2OZG A;  2Q4Y A;  3DSB A;  4KUA A;  3VWD A;  5IB0 A;  3MN8 A;  4DYO A;  2FE7 A;  4X5K A;  2PE3 A;  4ZX8 A;  4CPA A;  1YME A;  3RNZ A;  5DS0 A;  4OME A;  8CPA A;  5C82 A;  1J4J A;  2CNT A;  1HDQ A;  4MHN A;  3FED A;  4RS2 A;  1S7F A;  2X7B A;  5DWM A;  1S60 A;  1M4L A;  1TKJ A;  2H5M A;  3K9T A;  4DNC A;  2BL1 A;  1XE4 A;  3V8I A;  5EBV A;  4ZGY B;  4UFX A;  2XEG A;  5D29 A;  5K8P A;  3IU2 A;  4NXY A;  4C2X A;  1ELL P;  3B8G A;  3D4U A;  4ONW A;  4CGN A;  4B10 A;  2AE6 A;  2AFX A;  1Q2D A;  2DPS A;  2ZEO A;  3C26 A;  4UIB A;  4CAE A;  1ELM P;  2REF A;  5HXD A;  1KZF A;  3NH8 A;  4JD6 A;  3WC5 A;  3EO4 A;  4XPD B;  4OLL A;  4FUU A;  5ISV A;  4NGM A;  1M1D A;  4YU9 A;  4ZX9 A;  3RAM A;  3S9M A;  4A32 A;  2IJZ A;  2GIV A;  4JJX A;  3F8K A;  5JPH A;  3KL9 A;  4KSF A;  1HEE A;  2J8M A;  3SJE A;  1LAP A;  2Q51 A;  2YNC A;  4AVC A;  3B3S A;  5IV0 A;  4OP4 A;  2YGW A;  3PB7 X;  4MMO A;  5A27 A;  2ZEF A;  4CYQ A;  3LD2 A;  4B5P B;  3T90 A;  4C2Z A;  1IYK A;  3CXQ A;  2VXK A;  3D7H A;  4KOU A;  4CGM A;  2QVP A;  3GB0 A;  1R43 A;  2PJ1 A;  3PB6 X;  4NGT A;  1QMU A;  4CGO A;  1BLL E;  5LRJ A;  4YRH A;  1YGH A;  1LOK A;  1LCP A;  2DF5 A;  5IB9 A;  4HNX B;  3GKR A;  1RTQ A;  2V8V A;  1Z8T A;  5LYI A;  3PB8 X;  3IWE A;  3H8G A;  4LUA A;  2C6C A;  2WZN A;  3IU1 A;  3FJU A;  2DXQ A;  4KVX A;  4OAD A;  5J1Q A;  2CTB A;  4UEE A;  3B2Y A;  4KOV A;  2OOT A;  4ZYQ A;  2GLJ A;  3DLJ A;  5ELY A;  1S3Z A;  3EFA A;  2B5G A;  4WWV A;  1TKF A;  5BWA B;  2R8V A;  3NE8 A;  1GHE A;  1Q2C A;  4HPS A;  3B3C A;  4MBU A;  4HNY B;  3SI1 A;  2A4N A;  1XEB A;  4NJQ A;  4PPZ A;  4NGP A;  4Q38 A;  2ABZ A;  2NMT A;  2ZEE A;  3H5Z A;  5H86 A;  3WC7 A;  3T8W A;  5EMI A;  4C7I A;  4AVB A;  1X10 A;  4R76 A;  2P6F A;  2VQY A;  4ZI6 A;  3JUW A;  3NH4 A;  1QQ9 A;  4MXU A;  4ZBG A;  1ARL A;  2ATR A;  3LOD A;  4R3L A;  3SJG A;  4C7H A;  4A30 A;  2FIA A;  2VZY A;  3FRM A;  1XMB A;  1WK4 A;  4KOT A;  1XFO A;  3VH9 A;  1S5K A;  2EUI A;  4PXB A;  5F46 A;  3QB8 A;  2C6G A;  1UFH A;  3GIU A;  3BJ8 A;  1YW4 A;  3CXP A;  4K30 A;  4NGN A;  3QAY A;  3D3S A;  3FBU A;  3E0K A;  2B4D B;  2B3U A;  1KUV A;  2P6E A;  2XEF A;  3KQZ A;  2VL1 A;  3TT2 A;  2OU2 A;  1I21 A;  3DR8 A;  1ZG9 A;  4X2T A;  1QSM A;  5LRK A;  1AMP A;  1N71 A;  2B4D A;  3FEE A;  2ZW7 A;  4OC2 A;  2EWB A;  1IU8 A;  2EO8 A;  3FF3 A;  3FXT A;  3IC1 A;  3SHP A;  3G8W A;  5K8O A;  4E2A A;  2PCU A;  4PSW A;  1XF8 A;  1VHS A;  2GAN A;  2CIJ A;  3TC8 A;  4FD5 A;  1X12 A;  2PJ3 A;  1I12 A;  3B35 A;  3WAB A;  3CT9 A;  3TO9 A;  1VKC A;  4CGP A;  1AUG A;  2JLM A;  2PC1 A;  1ZG7 A;  2PJ4 A;  2XEJ A;  1M4G A;  2YNC C;  1BPN A;  4QUS A;  1CJW A;  4CRZ B;  2ZW6 A;  2DEA A;  4ZY2 A;  3PFO A;  4CRY B;  3NH5 A;  1IIC A;  4CS0 B;  2V8H A;  2K5T A;  3ZZI A;  5JGF A;  2PRB A;  3QAH A;  3TFY A;  1YX0 A;  1OBR A;  1Y9W A;  4YWY A;  1IOF A;  5HVH A;  2EK9 A;  4F0Y A;  2PIY A;  2FXF A;  3UY5 A;  2Z3M A;  2AFU A;  2BO9 A;  4FWU A;  1F57 A;  2J8R A;  2JDC A;  2PR8 A;  2BCO A;  2PJ8 A;  1P4N A;  3PZJ A;  2ZED A;  2FSR A;  2XEI A;  1IYL A;  1PYT B;  1Y9K A;  1IGB A;  2R7H A;  2ZEL A;  3LMS A;  3JTK A;  4M85 A;  4MCP A;  4MCR A;  3SXO A;  1VGY A;  3CXS A;  5G21 A;  2Z10 A;  3IIB A;  4R6T A;  4OAE A;  1PU9 A;  3TOA A;  5AG7 A;  4EWT A;  1P0H A;  3FYN A;  4R87 A;  1FT7 A;  4UIA A;  4EFD A;  5J8C A;  4KVO E;  3BI0 A;  1Y7R A;  5KTC A;  3N5F A;  4OC4 A;  3V7Z A;  3B3T A;  1Z9U A;  1TXR A;  1KUY A;  4KS9 A;  4XNH B;  2ZEM A;  5FVJ A;  4K3N A;  3S9N A;  2REE A;  2BUE A;  1HDU A;  3F5B A;  2GU2 A;  3HLP A;  4G1P A;  4CYP A;  4MHP A;  2B4B A;  4UEF A;  5AG6 A;  1V0C A;  4GXH A;  3GUX A;  5HH1 A;  4FD6 A;  2GFQ A;  3FIX A;  5LRG A;  3KR5 A;  4JXQ A;  1JQG A;  1S7L A;  2PJ0 A;  1Z8L A;  2C1C A;  1AYE A;  4L89 A;  4OID A;  4R9M A;  2IQ6 A;  5F47 A;  4UWJ A;  4A37 A;  1VHE A;  2JEW A;  2NYQ A;  2OZU A;  3KKW A;  4F8Z A;  2ZEP A;  1JWQ A;  2RFH A;  1YK3 A;  4OKO A;  2O4H A;  4RUH A;  3D66 A;  2B5G B;  2V77 A;  4F0X A;  2CNS A;  4F6A A;  2R98 A;  2HB6 A;  4GM5 A;  4EME A;  2WUU A;  2PJ2 A;  1Z8W A;  1YVK A;  3GYA A;  4IHM A;  1VHO A;  3B3V A;  2B58 A;  3PEI A;  2Q43 A;  4P4I A;  3RYO A;  2ZPA A;  4E0A A;  1DE4 C;  2C6P A;  4MFJ A;  4ZY1 A;  1YVO A;  4NSQ A;  3B7I A;  2AJ6 A;  4MHZ A;  3KQX A;  4A31 A;  4XPK A;  1Y7E A;  4NEX A;  3VWE A;  2EBJ A;  3WR7 A;  2PDO A;  3LAC A;  2PVW A;  2ZOF A;  4M6H A;  5G20 A;  5CBM A;  1CG2 A;  2YNE A;  2G9D A;  2F8H A;  4U5Y A;  3D68 A;  4KOY A;  3S6G A;  1XOV A;  2ODF A;  4U9Z A;  3RBU A;  4B6Z A;  1OZP A;  1Z4E A;  1IID A;  3BHX A;  4AVA A;  1GYT A;  5AGE A;  1BO4 A;  1QSR A;  5G22 A;  1LRZ A;  4LQ6 A;  2PJ9 A;  2FVG A;  3BXM A;  2Z3L A;  3FB3 A;  4PV6 A;  3TX8 A;  1A2Z A;  4FAI A;  1Z2L A;  2EK8 A;  3I9S A;  5DWN A;  1MJ9 A;  4NF1 A;  2EVN A;  4II9 A;  3ZJ0 A;  2BOA A;  3VAT A;  1YSJ A;  4RN7 A;  4BIN A;  4CAX A;  4WJB A;  4FD7 A;  1MK4 A;  3FVL A;  4NJR A;  2IL4 A;  1XMT A;  4B13 A;  2QIR A;  3KR4 A;  2CY2 A;  3NE7 A;  5H84 A;  4R3K A;  4MFK A;  4P4D A;  3FX6 A;  4I49 A;  1ZLI A;  3TTH A;  2HQY A;  2HUZ A;  3IJ3 A;  1H8L A;  4MRI A;  3IEH A;  4A95 A;  4UEZ A;  1DTD A;  4FD4 A;  2P6G A;  3TCV A;  3KI9 A;  2ARH A;  3W6S A;  2ZOG A;  3KHX A;  3R96 A;  5LYF A;  4J3G A;  3F0A A;  3MRU A;  4X3R A;  5F49 A;  2KCW A;  5C88 A;  3D7F A;  4PK3 A;  4GS4 A;  4MFZ A;  3B3W A;  3D7G A;  3R9F A;  2BEI A;  3TO6 A;  2VI7 A;  2Z0Z A;  4P10 A;  4A39 A;  2G3A A;  1F2O A;  2OH1 A;  4M3S A;  1CX8 A;  4ORF A;  7CPA A;  4OC5 A;  3NA6 A;  2FL4 A;  2PJB A;  5G1Z A;  5I0C A;  2FT0 A;  4JYW A;  3CPA A;  4IF5 A;  4M6I A;  4P4F A;  4PQA A;  3D7D A;  1B6B A;  5F48 A;  3SXN A;  1LAN A;  2AFM A;  2JBJ A;  3PBE A;  2FIW A;  4KZT A;  3ISX A;  2F5I A;  1UWY A;  2GE3 A;  3CZX A;  4QB9 A;  4AG9 A;  4F9V A;  2Q0Y A;  4MY0 A;  4XPD C;  3DGV A;  3EXN A;  5HVF A;  1CBX A;  2J8N A;  1CP6 A;  2ZXV A;  4Q36 A;  2R1I A;  1M44 A;  1QSN A;  2RC4 A;  2JBK A;  3BI1 A;  3TO7 A;  3HUV A;  1XRY A;  4P4E A;  5F09 A;  2D4P A;  1YRE A;  4A38 A;  3FNC A;  4KLW A;  1FNO A;  5GCN A;  4CAW A;  4LQG A;  3N7Z A;  2AFO A;  2HC9 A;  4Z65 A;  3PB4 X;  2ZEH A;  4O23 A;  2I3C A;  2JEV A;  2FCK A;  3QNV A;  1YR0 A;  4BBH A;  1XIX A;  3PB9 X;  4ZY0 A;  2G3T A;  2O53 A;  2CXA A;  3RO0 A; 
#chains in the Genus database with same CATH homology
 3S6H A;  2DPT A;  2PSW A;  3A9L A;  3IGR A;  4KSA A;  4QBJ A;  4UA3 A;  2QML A;  4A2Z A;  2QEC A;  3R9G A;  4KOS A;  4JXR A;  4IUS A;  2HV2 A;  2VBQ A;  4CAV A;  4L8A A;  1MJB A;  2Q4V A;  2ZW4 A;  2OB0 A;  4QC6 A;  4HNW B;  3D2M A;  4MHD A;  3I3G A;  1L0C A;  1Q2Y A;  1K4J A;  2O28 A;  4NCZ A;  3BLN A;  2P0W A;  4H6U A;  4HKF A;  4JWP A;  4H89 A;  4YFJ A;  4MFP A;  4UFW A;  1R57 A;  2BSW A;  5AG5 A;  1RXT A;  4B12 A;  4B5P A;  3PP9 A;  2Z3O A;  4UFV A;  3JVN A;  5KTA A;  3R1K A;  2Q7B A;  3GY9 A;  2VZZ A;  1Z4R A;  1B87 A;  4EVY A;  1BOB A;  1SQH A;  4UCN A;  4XPL A;  3EC4 A;  4UWI A;  3R95 A;  3P2F A;  5KTD A;  3TE4 A;  2G0B A;  4KVM E;  4MY3 A;  1M4I A;  4CAF A;  3W91 A;  4MFL A;  5CNP A;  4KOX A;  1TIQ A;  2Y0M A;  2PR1 A;  5A28 A;  1NSL A;  1ON0 A;  4MFQ A;  1QSO A;  1U6M A;  3P2H A;  4JLY A;  4AB7 A;  4LX9 A;  4A33 A;  3DDD A;  3D8P A;  4KUB A;  4PK2 A;  4CYN A;  4CGL A;  4E8O A;  4KLV A;  4U9Y A;  1S7N A;  3R9E A;  4Y49 B;  4CYO A;  4PSX A;  2Z3P A;  5HMN A;  4R57 A;  3S6F A;  2I79 A;  5J8F A;  2C27 A;  4AG7 A;  2WPW A;  3S6K A;  3OWC A;  1QST A;  5JQ4 A;  4B11 A;  1NE9 A;  3H4Q A;  2Q04 A;  1I1D A;  2Z3K A;  4KOR A;  4ONU A;  4KOW A;  2FS5 A;  4YGO A;  3W6X A;  2Z11 A;  3DR6 A;  5AG4 A;  4C2Y A;  5IX3 A;  4C68 A;  2CNM A;  3D2P A;  3MGD A;  4XNH C;  3EY5 A;  1MJA A;  2B3V A;  2Q44 A;  2PQ8 A;  4MI4 A;  4UBR A;  1KUX A;  4Y49 C;  1IB1 E;  3BJ7 A;  2YND A;  3K9U A;  2D4O A;  2Z3N A;  4MJ8 A;  4UCP A;  4B14 A;  3G3S A;  1FY7 A;  2ZW5 A;  2I00 A;  4B5O A;  1M4D A;  1RO5 A;  2JDD A;  1ZO0 A;  3DNS A;  4H6Z A;  4RI1 A;  4BMH A;  3T9Y A;  5EC4 A;  1WWZ A;  3TOB A;  2VEZ A;  1S7K A;  2WPX A;  5E96 A;  3PGP A;  4QVT A;  2WSA A;  3IWG A;  4UCM A;  1CM0 A;  2OZH A;  1NMT A;  1PUA A;  2OZG A;  2Q4Y A;  3DSB A;  4KUA A;  3VWD A;  5IB0 A;  2FE7 A;  4X5K A;  5C82 A;  1J4J A;  2CNT A;  4RS2 A;  1S7F A;  2X7B A;  5DWM A;  1S60 A;  2H5M A;  4DNC A;  2BL1 A;  1XE4 A;  3V8I A;  5EBV A;  4ZGY B;  4UFX A;  3IU2 A;  4NXY A;  4C2X A;  3B8G A;  4CGN A;  4B10 A;  2AE6 A;  1Q2D A;  2DPS A;  3C26 A;  4CAE A;  2REF A;  1KZF A;  4JD6 A;  3EO4 A;  4XPD B;  4OLL A;  5ISV A;  1M1D A;  4A32 A;  2GIV A;  4JJX A;  3F8K A;  5JPH A;  4KSF A;  2J8M A;  2YNC A;  4AVC A;  5IV0 A;  2YGW A;  5A27 A;  4CYQ A;  3LD2 A;  4B5P B;  3T90 A;  4C2Z A;  1IYK A;  3CXQ A;  2VXK A;  4KOU A;  4CGM A;  4CGO A;  4YRH A;  1YGH A;  4HNX B;  3GKR A;  3IWE A;  4LUA A;  3IU1 A;  4KVX A;  2DXQ A;  4OAD A;  4KOV A;  1S3Z A;  3EFA A;  2B5G A;  5BWA B;  2R8V A;  1GHE A;  1Q2C A;  4MBU A;  4HNY B;  2A4N A;  1XEB A;  5H86 A;  4Q38 A;  2NMT A;  3H5Z A;  4C7I A;  4AVB A;  2P6F A;  2VQY A;  3JUW A;  4ZBG A;  2ATR A;  3LOD A;  4R3L A;  4C7H A;  4A30 A;  2FIA A;  2VZY A;  3FRM A;  4KOT A;  1WK4 A;  1S5K A;  2EUI A;  5F46 A;  3QB8 A;  1UFH A;  3BJ8 A;  3CXP A;  4K30 A;  3D3S A;  3FBU A;  3E0K A;  2B4D B;  2B3U A;  1KUV A;  2P6E A;  3TT2 A;  2OU2 A;  1I21 A;  3DR8 A;  1QSM A;  1N71 A;  2B4D A;  2ZW7 A;  3FXT A;  3SHP A;  3G8W A;  4E2A A;  4PSW A;  1XF8 A;  1VHS A;  2GAN A;  4FD5 A;  1I12 A;  3TO9 A;  1VKC A;  4CGP A;  2JLM A;  2PC1 A;  1M4G A;  2YNC C;  4QUS A;  1CJW A;  4CRZ B;  2ZW6 A;  4CRY B;  1IIC A;  4CS0 B;  2K5T A;  3ZZI A;  2PRB A;  3QAH A;  3TFY A;  1YX0 A;  1Y9W A;  4F0Y A;  3UY5 A;  2FXF A;  2Z3M A;  2J8R A;  2JDC A;  2PR8 A;  1P4N A;  3PZJ A;  2FSR A;  1IYL A;  1Y9K A;  2R7H A;  4M85 A;  3JTK A;  3SXO A;  3CXS A;  5G21 A;  2Z10 A;  4OAE A;  1PU9 A;  3TOA A;  5AG7 A;  1P0H A;  3FYN A;  4R87 A;  5J8C A;  4KVO E;  5KTC A;  1Y7R A;  1Z9U A;  4XNH B;  1KUY A;  4KS9 A;  5FVJ A;  2REE A;  2BUE A;  3F5B A;  4CYP A;  2B4B A;  5AG6 A;  1V0C A;  5HH1 A;  4FD6 A;  3FIX A;  4JXQ A;  1S7L A;  4R9M A;  4L89 A;  5F47 A;  4UWJ A;  2OZU A;  3KKW A;  1YK3 A;  2B5G B;  4F0X A;  2CNS A;  4F6A A;  2R98 A;  2WUU A;  3GYA A;  1YVK A;  2B58 A;  3RYO A;  2ZPA A;  4E0A A;  4MFJ A;  1YVO A;  4NSQ A;  2AJ6 A;  4A31 A;  4XPK A;  4NEX A;  3VWE A;  3WR7 A;  2PDO A;  5G20 A;  2YNE A;  4U5Y A;  4KOY A;  3S6G A;  4U9Z A;  1OZP A;  1Z4E A;  1IID A;  4AVA A;  5AGE A;  1BO4 A;  1QSR A;  5G22 A;  1LRZ A;  2Z3L A;  3FB3 A;  4PV6 A;  3I9S A;  5DWN A;  1MJ9 A;  4NF1 A;  2EVN A;  4II9 A;  3ZJ0 A;  4CAX A;  4FD7 A;  1MK4 A;  2IL4 A;  1XMT A;  4B13 A;  2QIR A;  2CY2 A;  3NE7 A;  5H84 A;  4R3K A;  4MFK A;  4I49 A;  3TTH A;  2HQY A;  2HUZ A;  4A95 A;  4FD4 A;  2P6G A;  3TCV A;  2ARH A;  3W6S A;  3R96 A;  4J3G A;  3F0A A;  5F49 A;  2KCW A;  5C88 A;  4PK3 A;  4GS4 A;  4MFZ A;  3R9F A;  2BEI A;  3TO6 A;  2VI7 A;  2Z0Z A;  2G3A A;  2OH1 A;  4M3S A;  4ORF A;  2FL4 A;  5G1Z A;  5I0C A;  2FT0 A;  4IF5 A;  3SXN A;  1B6B A;  5F48 A;  2FIW A;  4KZT A;  2F5I A;  2GE3 A;  4QB9 A;  4AG9 A;  2Q0Y A;  4MY0 A;  4XPD C;  3EXN A;  2J8N A;  2ZXV A;  4Q36 A;  2R1I A;  1M44 A;  1QSN A;  2RC4 A;  3TO7 A;  2D4P A;  1YRE A;  3FNC A;  4KLW A;  5GCN A;  4CAW A;  3N7Z A;  2JEV A;  2FCK A;  1YR0 A;  4BBH A;  1XIX A;  2G3T A;  1YLE A;  2CXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...